Citrus Sinensis ID: 017648


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MDQNWKFTRLGVLFVVLISQSLCLCWSLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQVDEGQLSSAAKKEQSCYERSIKWNGVLDEDTVQRRLLQINPFRNLKGRILGIAPTSSPPPSSDAIPPASVGSSDDTKANETSSDRNDSVSPPKLSNPAPAPAPNQTPTPTPSIPIPRPSSSQSHQKSGGSSSKHIAILGGVIGGAILLVATVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGNYSFSGDNHF
cccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEccccEEEEEEcccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccEEEccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEccccccccccc
ccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccccccccccccEEEccccEEEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHcHccHHHHHHHHHHHcccccccccccccHHcccHHHHHcccccccccccccccccccccccccccHcccHccccccccccccccccccccHcccccccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEcccccccccccc
mdqnwkftrLGVLFVVLISQSLCLCWSLNDEGLALLRLRErvvrdpygaltswrscdtennpcswfgvecsdgkvvnlnlkdlclegtlapeiqslTHIKSIIlrnnsfsgiipegfgeleelevldfghnnfsgplpndlginhSLTIllldnndfvgslspEIYKLQvlsesqvdegqlssaAKKEQSCYERsikwngvldedTVQRRLLqinpfrnlkgrilgiaptsspppssdaippasvgssddtkanetssdrndsvsppklsnpapapapnqtptptpsipiprpsssqshqksggssskHIAILGGVIGGAILLVATVGIYLCRcnkvstvkpwatglsgqLQKAfvtgnysfsgdnhf
mdqnwkftrLGVLFVVLISQSLCLCWSLNDEGLALLRLRERVVRDPYGaltswrscdtennpCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQVDEGQlssaakkeqscyersikwngvldedtvQRRLLQINPFRNLKGRILGIAptsspppssdAIPPASVGSSDDTKANetssdrndsvsppkLSNPAPAPAPNQTPTPTPSIPIPRPSSSQSHQKSGGSSSKHIAILGGVIGGAILLVATVGIYLCRCNKVSTVkpwatglsgqlqkafvtgnysfsgdnhf
MDQNWKFTRLGVLFVVLISQSLCLCWSLNDEGlallrlrervvrDPYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPegfgeleelevldfgHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQVDEGQLSSAAKKEQSCYERSIKWNGVLDEDTVQRRLLQINPFRNLKGRILGIaptsspppssdaippasVGSSDDTKANETSSDRNDSVsppklsnpapapapnqtptptpsipiprpsssqshqksggssskhiailggviggaillvaTVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGNYSFSGDNHF
****WKFTRLGVLFVVLISQSLCLCWSLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVL*******************CYERSIKWNGVLDEDTVQRRLLQINPFRNLKGRILGI*********************************************************************************HIAILGGVIGGAILLVATVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGNYS*******
*****KF*RLGVLFVVLISQSLCLCWSLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQVDEGQLSSAAKKEQSCYERSIKWNGVLDEDTVQRRLLQINPFRNLKGRILGIAPTSSPPPS**************************************************************************AILGGVIGGAILLVATVGIYLCRC******************KAFVTGNYSFSGDNHF
MDQNWKFTRLGVLFVVLISQSLCLCWSLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLS*******************YERSIKWNGVLDEDTVQRRLLQINPFRNLKGRILGIAP*******************************************************TPSI*******************KHIAILGGVIGGAILLVATVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGNYSFSGDNHF
***NWKFTRLGVLFVVLISQSLCLCWSLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQVDEGQLSSAAKKEQSCYERSIKWNGVLDEDTVQRRLLQINPFRNLKGRILGIAPTSSPPPSSDAIPPASVGSSDDTKANETSSDRNDSVSPPKLSNPAPAPAPNQTPTPTPSIPIPRPSSSQSHQKSGGSSSKHIAILGGVIGGAILLVATVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGNYSFSGDNHF
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
iiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQNWKFTRLGVLFVVLISQSLCLCWSLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQVDEGQLSSAAKKEQSCYERSIKWNGVLDEDTVQRRLLQINPFRNLKGRILGIAPTSSPPPSSDAIPPASVGSSDDTKANETSSDRNDSVSPPKLSNPAPAPAPNQTPTPTPSIPIPRPSSSQSHQKSGGSSSKHIAILGGVIGGAILLVATVGIYLCRCNKVSTVKPWATGLSGQLQKAFVTGNYSFSGDNHF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query368 2.2.26 [Sep-21-2011]
C0LGU7 695 Probable LRR receptor-lik yes no 0.855 0.453 0.325 2e-37
C0LGQ4 678 Probable LRR receptor-lik no no 0.891 0.483 0.314 4e-36
C0LGH8 664 Probable LRR receptor-lik no no 0.410 0.227 0.335 6e-21
Q9C9N5 685 Probable inactive leucine no no 0.418 0.224 0.369 2e-19
Q93ZS4 632 Protein NSP-INTERACTING K no no 0.489 0.284 0.344 1e-18
Q8RY65 635 Protein NSP-INTERACTING K no no 0.385 0.223 0.351 2e-18
C0LGS3 768 Probable LRR receptor-lik no no 0.839 0.402 0.278 3e-18
Q9FZ59 1088 Leucine-rich repeat recep no no 0.472 0.159 0.364 2e-17
Q9LVP0 1102 Probable leucine-rich rep no no 0.388 0.129 0.4 2e-17
P93194 1109 Receptor-like protein kin N/A no 0.394 0.130 0.358 4e-17
>sp|C0LGU7|Y5458_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g45840 OS=Arabidopsis thaliana GN=At5g45840 PE=2 SV=1 Back     alignment and function desciption
 Score =  156 bits (395), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 119/366 (32%), Positives = 166/366 (45%), Gaps = 51/366 (13%)

Query: 32  GLALLRLRERVVRDPYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAP 91
           G  LL+ R RV  DP+G L +W   D  ++ CSWFGV C D KV  LNL    L GTLAP
Sbjct: 34  GFVLLKFRARVDSDPHGTLANWNVSD-HDHFCSWFGVTCVDNKVQMLNLSGCSLGGTLAP 92

Query: 92  EIQSLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILL 151
           E+  L+ ++S+IL  N  SG IP  F    +LE LD   NN +G +P +L    +   LL
Sbjct: 93  ELSQLSELRSLILSKNKLSGDIPNEFASFAKLEFLDLRDNNLNGVVPPELNKVLTPENLL 152

Query: 152 LDNNDFVGSLSPEIYKLQVLSESQVDEG-QLSSAAKKEQSCYERSIKWNGVLDEDTVQRR 210
           L  N F G ++ +  +LQ L + Q+++  +LSS +     C  R + +        V RR
Sbjct: 153 LSGNKFAGFMTVKFLRLQSLYKVQMNKNRELSSVSADVLDCVNRKLGY-------CVSRR 205

Query: 211 LLQINPFRNLKGRILGIAPTSSPPPSSDAIPPASVGSSDDTKANETSSDRNDSVSPPKLS 270
            L        K  +L I  TS            +   +     NETS  +   +   + S
Sbjct: 206 SLITR--NKAKAFVLRIRATSRHYMVRRESHGKNYVVNYHPSENETSIFKRRELL-EETS 262

Query: 271 NPAPAPAPNQTPTPTP---SIPIPRPSSS------------------------------- 296
           N A  PAP+ TP+P+P   +I  PR S S                               
Sbjct: 263 NLAAMPAPD-TPSPSPEIITIVFPRSSGSFPALTNAKKRIPPLIPPSSPPPLPTNNTIAS 321

Query: 297 ----QSHQKSGGSSSKHIAILGGVIGGAILLVATVGIYLCRCNKVSTVKPWATGLSGQLQ 352
               +  +KS G     + ++ GV     +L+    I+  R   V ++ PW TGLSGQLQ
Sbjct: 322 DPPRKFEEKSKGFKDVWLYVVIGVAAFVAMLIIVAVIFFFRKRAVKSIGPWKTGLSGQLQ 381

