Citrus Sinensis ID: 017438
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 371 | 2.2.26 [Sep-21-2011] | |||||||
| A0LE04 | 285 | Bifunctional protein FolD | yes | no | 0.762 | 0.992 | 0.584 | 2e-86 | |
| B3EJG9 | 298 | Bifunctional protein FolD | yes | no | 0.781 | 0.973 | 0.544 | 1e-84 | |
| B9M769 | 280 | Bifunctional protein FolD | yes | no | 0.749 | 0.992 | 0.554 | 5e-84 | |
| B4S820 | 295 | Bifunctional protein FolD | yes | no | 0.778 | 0.979 | 0.518 | 1e-83 | |
| A5GAM5 | 280 | Bifunctional protein FolD | yes | no | 0.749 | 0.992 | 0.550 | 3e-83 | |
| O96553 | 968 | C-1-tetrahydrofolate synt | yes | no | 0.776 | 0.297 | 0.551 | 4e-83 | |
| Q2RIB4 | 280 | Bifunctional protein FolD | yes | no | 0.746 | 0.989 | 0.562 | 2e-82 | |
| A7HSV9 | 298 | Bifunctional protein FolD | yes | no | 0.770 | 0.959 | 0.532 | 5e-82 | |
| A1BF67 | 295 | Bifunctional protein FolD | yes | no | 0.781 | 0.983 | 0.510 | 5e-82 | |
| A4SER8 | 295 | Bifunctional protein FolD | yes | no | 0.778 | 0.979 | 0.522 | 7e-82 |
| >sp|A0LE04|FOLD_MAGSM Bifunctional protein FolD OS=Magnetococcus sp. (strain MC-1) GN=folD PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 319 bits (818), Expect = 2e-86, Method: Compositional matrix adjust.
Identities = 170/291 (58%), Positives = 201/291 (69%), Gaps = 8/291 (2%)
Query: 80 AKVIDGKAVAKQIRDEITGEVSRMKDAIGVVPGLAVILVGDRKDSATYVRNKKKACQSVG 139
A VIDGKA+A+ +R+E+ EV R+K + PGLAV+LVG S YVRNKK+AC++ G
Sbjct: 2 AHVIDGKAIAQSVREELRMEVERLKLNHQLTPGLAVVLVGADPASQVYVRNKKRACETAG 61
Query: 140 INSFEVHLPEDTSEQEVLKHISVFNDDPSVHGILVQLPLPCHIDEQSILNAVSMEKDVDG 199
I SF L TS+ E+L I N D +VHGILVQLPLP HIDEQ +L A+S KD DG
Sbjct: 62 IASFSHELAATTSQAELLALIEQLNQDDAVHGILVQLPLPKHIDEQKVLEAISPSKDADG 121
Query: 200 FHPLNIGRLAMRGREPLFIPCTPKGCIELLHRYGFDIKGKRAVVIGRSNIVGMPAALLLQ 259
FHP N+GRL +P F PCTP G +E+L G D KGK AVVIGRSNIVG P AL+L
Sbjct: 122 FHPYNVGRLVT--GDPTFQPCTPWGVMEMLKVSGVDPKGKHAVVIGRSNIVGKPVALMLL 179
Query: 260 REDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGSWIKPGAVIIDVGINPVEDAKS 319
ATV+I HSRT + E ++ADI+++AVG+ NMV GSWIK GAV+IDVGIN ED K
Sbjct: 180 AAHATVTICHSRTPDLAETVKRADIVVAAVGRANMVPGSWIKKGAVVIDVGINRGEDGK- 238
Query: 320 PRGYRLVGDVCYEEACEVASAITPVPGGVGPMTIAMLLSNTLTSAKRVHNF 370
L GDV Y E ASAITPVPGGVGPMTIAMLL NT+ AKR HN
Sbjct: 239 -----LCGDVDYASCFEHASAITPVPGGVGPMTIAMLLKNTVEGAKRAHNI 284
|
Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate. Magnetococcus sp. (strain MC-1) (taxid: 156889) EC: 3EC: .EC: 5EC: .EC: 4EC: .EC: 9 |
| >sp|B3EJG9|FOLD_CHLPB Bifunctional protein FolD OS=Chlorobium phaeobacteroides (strain BS1) GN=folD PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B9M769|FOLD_GEOSF Bifunctional protein FolD OS=Geobacter sp. (strain FRC-32) GN=folD PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B4S820|FOLD_PROA2 Bifunctional protein FolD OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=folD PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A5GAM5|FOLD_GEOUR Bifunctional protein FolD OS=Geobacter uraniireducens (strain Rf4) GN=folD PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O96553|C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster GN=pug PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q2RIB4|FOLD_MOOTA Bifunctional protein FolD OS=Moorella thermoacetica (strain ATCC 39073) GN=folD PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A7HSV9|FOLD_PARL1 Bifunctional protein FolD OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=folD PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A1BF67|FOLD_CHLPD Bifunctional protein FolD OS=Chlorobium phaeobacteroides (strain DSM 266) GN=folD PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|A4SER8|FOLD_PROVI Bifunctional protein FolD OS=Prosthecochloris vibrioformis (strain DSM 265) GN=folD PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 371 | ||||||
| 255586321 | 366 | methylenetetrahydrofolate dehydrogenase, | 0.970 | 0.983 | 0.8 | 1e-165 | |
| 224067864 | 367 | tetrahydrofolate dehydrogenase/cyclohydr | 0.986 | 0.997 | 0.779 | 1e-163 | |
| 449433091 | 363 | PREDICTED: bifunctional protein FolD-lik | 0.970 | 0.991 | 0.786 | 1e-161 | |
| 15236888 | 360 | Amino acid dehydrogenase family protein | 0.954 | 0.983 | 0.764 | 1e-154 | |
| 297810105 | 361 | hypothetical protein ARALYDRAFT_490506 [ | 0.954 | 0.980 | 0.762 | 1e-154 | |
| 225454113 | 389 | PREDICTED: bifunctional protein FolD [Vi | 0.948 | 0.904 | 0.702 | 1e-152 | |
| 84468380 | 350 | putative tetrahydrofolate synthase [Trif | 0.900 | 0.954 | 0.8 | 1e-151 | |
| 363808352 | 342 | uncharacterized protein LOC100797215 [Gl | 0.859 | 0.932 | 0.793 | 1e-148 | |
| 358248028 | 345 | uncharacterized protein LOC100819231 [Gl | 0.865 | 0.930 | 0.787 | 1e-148 | |
| 357507199 | 351 | Bifunctional protein folD [Medicago trun | 0.897 | 0.948 | 0.789 | 1e-145 |
| >gi|255586321|ref|XP_002533811.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus communis] gi|223526248|gb|EEF28564.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 585 bits (1509), Expect = e-165, Method: Compositional matrix adjust.
Identities = 296/370 (80%), Positives = 325/370 (87%), Gaps = 10/370 (2%)
Query: 6 SMIFADCSSSTTARLVPFGRSRLLCGGGALCARRRLHVGVGPSLPASLRT----TLTVHS 61
S+ F DCSSS T RL F R+ G++ RRL + P S+RT T+++ S
Sbjct: 3 SVTFTDCSSSATPRLRLFNRTATFHRNGSITFARRL------AGPLSVRTICFGTVSIGS 56
Query: 62 SPSPSLPVMNATMASEASAKVIDGKAVAKQIRDEITGEVSRMKDAIGVVPGLAVILVGDR 121
S + S PV+NA+MASE AKVIDGK VA +IR+EIT EVSRMKD IGVVPGLAVILVGDR
Sbjct: 57 SSTASSPVINASMASETGAKVIDGKLVAMKIREEITVEVSRMKDEIGVVPGLAVILVGDR 116
Query: 122 KDSATYVRNKKKACQSVGINSFEVHLPEDTSEQEVLKHISVFNDDPSVHGILVQLPLPCH 181
KDSATYVRNKKKAC SVGINSFE +LPED++EQEVLK IS FN DPSVHGILVQLPLP H
Sbjct: 117 KDSATYVRNKKKACDSVGINSFEANLPEDSTEQEVLKFISGFNSDPSVHGILVQLPLPSH 176
Query: 182 IDEQSILNAVSMEKDVDGFHPLNIGRLAMRGREPLFIPCTPKGCIELLHRYGFDIKGKRA 241
+++Q+ILNAVS+EKDVDGFHPLNIGRLAMRGREPLF+PCTPKGCIELLHRYG +IKGKRA
Sbjct: 177 MNDQNILNAVSIEKDVDGFHPLNIGRLAMRGREPLFVPCTPKGCIELLHRYGVEIKGKRA 236
Query: 242 VVIGRSNIVGMPAALLLQREDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGSWIK 301
VVIGRSNIVGMPAAL+LQREDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRG+WIK
Sbjct: 237 VVIGRSNIVGMPAALMLQREDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGNWIK 296
Query: 302 PGAVIIDVGINPVEDAKSPRGYRLVGDVCYEEACEVASAITPVPGGVGPMTIAMLLSNTL 361
PGAV+IDVGINPVEDAKSPRGYRLVGDVCYEEAC+VASA+TPVPGGVGPMTIAMLLSNTL
Sbjct: 297 PGAVVIDVGINPVEDAKSPRGYRLVGDVCYEEACKVASAVTPVPGGVGPMTIAMLLSNTL 356
Query: 362 TSAKRVHNFQ 371
TSAKRVHNFQ
Sbjct: 357 TSAKRVHNFQ 366
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224067864|ref|XP_002302571.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Populus trichocarpa] gi|222844297|gb|EEE81844.1| tetrahydrofolate dehydrogenase/cyclohydrolase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449433091|ref|XP_004134331.1| PREDICTED: bifunctional protein FolD-like [Cucumis sativus] gi|449480371|ref|XP_004155875.1| PREDICTED: bifunctional protein FolD-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15236888|ref|NP_191971.1| Amino acid dehydrogenase family protein [Arabidopsis thaliana] gi|3047116|gb|AAC13627.1| F6N23.26 gene product [Arabidopsis thaliana] gi|7267401|emb|CAB80871.1| putative tetrahydrofolate synthase [Arabidopsis thaliana] gi|16649149|gb|AAL24426.1| Unknown protein [Arabidopsis thaliana] gi|23197716|gb|AAN15385.1| Unknown protein [Arabidopsis thaliana] gi|332656510|gb|AEE81910.1| Amino acid dehydrogenase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297810105|ref|XP_002872936.1| hypothetical protein ARALYDRAFT_490506 [Arabidopsis lyrata subsp. lyrata] gi|297318773|gb|EFH49195.1| hypothetical protein ARALYDRAFT_490506 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225454113|ref|XP_002269224.1| PREDICTED: bifunctional protein FolD [Vitis vinifera] gi|297745230|emb|CBI40310.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|84468380|dbj|BAE71273.1| putative tetrahydrofolate synthase [Trifolium pratense] | Back alignment and taxonomy information |
|---|
| >gi|363808352|ref|NP_001241997.1| uncharacterized protein LOC100797215 [Glycine max] gi|255641405|gb|ACU20979.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358248028|ref|NP_001239795.1| uncharacterized protein LOC100819231 [Glycine max] gi|255648103|gb|ACU24506.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357507199|ref|XP_003623888.1| Bifunctional protein folD [Medicago truncatula] gi|355498903|gb|AES80106.1| Bifunctional protein folD [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 371 | ||||||
| TAIR|locus:2127113 | 360 | EMB3127 "EMBRYO DEFECTIVE 3127 | 0.962 | 0.991 | 0.776 | 4.2e-143 | |
| TAIR|locus:2127083 | 310 | AT4G00600 [Arabidopsis thalian | 0.687 | 0.822 | 0.768 | 3.5e-107 | |
| TAIR|locus:2064143 | 352 | AT2G38660 [Arabidopsis thalian | 0.816 | 0.860 | 0.649 | 1.6e-104 | |
| TAIR|locus:2082254 | 299 | AT3G12290 [Arabidopsis thalian | 0.789 | 0.979 | 0.634 | 3.1e-99 | |
| DICTYBASE|DDB_G0283121 | 292 | DDB_G0283121 "methenyl tetrahy | 0.754 | 0.958 | 0.566 | 9.4e-82 | |
| FB|FBgn0020385 | 968 | pug "pugilist" [Drosophila mel | 0.776 | 0.297 | 0.551 | 1.7e-80 | |
| ASPGD|ASPL0000036964 | 1031 | AN2998 [Emericella nidulans (t | 0.811 | 0.291 | 0.518 | 2.5e-79 | |
| POMBASE|SPBC839.16 | 937 | SPBC839.16 "C1-5,6,7,8-tetrahy | 0.773 | 0.306 | 0.506 | 2.5e-77 | |
| MGI|MGI:1342005 | 935 | Mthfd1 "methylenetetrahydrofol | 0.778 | 0.309 | 0.5 | 2.9e-76 | |
| TIGR_CMR|SPO_1559 | 296 | SPO_1559 "methylenetetrahydrof | 0.765 | 0.959 | 0.539 | 6.3e-76 |
| TAIR|locus:2127113 EMB3127 "EMBRYO DEFECTIVE 3127" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1399 (497.5 bits), Expect = 4.2e-143, P = 4.2e-143
Identities = 285/367 (77%), Positives = 314/367 (85%)
Query: 6 SMIFADCSSSTTARLVPFGRSRLLCGGGALCARRRLHVG-VGPSLPASLRTTLTVHSSPS 64
SM+F DCSS+TT+RL+ RS G R+ VG + AS R + SS S
Sbjct: 3 SMMFTDCSSTTTSRLIHLNRS-----SGTFLLRQC--VGQLRLQTTASGRGCC-IRSSSS 54
Query: 65 PSLPVMNATMASEASAKVIDGKAVAKQIRDEITGEVSRMKDAIGVVPGLAVILVGDRKDS 124
P + ++A SE A VIDGKAVAK+IRDEIT EVSRMK++IGV+PGLAVILVGDRKDS
Sbjct: 55 P-ISSISADTKSEGGAIVIDGKAVAKKIRDEITIEVSRMKESIGVIPGLAVILVGDRKDS 113
Query: 125 ATYVRNKKKACQSVGINSFEVHLPEDTSEQEVLKHISVFNDDPSVHGILVQLPLPCHIDE 184
ATYVRNKKKAC SVGI SFEV L ED+SE+EVLK +S FNDDPSVHGILVQLPLP H+DE
Sbjct: 114 ATYVRNKKKACDSVGIKSFEVRLAEDSSEEEVLKSVSGFNDDPSVHGILVQLPLPSHMDE 173
Query: 185 QSILNAVSMEKDVDGFHPLNIGRLAMRGREPLFIPCTPKGCIELLHRYGFDIKGKRAVVI 244
Q+ILNAVS+EKDVDGFHPLNIGRLAMRGREPLF+PCTPKGCIELLHRY +IKGKRAVVI
Sbjct: 174 QNILNAVSIEKDVDGFHPLNIGRLAMRGREPLFVPCTPKGCIELLHRYNIEIKGKRAVVI 233
Query: 245 GRSNIVGMPAALLLQREDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGSWIKPGA 304
GRSNIVGMPAALLLQREDATVSI+HSRTKNPEEITR+ADIIISAVGQPNMVRGSWIKPGA
Sbjct: 234 GRSNIVGMPAALLLQREDATVSIIHSRTKNPEEITREADIIISAVGQPNMVRGSWIKPGA 293
Query: 305 VIIDVGINPVEDAKSPRGYRLVGDVCYEEACEVASAITPVPGGVGPMTIAMLLSNTLTSA 364
V+IDVGINPVED + RGYRLVGD+CYEEA +VASAITPVPGGVGPMTIAMLLSNTLTSA
Sbjct: 294 VLIDVGINPVEDPSAARGYRLVGDICYEEASKVASAITPVPGGVGPMTIAMLLSNTLTSA 353
Query: 365 KRVHNFQ 371
KR+HNFQ
Sbjct: 354 KRIHNFQ 360
|
|
| TAIR|locus:2127083 AT4G00600 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2064143 AT2G38660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082254 AT3G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0283121 DDB_G0283121 "methenyl tetrahydrofolate cyclohydrolase / NADP-dependent methylene H4F dehydrogenase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0020385 pug "pugilist" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000036964 AN2998 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC839.16 SPBC839.16 "C1-5,6,7,8-tetrahydrofolate (THF) synthase, trifunctional enzyme" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1342005 Mthfd1 "methylenetetrahydrofolate dehydrogenase (NADP+ dependent), methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1559 SPO_1559 "methylenetetrahydrofolate dehydrogenase (NADP+)/methenyltetrahydrofolate cyclohydrolase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| B3ECA6 | FOLD_CHLL2 | 3, ., 5, ., 4, ., 9 | 0.5238 | 0.7816 | 0.9797 | yes | no |
| Q71ZW2 | FOLD_LISMF | 3, ., 5, ., 4, ., 9 | 0.5085 | 0.7601 | 0.9929 | yes | no |
| A6UB98 | FOLD2_SINMW | 3, ., 5, ., 4, ., 9 | 0.5392 | 0.7654 | 0.9562 | yes | no |
| C0ZC05 | FOLD_BREBN | 3, ., 5, ., 4, ., 9 | 0.5277 | 0.7520 | 0.9823 | yes | no |
| A4SER8 | FOLD_PROVI | 3, ., 5, ., 4, ., 9 | 0.5221 | 0.7789 | 0.9796 | yes | no |
| B7KEP3 | FOLD_CYAP7 | 3, ., 5, ., 4, ., 9 | 0.5221 | 0.7762 | 0.9568 | yes | no |
| A1AL91 | FOLD_PELPD | 3, ., 5, ., 4, ., 9 | 0.5470 | 0.7493 | 0.9823 | yes | no |
| B8DFW8 | FOLD_LISMH | 3, ., 5, ., 4, ., 9 | 0.5051 | 0.7601 | 0.9929 | yes | no |
| A2RLU5 | FOLD_LACLM | 3, ., 5, ., 4, ., 9 | 0.5347 | 0.7520 | 0.9789 | yes | no |
| Q1GE28 | FOLD_RUEST | 3, ., 5, ., 4, ., 9 | 0.5290 | 0.7816 | 0.9666 | yes | no |
| A5GAM5 | FOLD_GEOUR | 3, ., 5, ., 4, ., 9 | 0.5505 | 0.7493 | 0.9928 | yes | no |
| C1L2R6 | FOLD_LISMC | 3, ., 5, ., 4, ., 9 | 0.5085 | 0.7601 | 0.9929 | yes | no |
| Q8Y7C5 | FOLD_LISMO | 3, ., 5, ., 4, ., 9 | 0.5087 | 0.7493 | 0.9788 | yes | no |
| Q92BZ4 | FOLD_LISIN | 3, ., 5, ., 4, ., 9 | 0.5191 | 0.7493 | 0.9788 | yes | no |
| A7HSV9 | FOLD_PARL1 | 3, ., 5, ., 4, ., 9 | 0.5328 | 0.7708 | 0.9597 | yes | no |
| B4S820 | FOLD_PROA2 | 3, ., 5, ., 4, ., 9 | 0.5187 | 0.7789 | 0.9796 | yes | no |
| B9M769 | FOLD_GEOSF | 3, ., 5, ., 4, ., 9 | 0.5540 | 0.7493 | 0.9928 | yes | no |
| A3DEE6 | FOLD_CLOTH | 3, ., 5, ., 4, ., 9 | 0.5400 | 0.7493 | 0.9754 | yes | no |
| Q31Q60 | FOLD_SYNE7 | 3, ., 5, ., 4, ., 9 | 0.5486 | 0.7547 | 0.9688 | yes | no |
| A1B5A7 | FOLD1_PARDP | 3, ., 5, ., 4, ., 9 | 0.5257 | 0.7708 | 0.9597 | yes | no |
| Q5N421 | FOLD_SYNP6 | 3, ., 5, ., 4, ., 9 | 0.5486 | 0.7547 | 0.9688 | yes | no |
| B2A532 | FOLD_NATTJ | 3, ., 5, ., 4, ., 9 | 0.5392 | 0.7628 | 0.9964 | yes | no |
| Q39WH4 | FOLD2_GEOMG | 3, ., 5, ., 4, ., 9 | 0.5298 | 0.7439 | 0.9684 | yes | no |
| B4RE11 | FOLD_PHEZH | 3, ., 5, ., 4, ., 9 | 0.5084 | 0.7843 | 0.9797 | yes | no |
| Q5LNV2 | FOLD1_RUEPO | 3, ., 5, ., 4, ., 9 | 0.5324 | 0.7708 | 0.9662 | yes | no |
| A1BBS1 | FOLD2_PARDP | 3, ., 5, ., 4, ., 9 | 0.5185 | 0.7870 | 0.9668 | yes | no |
| Q5NP22 | FOLD_ZYMMO | 3, ., 5, ., 4, ., 9 | 0.5410 | 0.7708 | 0.9629 | yes | no |
| Q2G338 | FOLD_NOVAD | 3, ., 5, ., 4, ., 9 | 0.5486 | 0.7681 | 0.9595 | yes | no |
| Q9K966 | FOLD_BACHD | 3, ., 5, ., 4, ., 9 | 0.5347 | 0.7493 | 0.9964 | yes | no |
| Q3ASI0 | FOLD_CHLCH | 3, ., 5, ., 4, ., 9 | 0.5290 | 0.7789 | 0.9796 | yes | no |
| B3EJG9 | FOLD_CHLPB | 3, ., 5, ., 4, ., 9 | 0.5442 | 0.7816 | 0.9731 | yes | no |
| B3QUL4 | FOLD_CHLT3 | 3, ., 5, ., 4, ., 9 | 0.5139 | 0.7601 | 0.9591 | yes | no |
| Q030A3 | FOLD_LACLS | 3, ., 5, ., 4, ., 9 | 0.5347 | 0.7520 | 0.9789 | yes | no |
| A8I5P5 | FOLD_AZOC5 | 3, ., 5, ., 4, ., 9 | 0.5625 | 0.7547 | 0.9655 | yes | no |
| A5EX57 | FOLD_DICNV | 3, ., 5, ., 4, ., 9 | 0.5376 | 0.7708 | 0.9828 | yes | no |
| A0LE04 | FOLD_MAGSM | 3, ., 5, ., 4, ., 9 | 0.5841 | 0.7628 | 0.9929 | yes | no |
| Q2N7E3 | FOLD_ERYLH | 3, ., 5, ., 4, ., 9 | 0.5482 | 0.7654 | 0.9530 | yes | no |
| B4SGR4 | FOLD_PELPB | 3, ., 5, ., 4, ., 9 | 0.5187 | 0.7789 | 0.9796 | yes | no |
| Q73RS2 | FOLD_TREDE | 3, ., 5, ., 4, ., 9 | 0.5152 | 0.7816 | 0.9897 | yes | no |
| B2UM17 | FOLD_AKKM8 | 3, ., 5, ., 4, ., 9 | 0.5104 | 0.7654 | 0.9759 | yes | no |
| Q2RIB4 | FOLD_MOOTA | 3, ., 5, ., 4, ., 9 | 0.5625 | 0.7466 | 0.9892 | yes | no |
| A1BF67 | FOLD_CHLPD | 3, ., 5, ., 4, ., 9 | 0.5102 | 0.7816 | 0.9830 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.5.4.9 | 0.914 |
