Citrus Sinensis ID: 017425
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 372 | ||||||
| 359485378 | 511 | PREDICTED: probable ubiquitin-conjugatin | 0.889 | 0.647 | 0.515 | 2e-86 | |
| 255553741 | 521 | ubiquitin conjugating enzyme, putative [ | 0.900 | 0.642 | 0.523 | 1e-84 | |
| 118487743 | 526 | unknown [Populus trichocarpa] | 0.916 | 0.648 | 0.509 | 7e-84 | |
| 147852875 | 532 | hypothetical protein VITISV_004820 [Viti | 0.889 | 0.622 | 0.481 | 2e-81 | |
| 356510847 | 481 | PREDICTED: probable ubiquitin-conjugatin | 0.569 | 0.440 | 0.601 | 2e-79 | |
| 302143294 | 472 | unnamed protein product [Vitis vinifera] | 0.787 | 0.620 | 0.486 | 2e-78 | |
| 356528202 | 474 | PREDICTED: probable ubiquitin-conjugatin | 0.545 | 0.428 | 0.586 | 3e-72 | |
| 224121916 | 324 | predicted protein [Populus trichocarpa] | 0.486 | 0.558 | 0.648 | 1e-62 | |
| 115465381 | 509 | Os05g0557600 [Oryza sativa Japonica Grou | 0.782 | 0.571 | 0.405 | 3e-59 | |
| 125553272 | 509 | hypothetical protein OsI_20939 [Oryza sa | 0.782 | 0.571 | 0.402 | 7e-59 |
| >gi|359485378|ref|XP_002274123.2| PREDICTED: probable ubiquitin-conjugating enzyme E2 26-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 325 bits (833), Expect = 2e-86, Method: Compositional matrix adjust.
Identities = 186/361 (51%), Positives = 242/361 (67%), Gaps = 30/361 (8%)
Query: 15 DAILHKLMNFARDKAPSEDSVGDQKA--DLDKGKKKICDDEMWENQVKDASAIDHAKSSS 72
+ +L ++ RD+ P+ S+ ++K +KGK KI DE W+NQ + A A D ++ +
Sbjct: 22 EVVLSDGIHIERDEGPTGLSITEEKVVTGGNKGKSKIDCDETWQNQAQVALAND-VRNPT 80
Query: 73 SESIISKIP----------------NSSNSELSYHDEDDNDDNYGNMDDYADDDYEYDDT 116
SE+ P N NS+LSYHD+D D + DD Y+ +D
Sbjct: 81 SEAGSEDSPDPLKSFASGSSDLININGFNSDLSYHDDDAID----DDDDDDVSGYDDNDD 136
Query: 117 DMYEDNYATMQSQFDNVDLPPGVEASLPWLKDIASSQDVTSVSSTTSISDL-SESKRKAT 175
+Y+D+Y +Q+QFDNVD+PPGVEAS+PWLKD S+ + +V T+ L + R +
Sbjct: 137 FLYDDDYLKLQAQFDNVDIPPGVEASVPWLKDPTPSEKMPAVVDTSPTPSLQGQCARVGS 196
Query: 176 ISYLGESKSKLAFVSHSTASVESISDEKEEKEESRVMANIQGFKQFDTVDDFSDHHYNRM 235
S GE ++K A S ST +S +++ V+ FKQFDTV+DFSDHH++RM
Sbjct: 197 FSDPGEKETKTAATSSSTVPAQSGDGNQDD-----VLGKYLFFKQFDTVEDFSDHHFSRM 251
Query: 236 GFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLF 295
GF+GE+ PPKNWAKKIQEEWKILE++LP+TIFVRV EARM+LLRAV++GP+GTPYHDGLF
Sbjct: 252 GFVGEQ-PPKNWAKKIQEEWKILERDLPETIFVRVYEARMDLLRAVIVGPAGTPYHDGLF 310
Query: 296 VFDCIFPPSYPNEPPSVYYYSGGLRLNPNLYDCGKVCLSLLGTWTGKSTEMWDKNKSTML 355
VFD +FPP+YP+ PP VYYYSGGLRLNPNLYDCGKVCLSLL TW GK TEMW KSTML
Sbjct: 311 VFDVLFPPNYPSVPPMVYYYSGGLRLNPNLYDCGKVCLSLLNTWNGKKTEMWIPGKSTML 370
Query: 356 Q 356
Q
Sbjct: 371 Q 371
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255553741|ref|XP_002517911.1| ubiquitin conjugating enzyme, putative [Ricinus communis] gi|223542893|gb|EEF44429.1| ubiquitin conjugating enzyme, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|118487743|gb|ABK95695.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147852875|emb|CAN79081.1| hypothetical protein VITISV_004820 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356510847|ref|XP_003524145.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|302143294|emb|CBI21855.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356528202|ref|XP_003532694.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 26-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224121916|ref|XP_002330685.1| predicted protein [Populus trichocarpa] gi|222872289|gb|EEF09420.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|115465381|ref|NP_001056290.1| Os05g0557600 [Oryza sativa Japonica Group] gi|49328017|gb|AAT58718.1| putative ubiquitin-conjugating enzyme [Oryza sativa Japonica Group] gi|113579841|dbj|BAF18204.1| Os05g0557600 [Oryza sativa Japonica Group] gi|222632521|gb|EEE64653.1| hypothetical protein OsJ_19507 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|125553272|gb|EAY98981.1| hypothetical protein OsI_20939 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 372 | ||||||