Query: 353 KAFVTG 358
           KAFVTG
Sbjct: 382 KAFVTG 387





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ4|MRH1_ARATH Probable LRR receptor-like serine/threonine-protein kinase MRH1 OS=Arabidopsis thaliana GN=MRH1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGH8|Y1634_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g63430 OS=Arabidopsis thaliana GN=At1g63430 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9N5|Y1668_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 OS=Arabidopsis thaliana GN=At1g66830 PE=1 SV=1 Back     alignment and function description
>sp|Q93ZS4|NIK3_ARATH Protein NSP-INTERACTING KINASE 3 OS=Arabidopsis thaliana GN=NIK3 PE=1 SV=1 Back     alignment and function description
>sp|Q8RY65|NIK2_ARATH Protein NSP-INTERACTING KINASE 2 OS=Arabidopsis thaliana GN=NIK2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS3|Y4372_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g37250 OS=Arabidopsis thaliana GN=At4g37250 PE=2 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query368
449519434 608 PREDICTED: probable LRR receptor-like se 0.945 0.572 0.490 4e-78
449460929 680 PREDICTED: probable LRR receptor-like se 0.945 0.511 0.490 6e-78
356569292 644 PREDICTED: probable LRR receptor-like se 0.826 0.472 0.495 3e-76
356551399 643 PREDICTED: probable LRR receptor-like se 0.902 0.516 0.485 8e-76
356537999 638 PREDICTED: probable LRR receptor-like se 0.831 0.479 0.510 8e-75
357461359 645 Ser-thr protein kinase [Medicago truncat 0.913 0.520 0.488 3e-71
356569509 699 PREDICTED: probable LRR receptor-like se 0.967 0.509 0.437 5e-68
356499209 645 PREDICTED: probable LRR receptor-like se 0.904 0.516 0.480 5e-68
224101185202 predicted protein [Populus trichocarpa] 0.529 0.965 0.705 9e-68
225434508 720 PREDICTED: probable LRR receptor-like se 0.578 0.295 0.6 2e-67
>gi|449519434|ref|XP_004166740.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like, partial [Cucumis sativus] Back     alignment and taxonomy information
 Score =  298 bits (762), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 186/379 (49%), Positives = 232/379 (61%), Gaps = 31/379 (8%)

Query: 3   QNWKFTRL-------GVLFVVLISQSLCLCWSLNDEGLALLRLRERVVRDPYGALTSWRS 55
           QN  F R        G + + L+ QS  L WSLN+EGL LL+ RERVV DP+G L++W  
Sbjct: 5   QNLSFHRFRLRIGVYGFVVISLLFQSFHLSWSLNEEGLTLLKFRERVVNDPFGVLSNWND 64

Query: 56  CDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPE 115
              + NPC WFGVECSDGKVV+LNLKDLCLEGTL PE+++L HIKSI LRNNSF+G IP+
Sbjct: 65  HKEDINPCFWFGVECSDGKVVSLNLKDLCLEGTLTPELKNLVHIKSINLRNNSFTGTIPQ 124

Query: 116 GFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQ 175
           G G LEELEVLD G+NNF GPLP+DLG N SL ILLLDNN  + SLSPEIY+LQ+LSE Q
Sbjct: 125 GLGGLEELEVLDLGYNNFCGPLPSDLGSNLSLGILLLDNNKDLRSLSPEIYQLQLLSEFQ 184

Query: 176 VDEGQLSSAAKKEQSCYERSIKWNGVLDEDTVQRRLLQINPFR---NLKGRILG-IAPTS 231
           VDE QLS+ A+    C + S+  + V  +D+  RR L+ +  +    ++GR+   + P +
Sbjct: 185 VDENQLSNTAEGSL-CNKESMSCDAVQVKDSRGRRELRASASQAQLTIQGRVAEVVVPLT 243