| 3rd Layer | 3.5.4 | 0.921 |
| 3rd Layer | 1.5.1 | 0.921 |
| 4th Layer | 1.5.1.5 | 0.914 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | AT4G00620 | tetrahydrofolate dehydrogenase/cyclohydrolase, putative; tetrahydrofolate dehydrogenase/cyclohydrolase, putative; FUNCTIONS IN- binding, catalytic activity; INVOLVED IN- folic acid and derivative biosynthetic process, metabolic process; LOCATED IN- chloroplast; CONTAINS InterPro DOMAIN/s- Tetrahydrofolate dehydrogenase/cyclohydrolase (InterPro-IPR000672), NAD(P)-binding (InterPro-IPR016040); BEST Arabidopsis thaliana protein match is- tetrahydrofolate dehydrogenase/cyclohydrolase, putative (TAIR-AT4G00600.1); Has 7121 Blast hits to 7116 proteins in 1557 species- Archae - 77; Bacteria - [...] (360 aa) | |||||||||
(Arabidopsis thaliana) | |||||||||||
 | THFS | • | • | • | • | 0.943 | |||||
 | AT5G47435 | • | • | • | 0.840 | ||||||
 | AT4G17360 | • | • | • | 0.831 | ||||||
 | AT2G35040 | • | • | • | • | 0.693 | |||||
 | PUR3 | • | • | • | 0.655 | ||||||
 | PUR2 | • | • | • | 0.621 | ||||||
 | GDCST | • | • | • | 0.616 | ||||||
 | AtGLDP2 | • | • | • | 0.604 | ||||||
 | MTHFR1 | • | • | 0.575 | |||||||
 | pde194 | • | • | 0.568 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 371 | |||
| PLN02616 | 364 | PLN02616, PLN02616, tetrahydrofolate dehydrogenase | 0.0 | |
| PLN02897 | 345 | PLN02897, PLN02897, tetrahydrofolate dehydrogenase | 1e-162 | |
| PLN02516 | 299 | PLN02516, PLN02516, methylenetetrahydrofolate dehy | 1e-152 | |
| COG0190 | 283 | COG0190, FolD, 5,10-methylene-tetrahydrofolate deh | 1e-148 | |
| PRK14190 | 284 | PRK14190, PRK14190, bifunctional 5,10-methylene-te | 1e-139 | |
| PRK14188 | 296 | PRK14188, PRK14188, bifunctional 5,10-methylene-te | 1e-138 | |
| PRK10792 | 285 | PRK10792, PRK10792, bifunctional 5,10-methylene-te | 1e-130 | |
| PRK14189 | 285 | PRK14189, PRK14189, bifunctional 5,10-methylene-te | 1e-123 | |
| PRK14186 | 297 | PRK14186, PRK14186, bifunctional 5,10-methylene-te | 1e-123 | |
| PRK14174 | 295 | PRK14174, PRK14174, bifunctional 5,10-methylene-te | 1e-121 | |
| PRK14179 | 284 | PRK14179, PRK14179, bifunctional 5,10-methylene-te | 1e-120 | |
| PRK14191 | 285 | PRK14191, PRK14191, bifunctional 5,10-methylene-te | 1e-116 | |
| PRK14167 | 297 | PRK14167, PRK14167, bifunctional 5,10-methylene-te | 1e-108 | |
| PRK14194 | 301 | PRK14194, PRK14194, bifunctional 5,10-methylene-te | 1e-107 | |
| PRK14184 | 286 | PRK14184, PRK14184, bifunctional 5,10-methylene-te | 1e-107 | |
| PRK14183 | 281 | PRK14183, PRK14183, bifunctional 5,10-methylene-te | 1e-105 | |
| PRK14168 | 297 | PRK14168, PRK14168, bifunctional 5,10-methylene-te | 1e-104 | |
| PRK14187 | 294 | PRK14187, PRK14187, bifunctional 5,10-methylene-te | 1e-104 | |
| PRK14175 | 286 | PRK14175, PRK14175, bifunctional 5,10-methylene-te | 1e-104 | |
| PRK14185 | 293 | PRK14185, PRK14185, bifunctional 5,10-methylene-te | 1e-103 | |
| PRK14176 | 287 | PRK14176, PRK14176, bifunctional 5,10-methylene-te | 1e-103 | |
| PRK14193 | 284 | PRK14193, PRK14193, bifunctional 5,10-methylene-te | 1e-102 | |
| PRK14170 | 284 | PRK14170, PRK14170, bifunctional 5,10-methylene-te | 3e-98 | |
| cd01080 | 168 | cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding | 1e-96 | |
| PRK14178 | 279 | PRK14178, PRK14178, bifunctional 5,10-methylene-te | 1e-96 | |
| PRK14192 | 283 | PRK14192, PRK14192, bifunctional 5,10-methylene-te | 3e-96 | |
| PRK14166 | 282 | PRK14166, PRK14166, bifunctional 5,10-methylene-te | 6e-96 | |
| pfam02882 | 160 | pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydro | 2e-95 | |
| PRK14173 | 287 | PRK14173, PRK14173, bifunctional 5,10-methylene-te | 7e-95 | |
| PRK14172 | 278 | PRK14172, PRK14172, bifunctional 5,10-methylene-te | 9e-95 | |
| PRK14182 | 282 | PRK14182, PRK14182, bifunctional 5,10-methylene-te | 2e-91 | |
| PRK14169 | 282 | PRK14169, PRK14169, bifunctional 5,10-methylene-te | 2e-91 | |
| PRK14180 | 282 | PRK14180, PRK14180, bifunctional 5,10-methylene-te | 6e-88 | |
| PRK14181 | 287 | PRK14181, PRK14181, bifunctional 5,10-methylene-te | 5e-87 | |
| PRK14171 | 288 | PRK14171, PRK14171, bifunctional 5,10-methylene-te | 4e-84 | |
| PRK14177 | 284 | PRK14177, PRK14177, bifunctional 5,10-methylene-te | 5e-83 | |
| pfam00763 | 117 | pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydroge | 2e-54 | |
| cd05212 | 140 | cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) b | 3e-34 | |
| cd01079 | 197 | cd01079, NAD_bind_m-THF_DH, NAD binding domain of | 6e-17 | |
| cd05191 | 86 | cd05191, NAD_bind_amino_acid_DH, NAD(P) binding do | 4e-06 | |
| smart01002 | 149 | smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT | 0.002 | |
| cd05305 | 359 | cd05305, L-AlaDH, Alanine dehydrogenase NAD-bindin | 0.004 |
| >gnl|CDD|215332 PLN02616, PLN02616, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
Score = 618 bits (1596), Expect = 0.0
Identities = 297/368 (80%), Positives = 321/368 (87%), Gaps = 4/368 (1%)
Query: 4 SRSMIFADCSSSTTARLVPFGRSRLLCGGGALCARRRLHVGVGPSLPASLRTTLTVHSSP 63
S++F DCSSSTT+RL+ F R G L RR VG + ++SS
Sbjct: 1 MASLMFTDCSSSTTSRLIHFNRISTPFNGTFLL--RRC-VGPLRVRTTASGRGCCINSSS 57
Query: 64 SPSLPVMNATMASEASAKVIDGKAVAKQIRDEITGEVSRMKDAIGVVPGLAVILVGDRKD 123
SPS PV+NA SE AKVIDGKAVAK+IRDEIT EVSRMK++IGVVPGLAVILVGDRKD
Sbjct: 58 SPS-PVINADTGSEGGAKVIDGKAVAKKIRDEITIEVSRMKESIGVVPGLAVILVGDRKD 116
Query: 124 SATYVRNKKKACQSVGINSFEVHLPEDTSEQEVLKHISVFNDDPSVHGILVQLPLPCHID 183
SATYVRNKKKAC SVGINSFEV LPED++EQEVLK IS FN+DPSVHGILVQLPLP H+D
Sbjct: 117 SATYVRNKKKACDSVGINSFEVRLPEDSTEQEVLKFISGFNNDPSVHGILVQLPLPSHMD 176
Query: 184 EQSILNAVSMEKDVDGFHPLNIGRLAMRGREPLFIPCTPKGCIELLHRYGFDIKGKRAVV 243
EQ+ILNAVS+EKDVDGFHPLNIGRLAMRGREPLF+PCTPKGCIELLHRY +IKGKRAVV
Sbjct: 177 EQNILNAVSIEKDVDGFHPLNIGRLAMRGREPLFVPCTPKGCIELLHRYNVEIKGKRAVV 236
Query: 244 IGRSNIVGMPAALLLQREDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGSWIKPG 303
IGRSNIVGMPAALLLQREDATVSIVHSRTKNPEEITR+ADIIISAVGQPNMVRGSWIKPG
Sbjct: 237 IGRSNIVGMPAALLLQREDATVSIVHSRTKNPEEITREADIIISAVGQPNMVRGSWIKPG 296
Query: 304 AVIIDVGINPVEDAKSPRGYRLVGDVCYEEACEVASAITPVPGGVGPMTIAMLLSNTLTS 363
AV+IDVGINPVEDA SPRGYRLVGDVCYEEAC+VASA+TPVPGGVGPMTIAMLLSNTLTS
Sbjct: 297 AVVIDVGINPVEDASSPRGYRLVGDVCYEEACKVASAVTPVPGGVGPMTIAMLLSNTLTS 356
Query: 364 AKRVHNFQ 371
AKR+HNFQ
Sbjct: 357 AKRIHNFQ 364
|
Length = 364 |
| >gnl|CDD|178485 PLN02897, PLN02897, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|178131 PLN02516, PLN02516, methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >gnl|CDD|223268 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184560 PRK14190, PRK14190, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184558 PRK14188, PRK14188, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236760 PRK10792, PRK10792, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184559 PRK14189, PRK14189, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237636 PRK14186, PRK14186, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172662 PRK14174, PRK14174, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237634 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172679 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184549 PRK14167, PRK14167, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172682 PRK14194, PRK14194, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237635 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184555 PRK14183, PRK14183, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237633 PRK14168, PRK14168, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172675 PRK14187, PRK14187, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184552 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184556 PRK14185, PRK14185, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184553 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237637 PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172658 PRK14170, PRK14170, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|172666 PRK14178, PRK14178, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184561 PRK14192, PRK14192, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172654 PRK14166, PRK14166, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217267 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|184551 PRK14173, PRK14173, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172660 PRK14172, PRK14172, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172670 PRK14182, PRK14182, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184550 PRK14169, PRK14169, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172668 PRK14180, PRK14180, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172669 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172659 PRK14171, PRK14171, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172665 PRK14177, PRK14177, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201431 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|133451 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|133447 cd01079, NAD_bind_m-THF_DH, NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|133449 cd05191, NAD_bind_amino_acid_DH, NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240630 cd05305, L-AlaDH, Alanine dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 371 | |||
| PLN02616 | 364 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 100.0 | |
| PLN02897 | 345 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 100.0 | |
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase | 100.0 | |
| PRK14171 | 288 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PLN02516 | 299 | methylenetetrahydrofolate dehydrogenase (NADP+) | 100.0 | |
| PRK14170 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14185 | 293 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14168 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14169 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14187 | 294 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14167 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14166 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14182 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14190 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14172 | 278 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14184 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14180 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14186 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14181 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14193 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14173 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14174 | 295 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14178 | 279 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| KOG4230 | 935 | consensus C1-tetrahydrofolate synthase [Coenzyme t | 100.0 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| KOG0089 | 309 | consensus Methylenetetrahydrofolate dehydrogenase/ | 100.0 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 100.0 | |
| cd01079 | 197 | NAD_bind_m-THF_DH NAD binding domain of methylene- | 100.0 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 100.0 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 100.0 | |
| PF00763 | 117 | THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh | 100.0 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 99.91 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 99.9 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 99.9 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 99.89 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 99.89 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 99.89 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 99.89 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 99.88 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 99.87 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 99.83 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 99.81 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 99.59 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 99.48 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 99.16 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 99.15 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 99.09 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 99.02 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 98.99 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 98.97 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 98.85 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 98.74 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 98.74 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 98.68 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 98.67 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 98.59 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 98.46 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 98.45 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 98.45 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 98.42 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 98.4 | |
| COG0499 | 420 | SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me | 98.3 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 98.29 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 98.28 | |
| PLN02494 | 477 | adenosylhomocysteinase | 98.27 | |
| PLN02928 | 347 | oxidoreductase family protein | 98.22 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 98.21 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 98.19 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 98.09 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 98.05 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 98.02 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 97.99 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 97.97 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 97.96 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 97.95 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 97.95 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 97.93 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 97.92 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 97.89 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 97.88 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 97.87 | |
| PRK12862 | 763 | malic enzyme; Reviewed | 97.87 | |
| KOG1370 | 434 | consensus S-adenosylhomocysteine hydrolase [Coenzy | 97.86 | |
| COG5322 | 351 | Predicted dehydrogenase [General function predicti | 97.86 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 97.83 | |
| PRK07232 | 752 | bifunctional malic enzyme oxidoreductase/phosphotr | 97.83 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 97.79 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 97.79 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 97.79 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 97.78 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 97.77 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 97.73 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 97.7 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 97.68 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 97.68 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 97.67 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 97.67 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 97.6 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 97.59 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 97.58 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 97.56 | |