| TAIR|locus:2090096 | 609 | UBC25 "ubiquitin-conjugating e | 0.370 | 0.226 | 0.654 | 1.3e-53 | |
| TAIR|locus:2057589 | 907 | PHO2 "AT2G33770" [Arabidopsis | 0.370 | 0.152 | 0.595 | 2.2e-45 | |
| TAIR|locus:2039380 | 1102 | UBC23 "AT2G16920" [Arabidopsis | 0.368 | 0.124 | 0.568 | 3.4e-40 | |
| UNIPROTKB|F1PG13 | 1138 | UBE2O "Uncharacterized protein | 0.330 | 0.108 | 0.473 | 1.5e-25 | |
| UNIPROTKB|F1P5I5 | 1328 | UBE2O "Uncharacterized protein | 0.349 | 0.097 | 0.468 | 1.8e-25 | |
| UNIPROTKB|F1N3I3 | 1287 | UBE2O "Uncharacterized protein | 0.330 | 0.095 | 0.473 | 2.1e-25 | |
| UNIPROTKB|F1M403 | 1287 | Ube2o "Protein Ube2o" [Rattus | 0.330 | 0.095 | 0.473 | 2.1e-25 | |
| MGI|MGI:2444266 | 1288 | Ube2o "ubiquitin-conjugating e | 0.330 | 0.095 | 0.473 | 2.1e-25 | |
| UNIPROTKB|I3L6C1 | 1294 | UBE2O "Uncharacterized protein | 0.330 | 0.095 | 0.473 | 2.1e-25 | |
| UNIPROTKB|Q9C0C9 | 1292 | UBE2O "Ubiquitin-conjugating e | 0.330 | 0.095 | 0.466 | 5.6e-25 |
| TAIR|locus:2090096 UBC25 "ubiquitin-conjugating enzyme 25" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 512 (185.3 bits), Expect = 1.3e-53, Sum P(2) = 1.3e-53
Identities = 91/139 (65%), Positives = 111/139 (79%)
Query: 218 FKQFDTVDDFSDHHYNRMGFLGEEKPPKNWAKKIQEEWKILEKNLPDTIFVRVCEARMEL 277
FK+FD V+DFSDHHY G ++ K+WAK+IQ+EW+ILEK+LP+ IFVR E+RM+L
Sbjct: 305 FKRFDIVEDFSDHHYASKGTTSKQHS-KDWAKRIQDEWRILEKDLPEMIFVRAYESRMDL 363
Query: 278 LRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPSVYYYSGGLRLNPNLYDCGKVCLSLLG 337
LRAV+IG GTPYHDGLF FD FP +YP+ PP V+Y+SGGLR+NPNLY+CGKVCLSLLG
Sbjct: 364 LRAVIIGAQGTPYHDGLFFFDIFFPDTYPSTPPIVHYHSGGLRINPNLYNCGKVCLSLLG 423
Query: 338 TWTGKSTEMWDKNKSTMLQ 356
TW+G E W N STMLQ
Sbjct: 424 TWSGNQREKWIPNTSTMLQ 442
|
|
| TAIR|locus:2057589 PHO2 "AT2G33770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039380 UBC23 "AT2G16920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PG13 UBE2O "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P5I5 UBE2O "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N3I3 UBE2O "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M403 Ube2o "Protein Ube2o" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2444266 Ube2o "ubiquitin-conjugating enzyme E2O" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L6C1 UBE2O "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9C0C9 UBE2O "Ubiquitin-conjugating enzyme E2 O" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 372 | |||
| cd00195 | 141 | cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca | 2e-25 | |
| pfam00179 | 139 | pfam00179, UQ_con, Ubiquitin-conjugating enzyme | 3e-20 | |
| smart00212 | 145 | smart00212, UBCc, Ubiquitin-conjugating enzyme E2, | 3e-15 | |
| COG5078 | 153 | COG5078, COG5078, Ubiquitin-protein ligase [Posttr | 5e-14 | |
| PLN00172 | 147 | PLN00172, PLN00172, ubiquitin conjugating enzyme; | 2e-07 | |
| PTZ00390 | 152 | PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; | 1e-06 |
| >gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
Score = 99.6 bits (249), Expect = 2e-25
Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
Query: 249 KKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNE 308
K++Q+E K L+K+ P I E + + GP TPY G+F D FP YP +
Sbjct: 2 KRLQKELKDLKKDPPSGISAEPVEENLLEWHGTIRGPPDTPYEGGIFKLDIEFPEDYPFK 61
Query: 309 PPSVYYYSGGLRLNPNLYDCGKVCLSLLGTWT 340
PP V + + +PN+ + GK+CLS+L T
Sbjct: 62 PPKVRFVT--KIYHPNVDENGKICLSILKTHG 91
|
This is part of the ubiquitin-mediated protein degradation pathway in which a thiol-ester linkage forms between a conserved cysteine and the C-terminus of ubiquitin and complexes with ubiquitin protein ligase enzymes, E3. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins) which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways which were omitted from the scope of this CD. Length = 141 |