Query: 232 SPPPS---SD---------AIPPASVGSSDDTKANETSSDRNDSVSPPKLSNPAPAPAPN 279
            P PS   SD         + P  + GS         S+  N +  PP       AP+  
Sbjct: 244 PPSPSGGNSDRPPSNSPPPSPPAGAQGSQPPPPGTGISTSNNATSPPPSFK----APSEK 299

Query: 280 QTPTPTPSIPIPRPSSSQSHQKSGGSSSKHIAILGGVIGGAILLVATVGIYLCRCNKVST 339
             P     +P P+PSS Q   K+  S    + +  G     I L   VGIYL   NK +T
Sbjct: 300 TPPAAPEGLPSPQPSSKQQGGKNKSSVGVVVGVSVGAAVFVIAL--AVGIYLWTNNK-AT 356

Query: 340 VKPWATGLSGQLQKAFVTG 358
           VKPWATGLSGQLQKAFVTG
Sbjct: 357 VKPWATGLSGQLQKAFVTG 375




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449460929|ref|XP_004148196.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356569292|ref|XP_003552837.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like [Glycine max] Back     alignment and taxonomy information
>gi|356551399|ref|XP_003544063.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like [Glycine max] Back     alignment and taxonomy information
>gi|356537999|ref|XP_003537493.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like [Glycine max] Back     alignment and taxonomy information
>gi|357461359|ref|XP_003600961.1| Ser-thr protein kinase [Medicago truncatula] gi|355490009|gb|AES71212.1| Ser-thr protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356569509|ref|XP_003552942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At5g45840-like [Glycine max] Back     alignment and taxonomy information
>gi|356499209|ref|XP_003518434.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase MRH1-like [Glycine max] Back     alignment and taxonomy information
>gi|224101185|ref|XP_002312176.1| predicted protein [Populus trichocarpa] gi|222851996|gb|EEE89543.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225434508|ref|XP_002278392.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At5g45840-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query368
TAIR|locus:2124102 678 MRH1 "morphogenesis of root ha 0.464 0.252 0.346 1.5e-27
TAIR|locus:2182915 553 AT5G07150 [Arabidopsis thalian 0.361 0.240 0.411 1.4e-25
TAIR|locus:2036636 632 NIK3 "NSP-interacting kinase 3 0.380 0.221 0.340 3e-18
TAIR|locus:2033379 685 AT1G66830 [Arabidopsis thalian 0.415 0.223 0.326 4.6e-18
TAIR|locus:4515102753 598 AT1G73066 [Arabidopsis thalian 0.489 0.301 0.287 7.2e-18
TAIR|locus:2033000 702 AT1G25320 [Arabidopsis thalian 0.421 0.220 0.325 1.8e-15
TAIR|locus:2038706 716 AT2G01210 [Arabidopsis thalian 0.456 0.234 0.309 1e-14
TAIR|locus:2058598 773 AT2G23300 [Arabidopsis thalian 0.453 0.216 0.305 1.2e-14
TAIR|locus:2163056 664 AT5G41180 [Arabidopsis thalian 0.366 0.203 0.280 3.1e-14
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.404 0.134 0.318 3.2e-14
TAIR|locus:2124102 MRH1 "morphogenesis of root hair 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 234 (87.4 bits), Expect = 1.5e-27, Sum P(2) = 1.5e-27
 Identities = 60/173 (34%), Positives = 82/173 (47%)

Query:    14 FVVLISQSLCLCWSLNDEGXXXXXXXXXXXXDPYGALTSWRSCDTENNPCSWFGVECSDG 73
             F ++I     L  SL  +G            DP+G L +W      N+ C W GV C DG
Sbjct:    12 FFLIIGLQAPLSLSLTSQGSALLKFRARVNSDPHGTLANWNVSGI-NDLCYWSGVTCVDG 70

Query:    74 KVVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSFSGIIPXXXXXXXXXXXXXXXHNNF 133
             KV  L+L    LEGTLAPE+  L+ ++S+IL  N FSG IP                N+ 
Sbjct:    71 KVQILDLSGYSLEGTLAPELSQLSDLRSLILSRNHFSGGIPKEYGSFENLEVLDLRENDL 130