| COG0281 | 432 | SfcA Malic enzyme [Energy production and conversio | 97.54 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 97.53 | |
| PRK12861 | 764 | malic enzyme; Reviewed | 97.53 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 97.49 | |
| PF08501 | 83 | Shikimate_dh_N: Shikimate dehydrogenase substrate | 97.43 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 97.37 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 97.33 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 97.3 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 97.24 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 97.23 | |
| PLN02342 | 348 | ornithine carbamoyltransferase | 97.22 | |
| TIGR02371 | 325 | ala_DH_arch alanine dehydrogenase, Archaeoglobus f | 97.2 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 97.06 | |
| PLN02712 | 667 | arogenate dehydrogenase | 97.04 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 97.03 | |
| PF02423 | 313 | OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst | 97.0 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 96.95 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 96.95 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 96.95 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 96.94 | |
| PLN02256 | 304 | arogenate dehydrogenase | 96.93 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 96.93 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 96.91 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 96.9 | |
| PRK14804 | 311 | ornithine carbamoyltransferase; Provisional | 96.9 | |
| PRK06823 | 315 | ornithine cyclodeaminase; Validated | 96.87 | |
| cd05312 | 279 | NAD_bind_1_malic_enz NAD(P) binding domain of mali | 96.85 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 96.81 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 96.8 | |
| PRK06046 | 326 | alanine dehydrogenase; Validated | 96.76 | |
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 96.75 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 96.74 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 96.74 | |
| PRK13814 | 310 | pyrB aspartate carbamoyltransferase catalytic subu | 96.7 | |
| PRK07589 | 346 | ornithine cyclodeaminase; Validated | 96.69 | |
| PRK03515 | 336 | ornithine carbamoyltransferase subunit I; Provisio | 96.66 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 96.6 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 96.6 | |
| PRK01713 | 334 | ornithine carbamoyltransferase; Provisional | 96.59 | |
| PRK06407 | 301 | ornithine cyclodeaminase; Provisional | 96.57 | |
| PRK12562 | 334 | ornithine carbamoyltransferase subunit F; Provisio | 96.57 | |
| PRK13529 | 563 | malate dehydrogenase; Provisional | 96.56 | |
| PF03949 | 255 | Malic_M: Malic enzyme, NAD binding domain; InterPr | 96.56 | |
| PRK00856 | 305 | pyrB aspartate carbamoyltransferase catalytic subu | 96.55 | |
| PRK02255 | 338 | putrescine carbamoyltransferase; Provisional | 96.55 | |
| TIGR01692 | 288 | HIBADH 3-hydroxyisobutyrate dehydrogenase. This en | 96.53 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 96.52 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 96.52 | |
| TIGR00670 | 301 | asp_carb_tr aspartate carbamoyltransferase. Ornith | 96.51 | |
| PRK04284 | 332 | ornithine carbamoyltransferase; Provisional | 96.5 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 96.5 | |
| PRK02102 | 331 | ornithine carbamoyltransferase; Validated | 96.5 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 96.49 | |
| PRK11891 | 429 | aspartate carbamoyltransferase; Provisional | 96.45 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 96.44 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 96.42 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 96.42 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 96.41 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 96.33 | |
| PLN02527 | 306 | aspartate carbamoyltransferase | 96.33 | |
| TIGR00658 | 304 | orni_carb_tr ornithine carbamoyltransferase. Most | 96.31 | |
| TIGR03316 | 357 | ygeW probable carbamoyltransferase YgeW. Members o | 96.24 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 96.24 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 96.2 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 96.19 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 96.19 | |
| PTZ00317 | 559 | NADP-dependent malic enzyme; Provisional | 96.17 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 96.15 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 96.13 | |
| PRK08507 | 275 | prephenate dehydrogenase; Validated | 96.12 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 96.11 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 96.11 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 96.1 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.09 | |
| PRK00779 | 304 | ornithine carbamoyltransferase; Provisional | 96.07 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 96.0 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.0 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.98 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 95.97 | |
| PRK14805 | 302 | ornithine carbamoyltransferase; Provisional | 95.95 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 95.94 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 95.92 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 95.91 | |
| PRK08192 | 338 | aspartate carbamoyltransferase; Provisional | 95.9 | |
| COG2423 | 330 | Predicted ornithine cyclodeaminase, mu-crystallin | 95.85 | |
| PLN02712 | 667 | arogenate dehydrogenase | 95.8 | |
| COG3288 | 356 | PntA NAD/NADP transhydrogenase alpha subunit [Ener | 95.77 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 95.76 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 95.75 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 95.74 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 95.66 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 95.66 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 95.65 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 95.62 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 95.6 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 95.56 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 95.55 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 95.54 | |
| PRK07200 | 395 | aspartate/ornithine carbamoyltransferase family pr | 95.54 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 95.54 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 95.51 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 95.46 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 95.44 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.4 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 95.37 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.36 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 95.35 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 95.32 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 95.31 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 95.3 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 95.29 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 95.27 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 95.27 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.26 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 95.26 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.22 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 95.22 | |
| PLN02477 | 410 | glutamate dehydrogenase | 95.2 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 95.2 | |
| PRK04523 | 335 | N-acetylornithine carbamoyltransferase; Reviewed | 95.2 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 95.18 | |
| PRK06199 | 379 | ornithine cyclodeaminase; Validated | 95.14 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 95.07 | |
| COG0078 | 310 | ArgF Ornithine carbamoyltransferase [Amino acid tr | 95.07 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.06 | |
| PRK01368 | 454 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.99 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.97 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 94.97 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 94.96 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 94.96 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 94.96 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 94.93 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 94.92 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 94.91 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.89 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 94.88 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 94.87 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 94.86 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 94.85 | |
| PRK06728 | 347 | aspartate-semialdehyde dehydrogenase; Provisional | 94.84 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 94.77 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 94.75 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 94.72 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 94.72 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 94.71 | |
| COG0677 | 436 | WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas | 94.69 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 94.65 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 94.65 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 94.63 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.6 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 94.55 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 94.54 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 94.52 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 94.5 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 94.49 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 94.49 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 94.45 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 94.45 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 94.44 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 94.43 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 94.42 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 94.4 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 94.39 | |
| PRK14806 | 735 | bifunctional cyclohexadienyl dehydrogenase/ 3-phos | 94.38 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 94.36 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 94.32 | |
| PRK05717 | 255 | oxidoreductase; Validated | 94.32 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 94.31 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 94.3 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 94.29 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 94.27 | |
| KOG0068 | 406 | consensus D-3-phosphoglycerate dehydrogenase, D-is | 94.25 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 94.24 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 94.24 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.18 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 94.18 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 94.16 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.15 | |
| PRK05225 | 487 | ketol-acid reductoisomerase; Validated | 94.15 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 94.12 | |
| TIGR01724 | 341 | hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome | 94.11 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 94.1 | |
| TIGR00521 | 390 | coaBC_dfp phosphopantothenoylcysteine decarboxylas | 94.1 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 94.06 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.05 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 94.03 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 94.03 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 94.03 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 94.03 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 94.02 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 94.01 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.0 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 94.0 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.96 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 93.95 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 93.95 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 93.93 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 93.93 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 93.92 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 93.92 | |
| PRK01390 | 460 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.92 | |
| PRK08223 | 287 | hypothetical protein; Validated | 93.89 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 93.89 | |
| COG0240 | 329 | GpsA Glycerol-3-phosphate dehydrogenase [Energy pr | 93.89 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 93.88 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 93.87 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 93.87 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 93.84 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 93.79 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 93.75 | |
| smart00859 | 122 | Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin | 93.75 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 93.72 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 93.72 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 93.71 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 93.71 | |
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 93.7 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 93.69 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 93.68 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 93.66 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 93.65 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 93.65 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 93.64 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 93.6 | |
| TIGR01851 | 310 | argC_other N-acetyl-gamma-glutamyl-phosphate reduc | 93.59 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 93.58 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 93.58 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.56 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 93.56 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 93.55 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 93.55 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 93.54 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 93.54 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 93.52 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 93.51 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 93.48 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 93.46 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 93.46 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 93.46 | |
| PLN02178 | 375 | cinnamyl-alcohol dehydrogenase | 93.45 | |
| PRK15182 | 425 | Vi polysaccharide biosynthesis protein TviB; Provi | 93.43 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 93.43 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 93.41 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.38 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 93.38 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 93.37 | |