| >gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 372 | |||
| COG5078 | 153 | Ubiquitin-protein ligase [Posttranslational modifi | 100.0 | |
| KOG0417 | 148 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| PTZ00390 | 152 | ubiquitin-conjugating enzyme; Provisional | 99.97 | |
| PLN00172 | 147 | ubiquitin conjugating enzyme; Provisional | 99.97 | |
| KOG0419 | 152 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.97 | |
| KOG0895 | 1101 | consensus Ubiquitin-conjugating enzyme [Posttransl | 99.96 | |
| PF00179 | 140 | UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP | 99.96 | |
| KOG0426 | 165 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.95 | |
| cd00195 | 141 | UBCc Ubiquitin-conjugating enzyme E2, catalytic (U | 99.95 | |
| KOG0425 | 171 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.95 | |
| KOG0418 | 200 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.94 | |
| smart00212 | 145 | UBCc Ubiquitin-conjugating enzyme E2, catalytic do | 99.94 | |
| KOG0424 | 158 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.94 | |
| KOG0421 | 175 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.92 | |
| KOG0895 | 1101 | consensus Ubiquitin-conjugating enzyme [Posttransl | 99.91 | |
| KOG0422 | 153 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.9 | |
| KOG0894 | 244 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.88 | |
| KOG0427 | 161 | consensus Ubiquitin conjugating enzyme [Posttransl | 99.87 | |
| KOG0416 | 189 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.87 | |
| KOG0423 | 223 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.86 | |
| KOG0420 | 184 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.85 | |
| KOG0428 | 314 | consensus Non-canonical ubiquitin conjugating enzy | 99.73 | |
| KOG0429 | 258 | consensus Ubiquitin-conjugating enzyme-related pro | 99.37 | |
| KOG0896 | 138 | consensus Ubiquitin-conjugating enzyme E2 [Posttra | 98.67 | |
| PF14461 | 133 | Prok-E2_B: Prokaryotic E2 family B | 97.71 | |
| PF08694 | 161 | UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 | 97.48 | |
| PF05743 | 121 | UEV: UEV domain; InterPro: IPR008883 The N-termina | 97.45 | |
| KOG0897 | 122 | consensus Predicted ubiquitin-conjugating enzyme [ | 97.21 | |
| KOG3357 | 167 | consensus Uncharacterized conserved protein [Funct | 96.36 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 96.31 | |
| PF05773 | 113 | RWD: RWD domain; InterPro: IPR006575 The RWD eukar | 95.53 | |
| smart00591 | 107 | RWD domain in RING finger and WD repeat containing | 94.04 | |
| PF14462 | 122 | Prok-E2_E: Prokaryotic E2 family E | 87.5 |
| >COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.1e-34 Score=253.72 Aligned_cols=115 Identities=27% Similarity=0.506 Sum_probs=108.3
Q ss_pred HHHHHHHHHHHHHHhcCCCceEEEecCC-CcceEEEEEECCCCCCCCCcEEEEEEECCCCCCCCCCeEEEeeCCCccccC
Q 017425 246 NWAKKIQEEWKILEKNLPDTIFVRVCEA-RMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPSVYYYSGGLRLNPN 324 (372)
Q Consensus 246 ~a~KRL~kElk~L~k~~P~gIsV~p~Ed-di~~W~vvI~GP~gTPYeGGlF~fdI~FP~dYP~~PPkV~F~T~~~IfHPN 324 (372)
.+.+||++|++.|+++++++|++.+..+ ++++|.++|.||++|||+||.|++.|.||.+||++||+|+|.++ |||||
T Consensus 5 ~a~~RL~kE~~~l~~~~~~~~~a~p~~d~~l~~w~~~i~GP~dtpYegg~f~~~l~fP~~YP~~PPkv~F~t~--i~HPN 82 (153)
T COG5078 5 SALKRLLKELKKLQKDPPPGISAGPVDDDNLFHWEATITGPPDTPYEGGIFKLTLEFPEDYPFKPPKVRFTTK--IFHPN 82 (153)
T ss_pred hHHHHHHHHHHHHhcCCCCceEEEECCCCcceeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCeeeeccC--CcCCC
Confidence 3899999999999999999999999887 99999999999999999999999999999999999999999999 99999
Q ss_pred cCCCCcEEecCCCCcCCCCCCCccchhHH------HHHhhhCCCCCCCCCc
Q 017425 325 LYDCGKVCLSLLGTWTGKSTEMWDKNKST------MLQGRRCPEVTMTMHL 369 (372)
Q Consensus 325 Vy~~GkVCLSLL~TWsG~~~E~WsPa~St------ILQVLlsP~~D~~i~~ 369 (372)
|+.+|+|||++|+ +.|+|+++. |+.+|.+|++++|+|.