Query:   134 SGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQVDEG-QLSSAA 185
             SG +P +L    SL  LLL  N F   +  +I +LQ   E ++ +  +LS  A
Sbjct:   131 SGQIPPELSNGLSLKHLLLSGNKFSDDMRIKIVRLQSSYEVRLKKSPKLSPLA 183


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0048765 "root hair cell differentiation" evidence=RCA;IMP
GO:0007155 "cell adhesion" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0048527 "lateral root development" evidence=RCA
GO:0048589 "developmental growth" evidence=RCA
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
TAIR|locus:2182915 AT5G07150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036636 NIK3 "NSP-interacting kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033379 AT1G66830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033000 AT1G25320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038706 AT2G01210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058598 AT2G23300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163056 AT5G41180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query368
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-09
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 4e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.001
pfam04652315 pfam04652, DUF605, Vta1 like 0.001
pfam04652315 pfam04652, DUF605, Vta1 like 0.001
PRK14954620 PRK14954, PRK14954, DNA polymerase III subunits ga 0.001
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 0.002
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.004
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
 Score = 69.5 bits (170), Expect = 7e-13
 Identities = 41/112 (36%), Positives = 57/112 (50%), Gaps = 11/112 (9%)

Query: 61  NPCS-----WFGVEC----SDGK--VVNLNLKDLCLEGTLAPEIQSLTHIKSIILRNNSF 109
           +PC      W G +C    + GK  +  L L +  L G +  +I  L H++SI L  NS 
Sbjct: 395 DPCVPQQHPWSGADCQFDSTKGKWFIDGLGLDNQGLRGFIPNDISKLRHLQSINLSGNSI 454

Query: 110 SGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSL 161
            G IP   G +  LEVLD  +N+F+G +P  LG   SL IL L+ N   G +
Sbjct: 455 RGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRV 506


Length = 623

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 368
PLN03150623 hypothetical protein; Provisional 99.89
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.72
PLN03150623 hypothetical protein; Provisional 99.34
KOG0617264 consensus Ras suppressor protein (contains leucine 99.32
KOG0617264 consensus Ras suppressor protein (contains leucine 99.22
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.87
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG4237498 consensus Extracellular matrix protein slit, conta 98.76
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.75
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.72
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.64
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.58
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.58
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.58
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.55
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.54
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.51
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.49
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.47
PLN032101153 Resistant to P. syringae 6; Provisional 98.47
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.38
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.34
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.33
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.29
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.18
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.09
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.09
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.98
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.86
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.64
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.62
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.51
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.47
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.31
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.9
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.7
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 96.58
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.56
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.28
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.23
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.21
PRK15386426 type III secretion protein GogB; Provisional 96.19
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.15
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.95
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.84
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.77
PF0869340 SKG6: Transmembrane alpha-helix domain; InterPro: 95.77
PRK15386426 type III secretion protein GogB; Provisional 95.71
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.25
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 95.19
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 95.14
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.0
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 94.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.73
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 94.59
PF15102146 TMEM154: TMEM154 protein family 94.21
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 93.46
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 92.94
PF12273130 RCR: Chitin synthesis regulation, resistance to Co 92.82
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.8
PF05454290 DAG1: Dystroglycan (Dystrophin-associated glycopro 92.72
KOG2123388 consensus Uncharacterized conserved protein [Funct 92.16
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 91.58
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.0
smart0037026 LRR Leucine-rich repeats, outliers. 91.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.59
PF13908179 Shisa: Wnt and FGF inhibitory regulator 89.54
PF12877 684 DUF3827: Domain of unknown function (DUF3827); Int 89.08
smart0037026 LRR Leucine-rich repeats, outliers. 89.07
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.07
PF04478154 Mid2: Mid2 like cell wall stress sensor; InterPro: 89.02
PF0720498 Orthoreo_P10: Orthoreovirus membrane fusion protei 88.75
PF02480439 Herpes_gE: Alphaherpesvirus glycoprotein E; InterP 88.62
PF05283186 MGC-24: Multi-glycosylated core protein 24 (MGC-24 88.2
PF1457575 EphA2_TM: Ephrin type-A receptor 2 transmembrane d 87.57
PF06809341 NPDC1: Neural proliferation differentiation contro 86.57
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 86.31
PF06697278 DUF1191: Protein of unknown function (DUF1191); In 85.91
PF03229126 Alpha_GJ: Alphavirus glycoprotein J; InterPro: IPR 85.55
PF0539394 Hum_adeno_E3A: Human adenovirus early E3A glycopro 84.65
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 84.35
PF15069143 FAM163: FAM163 family 83.34
PF06679163 DUF1180: Protein of unknown function (DUF1180); In 83.31
PF14610189 DUF4448: Protein of unknown function (DUF4448) 82.39
COG3889872 Predicted solute binding protein [General function 82.23
TIGR03154465 sulfolob_CbsA cytochrome b558/566, subunit A. Memb 81.96
PF08374 221 Protocadherin: Protocadherin; InterPro: IPR013585 81.37
PF06809341 NPDC1: Neural proliferation differentiation contro 80.81
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.23
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.89  E-value=2.8e-22  Score=206.51  Aligned_cols=149  Identities=31%  Similarity=0.508  Sum_probs=128.2