| TIGR03376 | 342 | glycerol3P_DH glycerol-3-phosphate dehydrogenase ( | 93.34 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 93.33 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 93.29 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 93.29 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 93.28 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 93.28 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.27 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 93.26 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 93.24 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 93.24 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 93.23 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.23 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 93.23 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 93.18 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.18 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 93.17 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.17 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 93.17 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 93.16 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 93.1 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 93.09 | |
| KOG1198 | 347 | consensus Zinc-binding oxidoreductase [Energy prod | 93.08 | |
| KOG0409 | 327 | consensus Predicted dehydrogenase [General functio | 93.03 | |
| PRK10727 | 343 | DNA-binding transcriptional regulator GalR; Provis | 92.98 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 92.98 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 92.96 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 92.93 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 92.91 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 92.91 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 92.91 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 92.9 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.89 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 92.89 | |
| KOG0725 | 270 | consensus Reductases with broad range of substrate | 92.89 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.87 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 92.85 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 92.82 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 92.81 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 92.8 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 92.8 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 92.79 | |
| PLN02602 | 350 | lactate dehydrogenase | 92.78 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 92.69 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 92.69 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 92.68 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 92.66 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 92.64 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 92.62 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 92.61 | |
| KOG1494 | 345 | consensus NAD-dependent malate dehydrogenase [Ener | 92.61 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.59 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 92.54 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 92.53 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.51 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 92.5 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 92.49 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 92.47 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 92.46 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 92.45 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 92.44 | |
| PRK05086 | 312 | malate dehydrogenase; Provisional | 92.44 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 92.43 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 92.41 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 92.36 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 92.35 | |
| COG0059 | 338 | IlvC Ketol-acid reductoisomerase [Amino acid trans | 92.35 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 92.32 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 92.32 | |
| PRK11863 | 313 | N-acetyl-gamma-glutamyl-phosphate reductase; Provi | 92.31 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 92.3 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 92.3 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 92.28 | |
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase | 92.28 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 92.24 | |
| PRK11303 | 328 | DNA-binding transcriptional regulator FruR; Provis | 92.22 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 92.21 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 92.2 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 92.2 | |
| PRK08643 | 256 | acetoin reductase; Validated | 92.19 | |
| cd08253 | 325 | zeta_crystallin Zeta-crystallin with NADP-dependen | 92.18 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 92.15 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 92.14 | |
| PF04127 | 185 | DFP: DNA / pantothenate metabolism flavoprotein; I | 92.11 | |
| PRK06444 | 197 | prephenate dehydrogenase; Provisional | 92.09 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 92.08 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 92.07 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 92.0 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 91.99 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 91.98 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.97 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 91.95 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 91.91 | |
| TIGR01745 | 366 | asd_gamma aspartate-semialdehyde dehydrogenase, ga | 91.9 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 91.89 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 91.89 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 91.88 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 91.85 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 91.81 | |
| PLN00106 | 323 | malate dehydrogenase | 91.81 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 91.78 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 91.76 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 91.75 | |
| cd05282 | 323 | ETR_like 2-enoyl thioester reductase-like. 2-enoyl | 91.75 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 91.75 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 91.73 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 91.72 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 91.7 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 91.7 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 91.69 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 91.69 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 91.62 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 91.59 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 91.59 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 91.57 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 91.51 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 91.51 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.49 | |
| PTZ00345 | 365 | glycerol-3-phosphate dehydrogenase; Provisional | 91.48 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 91.48 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 91.39 | |
| PRK10423 | 327 | transcriptional repressor RbsR; Provisional | 91.33 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 91.3 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 91.28 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 91.28 | |
| PRK13376 | 525 | pyrB bifunctional aspartate carbamoyltransferase c | 91.23 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 91.21 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 91.2 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 91.16 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 91.14 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 91.13 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 91.13 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 91.1 | |
| PF00185 | 158 | OTCace: Aspartate/ornithine carbamoyltransferase, | 91.09 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 91.06 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 91.04 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 91.03 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 91.02 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 90.93 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 90.92 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 90.91 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 90.89 | |
| PRK03806 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.86 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 90.83 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 90.8 |
| >PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-105 Score=788.74 Aligned_cols=363 Identities=81% Similarity=1.197 Sum_probs=336.9
Q ss_pred ccceeccccccccccccccccccccCCCccccccccccccCCCCCCccccccceeecCCCCCcccccccccccccceeee
Q 017438 5 RSMIFADCSSSTTARLVPFGRSRLLCGGGALCARRRLHVGVGPSLPASLRTTLTVHSSPSPSLPVMNATMASEASAKVID 84 (371)
Q Consensus 5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~a~ild 84 (371)
+|++|+|||||+++||+||+|..+ ||+|++..|+.. +...++.+...+.|.+.+++. .....+.+++++|++++||
T Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~ild 77 (364)
T PLN02616 2 ASLMFTDCSSSTTSRLIHFNRIST-PFNGTFLLRRCV--GPLRVRTTASGRGCCINSSSS-PSPVINADTGSEGGAKVID 77 (364)
T ss_pred chhhhccccccchhhhhHHhhccc-ccccccccceec--cccccCccccccccccCCCCC-cchhhhhhcCccccCeEeE
Confidence 689999999999999999999866 899999998733 233344444457888877776 4555667888998889999
Q ss_pred cHHHHHHHHHHHHHHHHHhHhccCCCceEEEEEeCCCcchHHHHHHHHHHHHHcCCeEEEEeCCCCCCHHHHHHHHHHhc
Q 017438 85 GKAVAKQIRDEITGEVSRMKDAIGVVPGLAVILVGDRKDSATYVRNKKKACQSVGINSFEVHLPEDTSEQEVLKHISVFN 164 (371)
Q Consensus 85 Gk~la~~i~~~ik~~v~~l~~~~g~~P~LaiI~vG~d~aS~~Yv~~k~k~~~~~GI~~~~~~lp~~v~~~el~~~I~~LN 164 (371)
||++|++|++++++++++|+++.|++|+||+|+||+||+|..|+++|.|+|+++||+++.++||++++|+|+++.|++||
T Consensus 78 Gk~iA~~i~~~lk~~v~~lk~~~g~~P~LaiIlvG~dpaS~~Yv~~k~K~~e~~GI~~~~~~lpe~~te~ell~~I~~LN 157 (364)
T PLN02616 78 GKAVAKKIRDEITIEVSRMKESIGVVPGLAVILVGDRKDSATYVRNKKKACDSVGINSFEVRLPEDSTEQEVLKFISGFN 157 (364)
T ss_pred hHHHHHHHHHHHHHHHHHHHHcCCCCCeEEEEEeCCChhHHHHHHHHHHHHHHcCCEEEEEECCCCCCHHHHHHHHHHHc
Confidence 99999999999999999999888899999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCccEEEEeCCCCCCCCHHHHHhhCCcccccCccCcchhhhhccCCCccccccCCHHHHHHHHHHhCCCCCCCEEEEE
Q 017438 165 DDPSVHGILVQLPLPCHIDEQSILNAVSMEKDVDGFHPLNIGRLAMRGREPLFIPCTPKGCIELLHRYGFDIKGKRAVVI 244 (371)
Q Consensus 165 ~D~~V~GIlVqlPLp~~i~~~~i~~~I~p~KDVDgl~~~N~G~l~~g~~~~~~~PcTa~gvi~lL~~~~i~l~GK~vvVI 244 (371)
+|++|||||||+|||+|+|+++++++|+|+|||||+|+.|+|+|+.|++.++|+||||.||+++|++|+++++||+|+||
T Consensus 158 ~D~~V~GIlVQlPLP~~id~~~i~~aI~P~KDVDGl~p~N~G~L~~g~~~~~f~PCTp~avielL~~y~i~l~GK~vvVI 237 (364)
T PLN02616 158 NDPSVHGILVQLPLPSHMDEQNILNAVSIEKDVDGFHPLNIGRLAMRGREPLFVPCTPKGCIELLHRYNVEIKGKRAVVI 237 (364)
T ss_pred CCCCCCEEEEeCCCCCCCCHHHHHhccCcccCcccCChhhhHHHhcCCCCCCCCCCCHHHHHHHHHHhCCCCCCCEEEEE
Confidence 99999999999999999999999999999999999999999999976546789999999999999999999999999999
Q ss_pred cCCcccHHHHHHHhccCCCeEEEEeCCCCCHHhhccCCcEEEEccCCCCcccCCCcCCCeEEEEeeecCCCCCCCCCCce
Q 017438 245 GRSNIVGMPAALLLQREDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGSWIKPGAVIIDVGINPVEDAKSPRGYR 324 (371)
Q Consensus 245 G~s~~VGkpla~lL~~~gAtVtv~h~~t~~l~~~l~~ADIVIsAvG~p~~v~~d~ik~gavVIDvgin~~~~~~~~~g~k 324 (371)
|||++||||+++||+++|||||+||++|+|+++++++|||||+|+|+|++|++||||||++|||+|+|+++++++++|+|
T Consensus 238 GRS~iVGkPLa~LL~~~~ATVTicHs~T~nl~~~~r~ADIVIsAvGkp~~i~~d~vK~GAvVIDVGIn~~~~~~~~~g~k 317 (364)
T PLN02616 238 GRSNIVGMPAALLLQREDATVSIVHSRTKNPEEITREADIIISAVGQPNMVRGSWIKPGAVVIDVGINPVEDASSPRGYR 317 (364)
T ss_pred CCCccccHHHHHHHHHCCCeEEEeCCCCCCHHHHHhhCCEEEEcCCCcCcCCHHHcCCCCEEEeccccccccccccCCCe
Confidence 99999999999999999999999999999999999999999999999999999999999999999999976544455668
Q ss_pred eecccchhhhhhhcceeccCCCCccHHHHHHHHHHHHHHHHHHhcCC
Q 017438 325 LVGDVCYEEACEVASAITPVPGGVGPMTIAMLLSNTLTSAKRVHNFQ 371 (371)
Q Consensus 325 l~GDVd~~~v~~~a~~iTPVPGGVGp~T~amLl~n~v~a~~~~~~~~ 371 (371)
++|||||+++.++|++||||||||||||++|||+|++++++++.+++
T Consensus 318 lvGDVdfe~v~~~as~ITPVPGGVGpmTva~Ll~N~~~aa~~~~~~~ 364 (364)
T PLN02616 318 LVGDVCYEEACKVASAVTPVPGGVGPMTIAMLLSNTLTSAKRIHNFQ 364 (364)
T ss_pred EEecCcHHHHHhhccccCCCCCchHHHHHHHHHHHHHHHHHHhhcCC
Confidence 99999999999999999999999999999999999999999998874
|
|
| >PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG4230 consensus C1-tetrahydrofolate synthase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG0089 consensus Methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12862 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG5322 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >COG0281 SfcA Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK12861 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF08501 Shikimate_dh_N: Shikimate dehydrogenase substrate binding domain; InterPro: IPR013708 This domain is the substrate binding domain of shikimate dehydrogenase [] | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02342 ornithine carbamoyltransferase | Back alignment and domain information |
|---|
| >TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14804 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06823 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06046 alanine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07589 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK03515 ornithine carbamoyltransferase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK01713 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06407 ornithine cyclodeaminase; Provisional | Back alignment and domain information |
|---|
| >PRK12562 ornithine carbamoyltransferase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK13529 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK02255 putrescine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00670 asp_carb_tr aspartate carbamoyltransferase | Back alignment and domain information |
|---|
| >PRK04284 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK02102 ornithine carbamoyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11891 aspartate carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02527 aspartate carbamoyltransferase | Back alignment and domain information |
|---|
| >TIGR00658 orni_carb_tr ornithine carbamoyltransferase | Back alignment and domain information |
|---|
| >TIGR03316 ygeW probable carbamoyltransferase YgeW | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00317 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08507 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00779 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >PRK14805 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08192 aspartate carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >PRK04523 N-acetylornithine carbamoyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06199 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06728 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05225 ketol-acid reductoisomerase; Validated | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02178 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0409 consensus Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10727 DNA-binding transcriptional regulator GalR; Provisional | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05086 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK11303 DNA-binding transcriptional regulator FruR; Provisional | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism | Back alignment and domain information |