T Consensus 83 V~~~G~vCLdIL~-------~~WsP~~~l~sILlsl~slL~~PN~~~Pln~ 126 (153)
T COG5078 83 VDPSGNVCLDILK-------DRWSPVYTLETILLSLQSLLLSPNPDSPLNT 126 (153)
T ss_pred cCCCCCChhHHHh-------CCCCccccHHHHHHHHHHHHcCCCCCCCCCh
Confidence 9999999999998 899999862 4566779999999985
|
|
| >KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00390 ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN00172 ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14461 Prok-E2_B: Prokaryotic E2 family B | Back alignment and domain information |
|---|
| >PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes | Back alignment and domain information |
|---|
| >PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) | Back alignment and domain information |
|---|
| >KOG0897 consensus Predicted ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3357 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) | Back alignment and domain information |
|---|
| >smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain | Back alignment and domain information |
|---|
| >PF14462 Prok-E2_E: Prokaryotic E2 family E | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 372 | ||||
| 3ceg_A | 323 | Crystal Structure Of The Ubc Domain Of Baculoviral | 2e-20 | ||
| 1jas_A | 152 | Hsubc2b Length = 152 | 9e-09 | ||
| 1ayz_A | 169 | Crystal Structure Of The Saccharomyces Cerevisiae U | 2e-08 | ||
| 1q34_A | 163 | Crystal Structures Of Two Ubc (E2) Enzymes Of The U | 4e-08 | ||
| 1z3d_A | 157 | Protein Crystal Growth Improvement Leading To The 2 | 4e-08 | ||
| 1yh2_A | 169 | Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 | 6e-08 | ||
| 2aak_A | 152 | Ubiquitin Conjugating Enzyme From Arabidopsis Thali | 7e-08 | ||
| 2oxq_A | 152 | Structure Of The Ubch5 :chip U-Box Complex Length = | 3e-06 | ||
| 1tte_A | 215 | The Structure Of A Class Ii Ubiquitin-Conjugating E | 5e-06 | ||
| 2ucz_A | 165 | Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy | 8e-06 | ||
| 2r0j_A | 149 | Crystal Structure Of The Putative Ubiquitin Conjuga | 8e-06 | ||
| 1zdn_A | 158 | Ubiquitin-Conjugating Enzyme E2s Length = 158 | 9e-06 | ||
| 3ong_B | 159 | Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 | 9e-06 | ||
| 2f4z_A | 193 | Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw | 9e-06 | ||
| 2ayv_A | 166 | Crystal Structure Of A Putative Ubiquitin-Conjugati | 9e-06 | ||
| 3e95_A | 151 | Crystal Structure Of The Plasmodium Falciparum Ubiq | 9e-06 | ||
| 2gjd_A | 157 | Distinct Functional Domains Of Ubc9 Dictate Cell Su | 1e-05 | ||
| 1fxt_A | 149 | Structure Of A Conjugating Enzyme-Ubiquitin Thioles | 1e-05 | ||
| 1qcq_A | 148 | Ubiquitin Conjugating Enzyme Length = 148 | 2e-05 | ||
| 4ii2_C | 163 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 3e-05 | ||
| 2esq_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 3e-05 | ||
| 3tgd_A | 152 | Crystal Structure Of The Human Ubiquitin-Conjugatin | 4e-05 | ||
| 3bzh_A | 194 | Crystal Structure Of Human Ubiquitin-Conjugating En | 4e-05 | ||
| 2esk_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil | 5e-05 | ||
| 3eb6_B | 149 | Structure Of The Ciap2 Ring Domain Bound To Ubch5b | 5e-05 | ||
| 3l1y_A | 157 | Crystal Structure Of Human Ubc4 E2 Conjugating Enzy | 5e-05 | ||
| 1z2u_A | 150 | The 1.1a Crystallographic Structure Of Ubiquitin- C | 5e-05 | ||
| 1ur6_A | 147 | Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp | 5e-05 | ||
| 1jbb_A | 153 | Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 | 5e-05 | ||
| 3e46_A | 253 | Crystal Structure Of Ubiquitin-Conjugating Enzyme E | 6e-05 | ||
| 2c4o_B | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 6e-05 | ||
| 3l1z_A | 157 | Crystal Structure Of The U-Box Domain Of Human E4b | 6e-05 | ||
| 1jat_A | 155 | Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng | 6e-05 | ||
| 3rpg_A | 149 | Bmi1RING1B-Ubch5c Complex Structure Length = 149 | 6e-05 | ||
| 2fuh_A | 146 | Solution Structure Of The Ubch5cUB NON-Covalent Com | 6e-05 | ||
| 1x23_A | 155 | Crystal Structure Of Ubch5c Length = 155 | 7e-05 | ||
| 2h2y_A | 136 | Crystal Structure Of Ubiquitin Conjugating Enzyme E | 7e-05 | ||
| 2eso_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 8e-05 | ||
| 1y6l_A | 149 | Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 | 9e-05 | ||
| 2esp_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 1e-04 | ||
| 4gpr_A | 151 | Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin | 1e-04 | ||
| 3fsh_A | 168 | Crystal Structure Of The Ubiquitin Conjugating Enzy | 1e-04 | ||
| 2cyx_A | 170 | Structure Of Human Ubiquitin-Conjugating Enzyme E2 | 1e-04 | ||
| 2kly_A | 167 | Solution Structure Of Human Ubiquitin Conjugating E | 2e-04 | ||
| 3h8k_A | 164 | Crystal Structure Of Ube2g2 Complxed With The G2br | 2e-04 | ||
| 2yho_B | 149 | The Idol-Ube2d Complex Mediates Sterol-Dependent De | 2e-04 | ||
| 3oj4_A | 153 | Crystal Structure Of The A20 Znf4, Ubiquitin And Ub | 2e-04 | ||
| 3rcz_B | 163 | Rad60 Sld2 Ubc9 Complex Length = 163 | 2e-04 | ||
| 2c4p_A | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 2e-04 | ||
| 4ddg_A | 399 | Crystal Structure Of Human Otub1UBCH5B~UBUB Length | 3e-04 | ||
| 1kps_A | 159 | Structural Basis For E2-Mediated Sumo Conjugation R | 4e-04 | ||
| 1u9a_A | 160 | Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 | 4e-04 | ||
| 1z5s_A | 158 | Crystal Structure Of A Complex Between Ubc9, Sumo-1 | 4e-04 | ||
| 3jvz_A | 146 | E2~ubiquitin-Hect Length = 146 | 4e-04 | ||
| 2grn_A | 161 | Crystal Structure Of Human Rangap1-Ubc9 Length = 16 | 4e-04 | ||
| 2grr_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-D127s Lengt | 4e-04 | ||
| 2grq_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-D127a Lengt | 4e-04 | ||
| 3k9p_A | 217 | The Crystal Structure Of E2-25k And Ubiquitin Compl | 4e-04 | ||
| 2o25_C | 160 | Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi | 4e-04 | ||
| 3a33_A | 150 | Ubch5b~ubiquitin Conjugate Length = 150 | 5e-04 | ||
| 3a4s_A | 163 | The Crystal Structure Of The Sld2:ubc9 Complex Leng | 5e-04 | ||
| 2gmi_A | 152 | Mms2UBC13~UBIQUITIN Length = 152 | 6e-04 | ||
| 2bep_A | 159 | Crystal Structure Of Ubiquitin Conjugating Enzyme E | 6e-04 | ||
| 1yla_A | 202 | Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington | 7e-04 | ||
| 3k9o_A | 201 | The Crystal Structure Of E2-25k And Ubb+1 Complex L | 7e-04 | ||
| 3ugb_A | 147 | Ubch5c~ubiquitin Conjugate Length = 147 | 7e-04 | ||
| 2c4o_A | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 8e-04 | ||
| 3hct_B | 155 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 9e-04 | ||
| 2c2v_B | 154 | Crystal Structure Of The Chip-Ubc13-Uev1a Complex L | 9e-04 |
| >pdb|3CEG|A Chain A, Crystal Structure Of The Ubc Domain Of Baculoviral Iap Repeat- Containing Protein 6 Length = 323 | Back alignment and structure |
|
| >pdb|1JAS|A Chain A, Hsubc2b Length = 152 | Back alignment and structure |
| >pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 | Back alignment and structure |
| >pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 | Back alignment and structure |
| >pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 | Back alignment and structure |
| >pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 | Back alignment and structure |
| >pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 | Back alignment and structure |
| >pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 | Back alignment and structure |
| >pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 | Back alignment and structure |
| >pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 | Back alignment and structure |