Q ss_pred             cCcHHHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCC-----CcceeEeC--C----CcEEEEEecCCCCcccCchhhc
Q 017648           26 WSLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPC-----SWFGVECS--D----GKVVNLNLKDLCLEGTLAPEIQ   94 (368)
Q Consensus        26 ~~~~~~~~aLl~~k~~~~~~~~~~l~~W~~~~~~~~~C-----~w~Gv~C~--~----~~v~~L~L~~n~l~g~~p~~l~   94 (368)
                      ....+|.++|+++|+.+. ++.  ..+|.  .   ++|     .|.||.|.  .    ..|+.|+|++|++.|.+|..+.
T Consensus       368 ~t~~~~~~aL~~~k~~~~-~~~--~~~W~--g---~~C~p~~~~w~Gv~C~~~~~~~~~~v~~L~L~~n~L~g~ip~~i~  439 (623)
T PLN03150        368 KTLLEEVSALQTLKSSLG-LPL--RFGWN--G---DPCVPQQHPWSGADCQFDSTKGKWFIDGLGLDNQGLRGFIPNDIS  439 (623)
T ss_pred             ccCchHHHHHHHHHHhcC-Ccc--cCCCC--C---CCCCCcccccccceeeccCCCCceEEEEEECCCCCccccCCHHHh
Confidence            345679999999999983 332  24786  2   345     79999995  1    2489999999999999999999


Q ss_pred             CCCCCCEEEeecCCCCcCCccccCCCCCCCEEEccCCcCCCCCCcccCCCCCCCEEEccCCcCCccCchhhcCC-CCCCE
Q 017648           95 SLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKL-QVLSE  173 (368)
Q Consensus        95 ~L~~L~~L~Ls~N~l~g~~P~~~~~l~~L~~L~Ls~N~l~g~lP~~l~~l~~L~~L~Ls~N~l~g~iP~~l~~l-~~L~~  173 (368)
                      .|++|+.|+|++|.|.|.+|..++.+++|+.|+|++|+++|.+|..++++++|+.|+|++|+|+|.+|..+..+ .++..
T Consensus       440 ~L~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~N~lsg~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~l~~~~~~~~~  519 (623)
T PLN03150        440 KLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRVPAALGGRLLHRAS  519 (623)
T ss_pred             CCCCCCEEECCCCcccCcCChHHhCCCCCCEEECCCCCCCCCCchHHhcCCCCCEEECcCCcccccCChHHhhccccCce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999988764 46778


Q ss_pred             EeccCCCCC
Q 017648          174 SQVDEGQLS  182 (368)
Q Consensus       174 L~L~~N~l~  182 (368)
                      +++.+|...
T Consensus       520 l~~~~N~~l  528 (623)
T PLN03150        520 FNFTDNAGL  528 (623)
T ss_pred             EEecCCccc
Confidence            888888643