|---|
| >PRK06444 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd05282 ETR_like 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10423 transcriptional repressor RbsR; Provisional | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 371 | ||||
| 4a26_A | 300 | The Crystal Structure Of Leishmania Major N5,N10- M | 3e-84 | ||
| 1dia_A | 306 | Human Methylenetetrahydrofolate Dehydrogenase Cyclo | 2e-79 | ||
| 1a4i_A | 301 | Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE | 2e-79 | ||
| 4a5o_A | 286 | Crystal Structure Of Pseudomonas Aeruginosa N5, N10 | 4e-73 | ||
| 1b0a_A | 288 | 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCL | 3e-72 | ||
| 3p2o_A | 285 | Crystal Structure Of Fold Bifunctional Protein From | 8e-71 | ||
| 3l07_A | 285 | Methylenetetrahydrofolate DehydrogenaseMETHENYLTETR | 2e-68 | ||
| 4b4u_A | 303 | Crystal Structure Of Acinetobacter Baumannii N5, N1 | 2e-67 | ||
| 2c2x_A | 281 | Three Dimensional Structure Of Bifunctional Methyle | 3e-58 | ||
| 3ngl_A | 276 | Crystal Structure Of Bifunctional 5,10-Methylenetet | 5e-45 | ||
| 1edz_A | 320 | Structure Of The Nad-Dependent 5,10- Methylenetetra | 3e-17 |
| >pdb|4A26|A Chain A, The Crystal Structure Of Leishmania Major N5,N10- Methylenetetrahydrofolate DehydrogenaseCYCLOHYDROLASE Length = 300 | Back alignment and structure |
|
| >pdb|1DIA|A Chain A, Human Methylenetetrahydrofolate Dehydrogenase Cyclohydrolase Complexed With Nadp And Inhibitor Ly249543 Length = 306 | Back alignment and structure |
| >pdb|1A4I|A Chain A, Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE Length = 301 | Back alignment and structure |
| >pdb|4A5O|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa N5, N10- Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Length = 286 | Back alignment and structure |
| >pdb|1B0A|A Chain A, 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCLOHYDROLASE FROM E COLI Length = 288 | Back alignment and structure |
| >pdb|3P2O|A Chain A, Crystal Structure Of Fold Bifunctional Protein From Campylobacter Jejuni Length = 285 | Back alignment and structure |
| >pdb|3L07|A Chain A, Methylenetetrahydrofolate DehydrogenaseMETHENYLTETRAHYDROFOLATE Cyclohydrolase, Putative Bifunctional Protein Fold From Francisella Tularensis. Length = 285 | Back alignment and structure |
| >pdb|4B4U|A Chain A, Crystal Structure Of Acinetobacter Baumannii N5, N10-Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Complexed With Nadp Cofactor Length = 303 | Back alignment and structure |
| >pdb|2C2X|A Chain A, Three Dimensional Structure Of Bifunctional Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase From Mycobacterium Tuberculosis Length = 281 | Back alignment and structure |
| >pdb|3NGL|A Chain A, Crystal Structure Of Bifunctional 5,10-Methylenetetrahydrofolate Dehydrogenase CYCLOHYDROLASE FROM THERMOPLASMA ACIDOPHILUM Length = 276 | Back alignment and structure |
| >pdb|1EDZ|A Chain A, Structure Of The Nad-Dependent 5,10- Methylenetetrahydrofolate Dehydrogenase From Saccharomyces Cerevisiae Length = 320 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Length = 301 | Back alignment and structure |
|---|
Score = 532 bits (1372), Expect = 0.0
Identities = 145/294 (49%), Positives = 201/294 (68%), Gaps = 3/294 (1%)
Query: 78 ASAKVIDGKAVAKQIRDEITGEVSRMKDAI-GVVPGLAVILVGDRKDSATYVRNKKKACQ 136
A A++++GK ++ QIR + +V+++K+ + G P LA++ VG+R DS Y+ K KA +
Sbjct: 2 APAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAE 61
Query: 137 SVGINSFEVHLPEDTSEQEVLKHISVFNDDPSVHGILVQLPLPCH--IDEQSILNAVSME 194
+GI + + LP T+E EV+K+I+ N+D +VHG LVQLPL I+ + ++NA++ E
Sbjct: 62 EIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPE 121
Query: 195 KDVDGFHPLNIGRLAMRGREPLFIPCTPKGCIELLHRYGFDIKGKRAVVIGRSNIVGMPA 254
KDVDG +N GRLA FIPCTPKGC+EL+ G I G+ AVV+GRS IVG P
Sbjct: 122 KDVDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPM 181
Query: 255 ALLLQREDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGSWIKPGAVIIDVGINPV 314
LL +ATV+ HS+T + +E + DI++ A GQP MV+G WIKPGA++ID GIN V
Sbjct: 182 HDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYV 241
Query: 315 EDAKSPRGYRLVGDVCYEEACEVASAITPVPGGVGPMTIAMLLSNTLTSAKRVH 368
D K P G ++VGDV Y+EA E AS ITPVPGGVGPMT+AML+ +T+ SAKR
Sbjct: 242 PDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFL 295
|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Length = 300 | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Length = 288 | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Length = 286 | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Length = 285 | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Length = 285 | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Length = 276 | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Length = 281 | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Length = 320 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 371 | |||
| 4b4u_A | 303 | Bifunctional protein fold; oxidoreductase; HET: NA | 100.0 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 100.0 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 100.0 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 100.0 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 100.0 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 100.0 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 100.0 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 100.0 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 100.0 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 100.0 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 99.96 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 99.95 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 99.95 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 99.95 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 99.95 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 99.94 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 99.93 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 99.93 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 99.92 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 99.91 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 99.91 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 99.91 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 99.91 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 99.88 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 99.87 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 99.86 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 99.84 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 99.59 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 99.47 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 99.25 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 99.09 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 99.0 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 98.95 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 98.8 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 98.8 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 98.66 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 98.61 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 98.6 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 98.54 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 98.48 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 98.45 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 98.39 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 98.38 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 98.37 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 98.33 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 98.31 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 98.26 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 98.16 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 98.16 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 98.14 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 98.14 | |
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 98.11 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 98.1 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 98.1 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 98.08 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 98.07 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 98.07 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 98.06 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 98.05 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 98.05 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 98.04 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 98.03 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 98.03 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 98.02 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 98.01 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 98.0 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 98.0 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 98.0 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 98.0 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 98.0 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 97.98 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 97.97 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 97.95 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 97.94 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 97.92 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 97.92 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 97.92 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 97.89 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 97.89 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 97.88 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 97.87 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 97.84 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 97.83 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 97.83 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 97.81 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 97.81 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 97.79 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 97.75 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 97.73 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 97.66 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 97.65 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 97.61 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 97.58 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 97.56 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 97.56 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 97.54 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 97.49 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 97.49 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 97.46 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 97.44 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 97.41 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 97.4 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 97.39 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 97.38 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 97.33 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 97.32 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 97.31 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 97.29 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 97.28 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 97.27 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 97.27 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 97.25 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 97.21 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 97.19 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 97.13 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 97.09 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 97.08 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 97.06 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 97.06 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 97.06 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 97.04 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 96.99 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 96.99 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 96.0 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 96.94 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 96.91 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 96.88 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 96.87 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 96.85 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 96.77 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 96.72 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 96.69 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 96.64 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 96.61 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 96.61 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 96.6 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.57 | |
| 3csu_A | 310 | Protein (aspartate carbamoyltransferase); transfer | 96.55 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 96.55 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 96.53 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 96.51 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 96.51 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 96.5 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 96.5 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.49 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 96.48 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 96.48 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 96.47 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.44 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 96.43 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 96.42 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 96.39 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 96.35 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 96.34 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 96.33 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.31 | |
| 1pg5_A | 299 | Aspartate carbamoyltransferase; 2.60A {Sulfolobus | 96.31 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 96.3 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 96.29 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 96.28 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 96.27 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 96.27 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 96.26 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 96.25 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 96.24 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 96.24 | |
| 1u7z_A | 226 | Coenzyme A biosynthesis bifunctional protein coabc | 96.24 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 96.23 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 96.23 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 96.23 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 96.2 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 96.2 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 96.19 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 96.18 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 96.18 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 96.16 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 96.16 | |