| >pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 | Back alignment and structure |
| >pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 | Back alignment and structure |
| >pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 | Back alignment and structure |
| >pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 | Back alignment and structure |
| >pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 | Back alignment and structure |
| >pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 | Back alignment and structure |
| >pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 | Back alignment and structure |
| >pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 | Back alignment and structure |
| >pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 | Back alignment and structure |
| >pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 | Back alignment and structure |
| >pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 | Back alignment and structure |
| >pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 | Back alignment and structure |
| >pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 | Back alignment and structure |
| >pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 | Back alignment and structure |
| >pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 | Back alignment and structure |
| >pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 | Back alignment and structure |
| >pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 | Back alignment and structure |
| >pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 | Back alignment and structure |
| >pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 | Back alignment and structure |
| >pdb|3E46|A Chain A, Crystal Structure Of Ubiquitin-Conjugating Enzyme E2-25kda (Huntington Interacting Protein 2) M172a Mutant Length = 253 | Back alignment and structure |
| >pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 | Back alignment and structure |
| >pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 | Back alignment and structure |
| >pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 | Back alignment and structure |
| >pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 | Back alignment and structure |
| >pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 | Back alignment and structure |
| >pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 | Back alignment and structure |
| >pdb|2H2Y|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2 From Plasmodium Falciparum Length = 136 | Back alignment and structure |
| >pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 | Back alignment and structure |
| >pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 | Back alignment and structure |
| >pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 | Back alignment and structure |
| >pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 | Back alignment and structure |
| >pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 | Back alignment and structure |
| >pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 | Back alignment and structure |
| >pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 | Back alignment and structure |
| >pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 | Back alignment and structure |
| >pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 | Back alignment and structure |
| >pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 | Back alignment and structure |
| >pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 | Back alignment and structure |
| >pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 | Back alignment and structure |
| >pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 | Back alignment and structure |
| >pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 | Back alignment and structure |
| >pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 | Back alignment and structure |
| >pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 | Back alignment and structure |
| >pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 | Back alignment and structure |
| >pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 | Back alignment and structure |
| >pdb|2GRR|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s Length = 161 | Back alignment and structure |
| >pdb|2GRQ|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a Length = 161 | Back alignment and structure |
| >pdb|3K9P|A Chain A, The Crystal Structure Of E2-25k And Ubiquitin Complex Length = 217 | Back alignment and structure |
| >pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 | Back alignment and structure |
| >pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 | Back alignment and structure |
| >pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 | Back alignment and structure |
| >pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 | Back alignment and structure |
| >pdb|2BEP|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2-25k Length = 159 | Back alignment and structure |
| >pdb|1YLA|A Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington Interacting Protein 2) Length = 202 | Back alignment and structure |
| >pdb|3K9O|A Chain A, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 201 | Back alignment and structure |
| >pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 | Back alignment and structure |
| >pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 | Back alignment and structure |
| >pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 | Back alignment and structure |
| >pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 372 | |||
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 2e-51 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 5e-17 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 7e-17 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 2e-16 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 2e-16 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 2e-15 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 2e-15 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 3e-15 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 3e-15 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 6e-15 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 8e-15 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 1e-14 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 1e-14 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 2e-14 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 2e-14 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 3e-14 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 4e-14 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 5e-14 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 5e-14 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 6e-14 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 7e-14 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 7e-14 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 8e-14 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 1e-13 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 1e-13 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 1e-13 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 2e-13 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 2e-13 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 2e-13 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 2e-13 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 3e-13 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 3e-13 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 3e-13 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 6e-13 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 7e-13 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 8e-13 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 8e-13 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 1e-12 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 2e-12 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 4e-12 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 6e-12 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 9e-12 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 2e-11 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 2e-11 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 4e-11 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 5e-11 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 5e-11 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 6e-11 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 2e-09 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 2e-06 | |