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF05454 DAG1: Dystroglycan (Dystrophin-associated glycoprotein 1); InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5 Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13908 Shisa: Wnt and FGF inhibitory regulator Back     alignment and domain information
>PF12877 DUF3827: Domain of unknown function (DUF3827); InterPro: IPR024606 The function of the proteins in this entry is not currently known, but one of the human proteins (Q9HCM3 from SWISSPROT) has been implicated in pilocytic astrocytomas [, , ] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region Back     alignment and domain information
>PF07204 Orthoreo_P10: Orthoreovirus membrane fusion protein p10; InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences Back     alignment and domain information
>PF02480 Herpes_gE: Alphaherpesvirus glycoprotein E; InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein Back     alignment and domain information
>PF05283 MGC-24: Multi-glycosylated core protein 24 (MGC-24); InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor Back     alignment and domain information
>PF14575 EphA2_TM: Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A Back     alignment and domain information
>PF06809 NPDC1: Neural proliferation differentiation control-1 protein (NPDC1); InterPro: IPR009635 This family consists of several neural proliferation differentiation control-1 (NPDC1) proteins Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06697 DUF1191: Protein of unknown function (DUF1191); InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function Back     alignment and domain information
>PF03229 Alpha_GJ: Alphavirus glycoprotein J; InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [] Back     alignment and domain information
>PF05393 Hum_adeno_E3A: Human adenovirus early E3A glycoprotein; InterPro: IPR008652 This family consists of several early glycoproteins (E3A), from human adenovirus type 2 Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>PF15069 FAM163: FAM163 family Back     alignment and domain information
>PF06679 DUF1180: Protein of unknown function (DUF1180); InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins Back     alignment and domain information
>PF14610 DUF4448: Protein of unknown function (DUF4448) Back     alignment and domain information
>COG3889 Predicted solute binding protein [General function prediction only] Back     alignment and domain information
>TIGR03154 sulfolob_CbsA cytochrome b558/566, subunit A Back     alignment and domain information
>PF08374 Protocadherin: Protocadherin; InterPro: IPR013585 The structure of protocadherins is similar to that of classic cadherins (IPR002126 from INTERPRO), but they also have some unique features associated with the cytoplasmic domains Back     alignment and domain information
>PF06809 NPDC1: Neural proliferation differentiation control-1 protein (NPDC1); InterPro: IPR009635 This family consists of several neural proliferation differentiation control-1 (NPDC1) proteins Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query368
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-18
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  111 bits (279), Expect = 8e-27
 Identities = 40/155 (25%), Positives = 64/155 (41%), Gaps = 15/155 (9%)

Query: 27  SLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLE 86
           SL  E   L+  ++ +  D    L  W S     NPC++ GV C D KV +++L    L 
Sbjct: 9   SLYREIHQLISFKDVLP-DK-NLLPDWSS---NKNPCTFDGVTCRDDKVTSIDLSSKPLN 63

Query: 87  ---GTLAPEIQSLTHIKSIILRNNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGI 143
                ++  + SLT ++S+ L N+  +G +   F     L  LD   N+ SGP+     +
Sbjct: 64  VGFSAVSSSLLSLTGLESLFLSNSHINGSVSG-FKCSASLTSLDLSRNSLSGPVTTLTSL 122

Query: 144 NH--SLTILLLDNNDFVGSLSPEIY----KLQVLS 172
                L  L + +N                L+VL 
Sbjct: 123 GSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLD 157