| 1ml4_A | 308 | Aspartate transcarbamoylase; beta pleated sheet, p | 96.16 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 96.14 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 96.13 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 96.13 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 96.12 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 96.11 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 96.11 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 96.09 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 96.06 | |
| 3kzn_A | 359 | Aotcase, N-acetylornithine carbamoyltransferase; t | 96.05 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 96.04 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 96.03 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 96.03 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 96.02 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 96.02 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 96.0 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 96.0 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 95.98 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 95.98 | |
| 4ekn_B | 306 | Aspartate carbamoyltransferase; atcase, aspartate | 95.98 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 95.98 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 95.95 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 95.94 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 95.94 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 95.93 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.93 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 95.92 | |
| 2ef0_A | 301 | Ornithine carbamoyltransferase; TTHA1199, thermus | 95.91 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 95.9 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 95.89 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 95.89 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 95.89 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 95.89 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 95.88 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 95.88 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 95.88 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 95.87 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 95.85 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 95.84 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 95.84 | |
| 1pvv_A | 315 | Otcase, ornithine carbamoyltransferase; dodecamer; | 95.83 | |
| 1duv_G | 333 | Octase-1, ornithine transcarbamoylase; enzyme-inhi | 95.83 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 95.83 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 95.81 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 95.8 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 95.79 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 95.79 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 95.79 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 95.79 | |
| 2i6u_A | 307 | Otcase, ornithine carbamoyltransferase; X-RAY crys | 95.78 | |
| 3sds_A | 353 | Ornithine carbamoyltransferase, mitochondrial; str | 95.78 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 95.78 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 95.78 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 95.77 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 95.77 | |
| 3tpf_A | 307 | Otcase, ornithine carbamoyltransferase; structural | 95.77 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 95.76 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 95.76 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 95.74 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 95.74 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 95.74 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 95.73 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 95.73 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 95.72 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 95.71 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 95.71 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 95.7 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 95.7 | |
| 1vlv_A | 325 | Otcase, ornithine carbamoyltransferase; TM1097, st | 95.67 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 95.67 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 95.67 | |
| 4a8t_A | 339 | Putrescine carbamoyltransferase; trabnsferase PALO | 95.67 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 95.66 | |
| 4f2g_A | 309 | Otcase 1, ornithine carbamoyltransferase 1; struct | 95.66 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 95.66 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 95.66 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 95.66 | |
| 1dxh_A | 335 | Ornithine carbamoyltransferase; transcarbamylase; | 95.66 | |
| 4ep1_A | 340 | Otcase, ornithine carbamoyltransferase; structural | 95.64 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 95.63 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 95.63 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 95.63 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 95.63 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 95.63 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 95.62 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 95.62 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 95.62 | |
| 3r7f_A | 304 | Aspartate carbamoyltransferase; aspartate transcar | 95.62 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 95.62 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 95.61 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 95.61 | |
| 3gd5_A | 323 | Otcase, ornithine carbamoyltransferase; structural | 95.61 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 95.6 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 95.6 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 95.59 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 95.59 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 95.59 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 95.59 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 95.58 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 95.57 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 95.57 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 95.57 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 95.57 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 95.56 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 95.56 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 95.56 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 95.56 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 95.55 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 95.55 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 95.54 | |
| 2gk4_A | 232 | Conserved hypothetical protein; alpha-beta-alpha s | 95.54 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 95.52 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 95.51 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 95.51 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 95.5 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 95.5 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 95.49 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 95.49 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 95.49 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 95.48 | |
| 3fr7_A | 525 | Putative ketol-acid reductoisomerase (OS05G057370 | 95.47 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 95.46 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 95.45 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 95.45 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 95.44 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 95.44 | |
| 4a8p_A | 355 | Putrescine carbamoyltransferase; ornithine agmatin | 95.44 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 95.44 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 95.43 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 95.43 | |
| 2w37_A | 359 | Ornithine carbamoyltransferase, catabolic; transca | 95.42 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 95.42 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 95.42 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 95.42 | |
| 3d6n_B | 291 | Aspartate carbamoyltransferase; reactor, chamber, | 95.41 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 95.41 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 95.41 | |
| 4h31_A | 358 | Otcase, ornithine carbamoyltransferase; structural | 95.4 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 95.4 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 95.39 | |
| 1oth_A | 321 | Protein (ornithine transcarbamoylase); transferase | 95.38 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 95.38 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 95.38 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 95.38 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 95.37 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 95.36 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.34 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 95.33 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 95.33 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 95.31 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 95.31 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 95.29 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 95.26 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 95.26 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 95.26 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 95.26 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 95.26 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 95.26 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.25 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 95.25 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 95.25 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 95.23 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 95.23 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 95.23 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 95.23 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 95.22 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 95.21 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 95.21 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 95.19 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 95.19 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 95.19 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 95.19 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 95.18 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 95.17 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 95.17 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 95.15 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 95.14 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 95.11 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 95.11 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 95.1 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 95.09 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 95.08 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 95.08 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 95.06 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 95.04 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 95.04 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 95.03 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 95.02 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 95.01 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 94.99 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 94.98 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 94.97 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 94.97 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 94.96 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 94.96 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 94.96 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 94.94 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 94.94 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 94.92 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 94.91 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 94.91 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 94.89 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 94.89 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 94.88 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 94.88 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 94.87 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 94.87 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 94.87 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 94.87 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 94.84 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 94.83 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 94.82 | |
| 4amu_A | 365 | Ornithine carbamoyltransferase, catabolic; ornithi | 94.82 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 94.82 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 94.81 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 94.81 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 94.8 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 94.79 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 94.79 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 94.79 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 94.78 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 94.78 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 94.78 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 94.78 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 94.77 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 94.75 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 94.75 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 94.74 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 94.74 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 94.74 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 94.73 | |
| 3q98_A | 399 | Transcarbamylase; rossmann fold, transferase; 2.00 | 94.72 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 94.72 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 94.72 | |
| 4hv4_A | 494 | UDP-N-acetylmuramate--L-alanine ligase; MURC, yers | 94.72 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 94.71 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 94.71 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 94.7 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 94.7 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 94.69 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 94.68 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 94.68 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 94.68 | |