| 3obq_A | 146 | Tumor susceptibility gene 101 protein; protein tra | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 |
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
Score = 173 bits (440), Expect = 2e-51
Identities = 59/191 (30%), Positives = 92/191 (48%), Gaps = 16/191 (8%)
Query: 181 ESKSKLAFVSHSTASVESISDEKEEKEESRVMANIQGFKQFDTVDDFSD--------HHY 232
E K + + E++ VM +Q F F+ V + D +HY
Sbjct: 4 EKKLGEYSKKAAMKPKPLSVLKSLEEKYVAVMKKLQ-FDTFEMVSEDEDGKLGFKVNYHY 62
Query: 233 NRMGFLGEEKPPKNWAKKIQEEWKILEKNLP----DTIFVRVCEARMELLRAVMIGPSGT 288
+ A+++ +E L +LP ++FVR E R+++++ ++ GP+ T
Sbjct: 63 MSQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPADT 122
Query: 289 PYHDGLFVFDCIFPPSYPNEPPSVYYYS---GGLRLNPNLYDCGKVCLSLLGTWTGKSTE 345
PY +G F FD FP YP+ PP V + +R NPNLY+ GKVCLS+L TW G+ E
Sbjct: 123 PYANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEE 182
Query: 346 MWDKNKSTMLQ 356
W+ S+ LQ
Sbjct: 183 KWNPQTSSFLQ 193
|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 | Back alignment and structure |
|---|
| >3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Length = 146 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 372 | |||
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 100.0 | |
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 100.0 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 100.0 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 100.0 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 100.0 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 100.0 | |
| 4gpr_A | 151 | Ubiquitin-conjugating enzyme family protein; ubiqu | 100.0 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 100.0 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 100.0 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 100.0 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 100.0 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 100.0 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 100.0 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 100.0 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 100.0 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 100.0 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 99.98 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 99.98 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 99.98 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 99.98 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 99.97 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 99.97 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 99.97 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 99.97 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 99.97 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 99.97 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 99.97 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 99.97 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 99.97 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 99.97 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 99.97 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 99.97 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 99.97 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 99.97 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 99.97 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 99.97 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 99.97 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 99.97 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 99.97 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 99.97 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 99.96 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 99.96 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 99.96 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 99.96 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 99.96 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 99.96 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 99.96 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 99.96 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 99.95 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 99.95 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 99.95 | |
| 2z6o_A | 172 | UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p | 99.86 | |
| 3kpa_A | 168 | Probable ubiquitin fold modifier conjugating ENZY; | 99.58 | |
| 3r3q_A | 162 | Suppressor protein STP22 of temperature-sensitive | 99.49 | |
| 3obq_A | 146 | Tumor susceptibility gene 101 protein; protein tra | 99.02 | |
| 2ebm_A | 128 | RWD domain-containing protein 1; alpha+beta sandwi | 95.28 | |
| 2day_A | 128 | Ring finger protein 25; ligase, metal-binding, UB1 | 94.71 | |
| 2yz0_A | 138 | Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- | 93.88 | |
| 1ukx_A | 137 | GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple | 91.79 | |
| 2daw_A | 154 | RWD domain containing protein 2; alpha+beta sandwi | 90.02 | |
| 2ebk_A | 128 | RWD domain-containing protein 3; alpha+beta sandwi | 88.27 | |
| 2dax_A | 152 | Protein C21ORF6; RWD domain, alpha+beta sandwich f | 83.9 |
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-33 Score=249.59 Aligned_cols=124 Identities=27% Similarity=0.516 Sum_probs=110.3
Q ss_pred chHHHHHHHHHHHHHHhcCCCceEEEecC-CCcceEEEEEECCCCCCCCCcEEEEEEECCCCCCCCCCeEEEeeCCCccc
Q 017425 244 PKNWAKKIQEEWKILEKNLPDTIFVRVCE-ARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPSVYYYSGGLRLN 322 (372)
Q Consensus 244 ~s~a~KRL~kElk~L~k~~P~gIsV~p~E-ddi~~W~vvI~GP~gTPYeGGlF~fdI~FP~dYP~~PPkV~F~T~~~IfH 322 (372)
++.+.+||++|++.|+++++.||++.+.+ +|++.|+++|.||+||||+||+|+|+|.||++||++||+|+|.|+ +||
T Consensus 2 ~~~a~~RL~kEl~~l~~~~~~gi~~~~~~~~~l~~w~~~i~GP~~tpYegg~f~~~i~fp~~YP~~PP~v~f~t~--i~H 79 (165)
T 2ucz_A 2 SKTAQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPS--ILH 79 (165)
T ss_dssp CHHHHHHHHHHHHHHHHSCCTTEEEEESSSSCCSEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEESSC--CSC
T ss_pred ChHHHHHHHHHHHHHHhCCCCCEEEEECCCCCccEEEEEEECCCCCCccCcEEEEEEECCccCCCCCCEEEEeCC--Ccc
Confidence 35789999999999999999999999865 799999999999999999999999999999999999999999999 999
Q ss_pred cCcCCCCcEEecCCCCcCCC------CCCCccchhHH------HHHhhhCCCCCCCCCc
Q 017425 323 PNLYDCGKVCLSLLGTWTGK------STEMWDKNKST------MLQGRRCPEVTMTMHL 369 (372)
Q Consensus 323 PNVy~~GkVCLSLL~TWsG~------~~E~WsPa~St------ILQVLlsP~~D~~i~~ 369 (372)
|||+.+|+|||++|++|+.. ..+.|+|+++. |..+|.+|++++|+|.