| 3grf_A | 328 | Ornithine carbamoyltransferase; ornithine transcar | 94.67 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 94.66 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 94.65 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 94.65 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 94.65 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 94.65 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 94.64 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 94.63 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 94.63 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 94.63 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 94.63 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 94.61 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 94.59 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 94.59 | |
| 2yfk_A | 418 | Aspartate/ornithine carbamoyltransferase; transcar | 94.59 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 94.58 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 94.58 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 94.57 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 94.57 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 94.56 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 94.56 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 94.54 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 94.52 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 94.51 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 94.5 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 94.49 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 94.49 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 94.49 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 94.47 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 94.47 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 94.45 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 94.42 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 94.42 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 94.41 | |
| 2i76_A | 276 | Hypothetical protein; NADP, dehydrogenase, TM1727, | 94.41 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 94.4 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 94.4 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 94.4 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 94.4 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 94.4 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 94.4 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 94.39 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 94.38 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 94.37 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 94.37 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 94.36 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 94.36 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 94.34 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 94.33 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 94.31 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 94.3 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 94.28 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 94.27 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 94.25 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 94.25 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 94.25 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 94.25 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 94.23 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 94.23 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 94.17 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 94.17 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 94.17 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 94.16 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 94.14 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 94.13 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 94.12 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 94.1 | |
| 3tz6_A | 344 | Aspartate-semialdehyde dehydrogenase; asadh, ASD, | 94.1 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 94.09 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 94.08 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 94.08 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 94.07 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 94.07 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 94.06 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 94.05 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 94.03 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 94.01 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 94.0 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 94.0 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 93.96 |
| >4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-97 Score=717.60 Aligned_cols=281 Identities=46% Similarity=0.783 Sum_probs=275.5
Q ss_pred ceeeecHHHHHHHHHHHHHHHHHhHhccCCCceEEEEEeCCCcchHHHHHHHHHHHHHcCCeEEEEeCCCCCCHHHHHHH
Q 017438 80 AKVIDGKAVAKQIRDEITGEVSRMKDAIGVVPGLAVILVGDRKDSATYVRNKKKACQSVGINSFEVHLPEDTSEQEVLKH 159 (371)
Q Consensus 80 a~ildGk~la~~i~~~ik~~v~~l~~~~g~~P~LaiI~vG~d~aS~~Yv~~k~k~~~~~GI~~~~~~lp~~v~~~el~~~ 159 (371)
|+|||||++|++|++++++++++|+++.|++|+||+|+||+||+|..|+++|.|+|+++||+++.++||++++|+||++.
T Consensus 23 a~ildGk~iA~~i~~~l~~~v~~l~~~~g~~P~LavIlVG~dpaS~~Yv~~K~k~c~~vGi~s~~~~lp~~~se~ell~~ 102 (303)
T 4b4u_A 23 ALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAE 102 (303)
T ss_dssp CEECCHHHHHHHHHHHHHHHHHHHHHHHSCCCEEEEEEESCCHHHHHHHHHHHHHHHHTTCEEEEEEECTTCCHHHHHHH
T ss_pred CEEeehHHHHHHHHHHHHHHHHHHHHcCCCCCcEEEEEeCCCHHHHHHHHHHHHHHHHcCCeEEEEecCccCCHHHHHHH
Confidence 79999999999999999999999998889999999999999999999999999999999999999999999999999999
Q ss_pred HHHhcCCCCccEEEEeCCCCCCCCHHHHHhhCCcccccCccCcchhhhhccCCCccccccCCHHHHHHHHHHhCCCCCCC
Q 017438 160 ISVFNDDPSVHGILVQLPLPCHIDEQSILNAVSMEKDVDGFHPLNIGRLAMRGREPLFIPCTPKGCIELLHRYGFDIKGK 239 (371)
Q Consensus 160 I~~LN~D~~V~GIlVqlPLp~~i~~~~i~~~I~p~KDVDgl~~~N~G~l~~g~~~~~~~PcTa~gvi~lL~~~~i~l~GK 239 (371)
|++||+|++|||||||+|||+|+|+++++++|+|+|||||||+.|.|+|+.| ++.|+||||.||+++|++|+++++||
T Consensus 103 I~~LN~D~~V~GIlVQlPLP~hid~~~i~~~I~p~KDVDG~hp~N~G~L~~g--~~~~~PcTp~gv~~lL~~~~i~l~Gk 180 (303)
T 4b4u_A 103 IEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMG--EAAYGSATPAGIMTILKENNIEIAGK 180 (303)
T ss_dssp HHHHHTCTTCCEEEECSSCCTTSCHHHHHHHSCGGGCTTCCCHHHHHHHHTT--CCCCCCHHHHHHHHHHHHTTCCCTTC
T ss_pred HHHhcCCCCccEEEEeCCCccccChHHHHhccCcccccCccCcchHHHhcCC--CCcccCccHHHHHHHHHHHCCCCCCC
Confidence 9999999999999999999999999999999999999999999999999976 68999999999999999999999999
Q ss_pred EEEEEcCCcccHHHHHHHhccCCCeEEEEeCCCCCHHhhccCCcEEEEccCCCCcccCCCcCCCeEEEEeeecCCCCCCC
Q 017438 240 RAVVIGRSNIVGMPAALLLQREDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGSWIKPGAVIIDVGINPVEDAKS 319 (371)
Q Consensus 240 ~vvVIG~s~~VGkpla~lL~~~gAtVtv~h~~t~~l~~~l~~ADIVIsAvG~p~~v~~d~ik~gavVIDvgin~~~~~~~ 319 (371)
+|+|||||++||||++++|+++|||||+||++|+||++++++|||||+|+|+|++|++||||||++|||+|+|+.++
T Consensus 181 ~vvViGRS~iVGkPla~LL~~~~ATVTi~Hs~T~dl~~~~~~ADIvV~A~G~p~~i~~d~vk~GavVIDVGin~~~~--- 257 (303)
T 4b4u_A 181 HAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDG--- 257 (303)
T ss_dssp EEEEECCCTTTHHHHHHHHHHTTCEEEEECTTCSSHHHHHHTCSEEEECSCSTTCBCGGGSCTTCEEEECCCBCCTT---
T ss_pred EEEEEeccccccchHHHHHHhcCCEEEEecCCCCCHHHHhhcCCeEEeccCCCCccccccccCCCEEEEeceecCCC---
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999754
Q ss_pred CCCceeecccchhhhhhhcceeccCCCCccHHHHHHHHHHHHHHHHHHhc
Q 017438 320 PRGYRLVGDVCYEEACEVASAITPVPGGVGPMTIAMLLSNTLTSAKRVHN 369 (371)
Q Consensus 320 ~~g~kl~GDVd~~~v~~~a~~iTPVPGGVGp~T~amLl~n~v~a~~~~~~ 369 (371)
+++|||||++++++|++||||||||||||++|||+|+++|+|++.|
T Consensus 258 ----~~vGDVdf~~v~~~a~~iTPVPGGVGPmTiamLl~Ntv~aa~r~~G 303 (303)
T 4b4u_A 258 ----GGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG 303 (303)
T ss_dssp ----SCBCSBCCTTGGGTCSEECCSSSSHHHHHHHHHHHHHHHHHHHHHC
T ss_pred ----CeECCcCHHHHhhhCcEECCCCCCchHHHHHHHHHHHHHHHHHhcC
Confidence 7999999999999999999999999999999999999999999876
|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >3kzn_A Aotcase, N-acetylornithine carbamoyltransferase; transcarbamylase, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: KCX AOR; 1.80A {Xanthomonas campestris PV} PDB: 3kzc_A* 3kzm_A* 3kzk_A* 3kzo_A* 3m4j_A* 3m5d_A* 3m5c_A* 3l05_A* 3l02_A* 3m4n_A* 3l06_A* 3l04_A* | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A | Back alignment and structure |
|---|
| >1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A | Back alignment and structure |
|---|
| >3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A | Back alignment and structure |
|---|
| >4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 371 | ||||
| d1a4ia1 | 170 | c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehy | 4e-60 | |
| d1b0aa1 | 166 | c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehy | 3e-57 | |
| d1edza2 | 146 | c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/ | 3e-48 | |
| d1edza1 | 171 | c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehy | 1e-43 | |
| d1a4ia2 | 125 | c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/ | 2e-38 | |
| d1b0aa2 | 121 | c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/ | 3e-38 |
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Aminoacid dehydrogenase-like, C-terminal domain domain: Methylenetetrahydrofolate dehydrogenase/cyclohydrolase species: Human (Homo sapiens) [TaxId: 9606]
Score = 189 bits (481), Expect = 4e-60
Identities = 93/167 (55%), Positives = 116/167 (69%)
Query: 200 FHPLNIGRLAMRGREPLFIPCTPKGCIELLHRYGFDIKGKRAVVIGRSNIVGMPAALLLQ 259
+N GRLA FIPCTPKGC+EL+ G I G+ AVV+GRS IVG P LL
Sbjct: 1 LTSINAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLL 60
Query: 260 REDATVSIVHSRTKNPEEITRQADIIISAVGQPNMVRGSWIKPGAVIIDVGINPVEDAKS 319
+ATV+ HS+T + +E + DI++ A GQP MV+G WIKPGA++ID GIN V D K
Sbjct: 61 WNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKK 120
Query: 320 PRGYRLVGDVCYEEACEVASAITPVPGGVGPMTIAMLLSNTLTSAKR 366
P G ++VGDV Y+EA E AS ITPVPGGVGPMT+AML+ +T+ SAKR
Sbjct: 121 PNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKR 167
|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 371 | |||
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 100.0 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 100.0 | |
| d1edza2 | 146 | Tetrahydrofolate dehydrogenase/cyclohydrolase {Bak | 100.0 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 100.0 | |
| d1b0aa2 | 121 | Tetrahydrofolate dehydrogenase/cyclohydrolase {Esc | 100.0 | |
| d1a4ia2 | 125 | Tetrahydrofolate dehydrogenase/cyclohydrolase {Hum | 100.0 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 99.65 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 99.61 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 99.59 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 99.57 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 99.51 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 99.21 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 99.02 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 99.01 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 98.66 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 98.57 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 98.48 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 98.28 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 98.13 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 98.13 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 98.04 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 98.02 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 98.0 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 97.99 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 97.85 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 97.8 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 97.76 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 97.74 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 97.74 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 97.65 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 97.56 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 97.44 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 97.39 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.37 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 97.29 | |
| d1vi2a2 | 102 | Putative shikimate dehydrogenase YdiB {Escherichia | 97.27 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 97.22 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 96.99 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.97 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 96.96 | |
| d1p77a2 | 101 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 96.95 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 96.9 | |
| d1nvta2 | 110 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 96.9 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 96.88 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 96.87 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 96.83 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 96.82 | |
| d1nyta2 | 101 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 96.82 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 96.8 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 96.78 | |
| d1npya2 | 102 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 96.74 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 96.73 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 96.73 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 96.71 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 96.67 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 96.63 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 96.63 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 96.62 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 96.59 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 96.57 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 96.56 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 96.55 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 96.53 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 96.53 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 96.5 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 96.49 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 96.49 | |
| d1omoa_ | 320 | Archaeal alanine dehydrogenase {Archaeon Archaeogl | 96.49 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 96.47 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 96.46 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 96.43 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 96.41 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 96.39 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 96.37 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 96.37 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 96.36 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 96.34 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 96.33 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 96.33 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 96.31 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 96.3 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 96.28 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 96.25 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 96.25 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 96.23 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 96.22 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 96.2 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 96.19 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 96.19 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 96.18 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 96.18 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 96.17 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 96.16 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 96.15 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 96.15 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 96.15 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 96.12 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 96.11 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 96.08 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 96.08 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 96.05 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 96.03 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 96.02 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 96.01 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 96.01 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 96.0 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 95.99 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 95.96 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 95.95 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 95.93 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 95.92 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 95.91 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 95.91 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 95.88 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 95.87 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 95.84 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 95.84 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 95.83 | |
| d1x7da_ | 340 | Ornithine cyclodeaminase {Pseudomonas putida [TaxI | 95.83 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 95.82 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 95.78 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 95.77 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 95.75 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 95.7 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 95.69 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 95.66 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 95.65 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 95.64 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 95.61 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 95.59 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 95.58 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 95.55 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 95.54 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 95.5 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 95.43 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 95.42 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 95.41 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 95.39 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 95.38 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 95.36 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 95.3 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 95.27 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 95.21 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 95.19 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 95.17 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 95.16 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 95.14 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 95.07 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 95.06 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 95.02 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 95.02 | |
| d1pvva2 | 163 | Ornithine transcarbamoylase {Archaeon Pyrococcus f | 94.98 | |
| d1tuga1 | 310 | Aspartate carbamoyltransferase catalytic subunit { | 94.95 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 94.94 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 94.9 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 94.89 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 94.88 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 94.87 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 94.78 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 94.78 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 94.74 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 94.73 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 94.71 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 94.7 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 94.7 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 94.66 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 94.61 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 94.44 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 94.39 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 94.35 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 94.33 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 94.3 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 94.27 | |
| d1o0sa1 | 308 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 94.25 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 94.12 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 94.11 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 93.99 | |
| d1mv8a3 | 136 | GDP-mannose 6-dehydrogenase, GDP-binding domain {P | 93.99 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 93.95 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 93.9 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 93.9 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 93.76 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 93.7 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 93.67 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 93.62 | |
| d1gq2a1 | 298 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 93.61 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 93.59 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 93.57 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 93.54 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 93.52 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 93.46 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 93.43 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 93.43 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 93.39 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 93.37 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 93.34 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 93.29 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 93.29 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 93.28 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 93.25 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 93.24 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 93.11 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 93.01 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 93.0 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 92.92 | |
| d1vlva2 | 161 | Ornithine transcarbamoylase {Thermotoga maritima [ | 92.91 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 92.9 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 92.9 | |
| d1np3a2 | 182 | Class I ketol-acid reductoisomerase (KARI) {Pseudo | 92.86 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 92.84 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 92.84 | |
| d1u7za_ | 223 | Coenzyme A biosynthesis bifunctional protein CoaBC | 92.83 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 92.66 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 92.66 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 92.65 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 92.55 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 92.27 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 92.22 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 92.09 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 92.08 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 92.07 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 92.05 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 92.01 | |
| d1otha2 | 170 | Ornithine transcarbamoylase {Human (Homo sapiens) | 91.96 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 91.83 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 91.82 | |
| d1ml4a2 | 157 | Aspartate carbamoyltransferase catalytic subunit { | 91.63 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 91.59 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 91.53 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 91.44 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 91.4 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 91.37 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 91.35 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 91.26 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 91.23 | |
| d1pg5a2 | 153 | Aspartate carbamoyltransferase catalytic subunit { | 91.15 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 91.14 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 91.06 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 91.01 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 90.88 | |
| d1dxha2 | 185 | Ornithine transcarbamoylase {Pseudomonas aeruginos | 90.63 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 90.56 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 90.52 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 90.51 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 90.51 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 90.37 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 90.31 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 90.27 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 90.23 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 89.94 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 89.72 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 89.7 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 89.66 | |
| d2h1qa1 | 251 | Hypothetical protein Dhaf_3308 {Desulfitobacterium | 89.59 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 89.36 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 89.28 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 89.23 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 88.52 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 88.37 | |
| d2at2a2 | 151 | Aspartate carbamoyltransferase catalytic subunit { | 88.16 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 88.14 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 88.04 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 88.04 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 88.03 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 87.52 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 87.2 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 87.08 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 86.8 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 86.74 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 86.68 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 86.43 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 86.08 | |
| d7reqa2 | 168 | Methylmalonyl-CoA mutase alpha subunit, C-terminal | 85.97 | |
| d1duvg2 | 183 | Ornithine transcarbamoylase {Escherichia coli [Tax | 85.82 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 85.75 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 85.73 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 85.65 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 85.57 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 85.49 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 85.29 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 85.18 | |
| d1qmga2 | 226 | Class II ketol-acid reductoisomerase (KARI) {Spina | 84.86 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 84.56 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 84.46 | |
| d1ekxa2 | 160 | Aspartate carbamoyltransferase catalytic subunit { | 84.22 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 83.64 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 83.59 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 83.49 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 83.47 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 83.44 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 83.44 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 83.19 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 82.67 | |
| d1j4aa2 | 134 | D-lactate dehydrogenase {Lactobacillus helveticus | 82.61 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 82.5 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 82.46 | |
| d1dlja3 | 108 | UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD | 82.23 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 82.12 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 81.71 | |
| d2csua1 | 129 | Acetate-CoA ligase alpha chain, AcdA, N-terminal d | 81.28 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 80.48 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 80.41 |
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Aminoacid dehydrogenase-like, C-terminal domain domain: Methylenetetrahydrofolate dehydrogenase/cyclohydrolase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=4.7e-56 Score=396.57 Aligned_cols=164 Identities=51% Similarity=0.876 Sum_probs=158.6
Q ss_pred cCcchhhhhccCCCccccccCCHHHHHHHHHHhCCCCCCCEEEEEcCCcccHHHHHHHhccCCCeEEEEeCCCCCHHhhc
Q 017438 200 FHPLNIGRLAMRGREPLFIPCTPKGCIELLHRYGFDIKGKRAVVIGRSNIVGMPAALLLQREDATVSIVHSRTKNPEEIT 279 (371)
Q Consensus 200 l~~~N~G~l~~g~~~~~~~PcTa~gvi~lL~~~~i~l~GK~vvVIG~s~~VGkpla~lL~~~gAtVtv~h~~t~~l~~~l 279 (371)
|||+|+|+|..| .+.|+||||.||+++|++|+++++||+|+|||||++||+|++++|.++|||||+||++|+++++++
T Consensus 1 fhp~N~G~l~~~--~~~~~PcTp~aI~~lL~~y~i~l~GK~v~VIGrS~~VG~Pla~lL~~~gatVt~~h~~t~~l~~~~ 78 (166)
T d1b0aa1 1 FHPYNVGRLCQR--APRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHV 78 (166)
T ss_dssp CSHHHHHHHHTT--CCSSCCHHHHHHHHHHHHTTCCCTTCEEEEECCCTTTHHHHHHHHHTTTCEEEEECSSCSCHHHHH
T ss_pred CCchhHHHHhCC--CCCCCCchHHHHHHHHHHcCcccccceEEEEeccccccHHHHHHHHHhhccccccccccchhHHHH
Confidence 799999999976 689999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCcEEEEccCCCCcccCCCcCCCeEEEEeeecCCCCCCCCCCceeecccchhhhhhhcceeccCCCCccHHHHHHHHHH
Q 017438 280 RQADIIISAVGQPNMVRGSWIKPGAVIIDVGINPVEDAKSPRGYRLVGDVCYEEACEVASAITPVPGGVGPMTIAMLLSN 359 (371)
Q Consensus 280 ~~ADIVIsAvG~p~~v~~d~ik~gavVIDvgin~~~~~~~~~g~kl~GDVd~~~v~~~a~~iTPVPGGVGp~T~amLl~n 359 (371)
++|||||+|+|+|++|++||+|+|++|||+|+++.+++ +++||+||+++.++|+++|||||||||||++|||+|
T Consensus 79 ~~ADivI~a~G~p~~i~~~~vk~g~vvIDvGi~~~~~~------~~~Gdvd~~~v~~~a~~~TPvPGGVGP~Tva~L~~N 152 (166)
T d1b0aa1 79 ENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENG------KVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIEN 152 (166)
T ss_dssp HHCSEEEECSCCTTCBCTTTSCTTCEEEECCCEECTTS------CEECSBCHHHHHHHCSEECCSSSSSHHHHHHHHHHH
T ss_pred hhhhHhhhhccCcccccccccCCCcEEEecCceecCCC------CEEeccccHhHHhheeEeCCCCCcccHHHHHHHHHH
Confidence 99999999999999999999999999999999998763 899999999999999999999999999999999999
Q ss_pred HHHHHHHHhcCC
Q 017438 360 TLTSAKRVHNFQ 371 (371)
Q Consensus 360 ~v~a~~~~~~~~ 371 (371)
+++++++|++-|
T Consensus 153 ~v~a~~~~~~~~ 164 (166)
T d1b0aa1 153 TLQACVEYHDPQ 164 (166)
T ss_dssp HHHHHHHTTSCC
T ss_pred HHHHHHHHhCcc
Confidence 999999998754
|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|