T Consensus 80 PNv~~~G~iCl~iL~~~~~~~~~~~~~~~~W~p~~~i~~vL~si~~ll~~Pn~~~p~n~ 138 (165)
T 2ucz_A 80 PNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANI 138 (165)
T ss_dssp TTBCTTSBBCCGGGSCCCSCTTSTTTTTTSCCTTCCHHHHHHHHHHHHHSCCGGGCCCH
T ss_pred CCCCCCCcEeehhhCCccccccccCCCCCCCCCcCcHHHHHHHHHHHHhCCCCCCchhH
Confidence 99999999999999775422 36899999762 3455668999999874
|
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A | Back alignment and structure |
|---|
| >2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A | Back alignment and structure |
|---|
| >3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 | Back alignment and structure |
|---|
| >3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* | Back alignment and structure |
|---|
| >3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A | Back alignment and structure |
|---|
| >2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A | Back alignment and structure |
|---|
| >2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 372 | ||||
| d1z2ua1 | 147 | d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U | 8e-20 | |
| d2a4da1 | 139 | d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, | 1e-16 | |
| d2a7la1 | 117 | d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 | 2e-16 | |
| d1y6la_ | 148 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H | 7e-16 | |
| d1s1qa_ | 141 | d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 | 2e-15 | |
| d2fo3a1 | 109 | d.20.1.1 (A:9-117) Putative ubiquitin-conjugating | 4e-15 | |
| d2awfa1 | 125 | d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U | 4e-15 | |
| d1j7db_ | 149 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H | 6e-15 | |
| d2ucza_ | 164 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 1e-14 | |
| d1ayza_ | 153 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 2e-14 | |
| d1jata_ | 152 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 3e-14 | |
| d1z3da1 | 149 | d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U | 6e-14 | |
| d1yh2a1 | 154 | d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U | 1e-13 | |
| d1wzva1 | 150 | d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U | 4e-13 | |
| d1zdna1 | 151 | d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U | 8e-13 | |
| d2f4wa1 | 157 | d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, | 9e-13 | |
| d1pzva_ | 161 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N | 2e-12 | |
| d2e2ca_ | 156 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C | 3e-12 | |
| d1i7ka_ | 146 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H | 2e-11 | |
| d2uyza1 | 156 | d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U | 9e-11 | |
| d1y8xa1 | 157 | d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, | 2e-10 | |
| d1fzya_ | 149 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 2e-10 | |
| d1jatb_ | 136 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B | 3e-10 | |
| d2f4za1 | 161 | d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca | 5e-10 | |
| d1c4zd_ | 144 | d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H | 7e-10 | |
| d1uzxa_ | 152 | d.20.1.2 (A:) Vacuolar protein sorting-associated | 1e-09 | |
| d1yrva1 | 148 | d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U | 2e-09 | |
| d2bepa1 | 154 | d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 | 6e-09 | |
| d2z5da1 | 152 | d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, | 5e-07 | |
| d1yf9a1 | 158 | d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, | 3e-06 |
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Ubiquitin conjugating enzyme, UBC species: Caenorhabditis elegans, E2 2 [TaxId: 6239]
Score = 82.9 bits (204), Expect = 8e-20
Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 2/99 (2%)
Query: 249 KKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNE 308
K+IQ+E + L ++ P + +A ++GP +PY G+F FP YP +
Sbjct: 4 KRIQKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFK 63
Query: 309 PPSVYYYSGGLRLNPNLYDCGKVCLSLLGTWTGKSTEMW 347
PP V + + +PN+ G +CL +L + + +
Sbjct: 64 PPKVAFTTR--IYHPNINSNGSICLDILRSQWSPALTIS 100
|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 372 | |||
| d1y6la_ | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.98 | |
| d2ucza_ | 164 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.97 | |
| d1z2ua1 | 147 | Ubiquitin conjugating enzyme, UBC {Caenorhabditis | 99.97 | |
| d1yh2a1 | 154 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d1ayza_ | 153 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.97 | |
| d2e2ca_ | 156 | Ubiquitin conjugating enzyme, UBC {Clam (Spisula s | 99.97 | |
| d2a7la1 | 117 | Ubiquitin-protein ligase W (E2 W) {Human (Homo sap | 99.97 | |
| d1i7ka_ | 146 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d1z3da1 | 149 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 99.97 | |
| d1zdna1 | 151 | Ubiquitin conjugating enzyme, UBC {Human(Homo sapi | 99.97 | |
| d1j7db_ | 149 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d1jata_ | 152 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.97 | |
| d2fo3a1 | 109 | Putative ubiquitin-conjugating enzyme, E2 domain { | 99.97 | |
| d2awfa1 | 125 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d1yrva1 | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d2uyza1 | 156 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d1pzva_ | 161 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 99.97 | |
| d1wzva1 | 150 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.96 | |
| d1fzya_ | 149 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.96 | |
| d2bepa1 | 154 | Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain | 99.96 | |
| d1c4zd_ | 144 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.96 | |
| d2f4za1 | 161 | Hypothetical protein Tgtwinscan_2721, E2 domain {T | 99.95 | |
| d1y8xa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.94 | |
| d2f4wa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.94 | |
| d2a4da1 | 139 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.94 | |
| d2z5da1 | 152 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.93 | |
| d1jatb_ | 136 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.93 | |
| d1yf9a1 | 158 | Ubiquitin conjugating enzyme, UBC {Leishmania majo | 99.93 | |
| d1zuoa1 | 162 | Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom | 99.92 | |
| d1s1qa_ | 141 | Tumor susceptibility gene 101 (TSG101) {Human (Hom | 99.67 | |
| d1uzxa_ | 152 | Vacuolar protein sorting-associated {Baker's yeast | 99.49 | |
| d2in1a1 | 162 | Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie | 97.22 | |
| d2daya1 | 115 | E3 ubiquitin-protein ligase RNF25 {Human (Homo sap | 95.08 | |
| d1ukxa_ | 137 | EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu | 87.66 |
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Ubiquitin conjugating enzyme, UBC species: Human (Homo sapiens), ubch8 [TaxId: 9606]
Probab=99.98 E-value=1.8e-32 Score=236.57 Aligned_cols=115 Identities=23% Similarity=0.409 Sum_probs=107.4
Q ss_pred HHHHHHHHHHHHHHhcCCCceEEEecCCCcceEEEEEECCCCCCCCCcEEEEEEECCCCCCCCCCeEEEeeCCCccccCc
Q 017425 246 NWAKKIQEEWKILEKNLPDTIFVRVCEARMELLRAVMIGPSGTPYHDGLFVFDCIFPPSYPNEPPSVYYYSGGLRLNPNL 325 (372)
Q Consensus 246 ~a~KRL~kElk~L~k~~P~gIsV~p~Eddi~~W~vvI~GP~gTPYeGGlF~fdI~FP~dYP~~PPkV~F~T~~~IfHPNV 325 (372)
++.|||++|++.|++++|.||++.+.++|++.|+++|.||++|||+||+|+|+|.||.+||+.||+|+|+|+ +|||||
T Consensus 2 ~~~kRi~~E~~~l~~~~~~gi~~~~~~~n~~~w~~~i~gp~~t~y~gg~f~~~i~~p~~YP~~pP~v~f~t~--i~HPnv 79 (148)
T d1y6la_ 2 TSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTR--IYHCNI 79 (148)
T ss_dssp HHHHHHHHHHHHHHHSCCTTEEEEESSSCTTEEEEEEECCTTSTTTTCEEEEEEECCTTTTSSCCEEEESSC--CCBTTB
T ss_pred hHHHHHHHHHHHHhhCCCCCEEEEECCcccceeceEEECCCCCCcCCCeEEEEEecCcccCCCCcEEEEeCC--CcCceE
Confidence 578999999999999999999999999999999999999999999999999999999999999999999999 999999
Q ss_pred CCCCcEEecCCCCcCCCCCCCccchhHH------HHHhhhCCCCCCCCCc
Q 017425 326 YDCGKVCLSLLGTWTGKSTEMWDKNKST------MLQGRRCPEVTMTMHL 369 (372)
Q Consensus 326 y~~GkVCLSLL~TWsG~~~E~WsPa~St------ILQVLlsP~~D~~i~~ 369 (372)
+.+|+|||++|. +.|+|++++ |..+|..|++++++|.
T Consensus 80 ~~~G~iCl~~l~-------~~W~p~~~l~~il~~i~~ll~~p~~~~p~n~ 122 (148)
T d1y6la_ 80 NSQGVICLDILK-------DNWSPALTISKVLLSICSLLTDCNPADPLVG 122 (148)
T ss_dssp CTTCBBCCGGGT-------TTCCTTCCHHHHHHHHHHHHHSCCTTSCSSH
T ss_pred CCCCeEEEEecC-------CcCCCcEeHHHHHHHHHHHHhCCCCcccccH
Confidence 999999999997 789999762 4456678999999874
|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|