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query368
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.68
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.66
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.63
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.62
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.58
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.58
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.56
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.54
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.54
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.53
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.52
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.52
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.51
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.5
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.5
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.5
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.5
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.5
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.49
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.49
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.49
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.49
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.48
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.48
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.48
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.47
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.47
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.47
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.45
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.45
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.45
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.45
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.44
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.44
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.44
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.44
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.43
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.43
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.42
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.42
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.41
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.4
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.4
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.4
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.39
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.38
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.38
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.36
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.35
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.35
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.34
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.34
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.33
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.33
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.3
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.3
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.3
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.28
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.27
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.26
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.25
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.21
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.19
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.18
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.13
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.1
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.02
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.84
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.76
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.71
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.67
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.49
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.48
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.29
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.23
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.09
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.92
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.5
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.43
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.39
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.94
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.73
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 96.31
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 96.21
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.83
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.03
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.92
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 94.1
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.72
2k9y_A41 Ephrin type-A receptor 2; receptor tyrosine kinase 93.05
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 92.92
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.69
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 91.45
1iij_A35 ERBB-2 receptor protein-tyrosine kinase; alpha-hel 81.8
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.93  E-value=4.8e-26  Score=214.83  Aligned_cols=159  Identities=28%  Similarity=0.488  Sum_probs=147.2

Q ss_pred             cCcHHHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCCC--cceeEeCC----CcEEEEEecCCCCcc--cCchhhcCCC
Q 017648           26 WSLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPCS--WFGVECSD----GKVVNLNLKDLCLEG--TLAPEIQSLT   97 (368)
Q Consensus        26 ~~~~~~~~aLl~~k~~~~~~~~~~l~~W~~~~~~~~~C~--w~Gv~C~~----~~v~~L~L~~n~l~g--~~p~~l~~L~   97 (368)
                      .|.++|++||++||+++ .++. .+.+|.   .+.+||.  |.||.|+.    ++|+.|+|++|+++|  .+|..|.+++
T Consensus         2 ~c~~~~~~aL~~~k~~~-~~~~-~l~~W~---~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~   76 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDL-GNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLP   76 (313)
T ss_dssp             CSCHHHHHHHHHHHHHT-TCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCT
T ss_pred             CCCHHHHHHHHHHHHhc-CCcc-cccCCC---CCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCC
Confidence            47789999999999999 4654 678997   3568998  99999983    799999999999999  8999999999


Q ss_pred             CCCEEEeec-CCCCcCCccccCCCCCCCEEEccCCcCCCCCCcccCCCCCCCEEEccCCcCCccCchhhcCCCCCCEEec
Q 017648           98 HIKSIILRN-NSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQV  176 (368)
Q Consensus        98 ~L~~L~Ls~-N~l~g~~P~~~~~l~~L~~L~Ls~N~l~g~lP~~l~~l~~L~~L~Ls~N~l~g~iP~~l~~l~~L~~L~L  176 (368)
                      +|++|+|++ |.+.+.+|..|.++++|++|+|++|.+++.+|..++.+++|++|+|++|.++|.+|..+..+++|++|++
T Consensus        77 ~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L  156 (313)
T 1ogq_A           77 YLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITF  156 (313)
T ss_dssp             TCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEEC
T ss_pred             CCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEEC
Confidence            999999995 9999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCccCCCCc
Q 017648          177 DEGQLSSAAKKEQ  189 (368)
Q Consensus       177 ~~N~l~g~ip~~~  189 (368)
                      ++|+++|.+|...
T Consensus       157 ~~N~l~~~~p~~l  169 (313)
T 1ogq_A          157 DGNRISGAIPDSY  169 (313)
T ss_dssp             CSSCCEEECCGGG
T ss_pred             cCCcccCcCCHHH
Confidence            9999999998644



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2k9y_A Ephrin type-A receptor 2; receptor tyrosine kinase, membrane protein, dimeric transmembrane domain, ephrin receptor, ATP-binding, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>1iij_A ERBB-2 receptor protein-tyrosine kinase; alpha-helix-PI-bulge-alpha-helix, signaling protein; NMR {Synthetic} SCOP: j.35.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 368
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 59.6 bits (143), Expect = 2e-10
 Identities = 23/110 (20%), Positives = 37/110 (33%), Gaps = 6/110 (5%)

Query: 46  PYGALTSWRSCDTENNPCSWFGVECSDGKVVNLNLKDLCLEGTLAPEIQSLTHIKSIILR 105
           P   LT+  + +   N         +   +  L L    +       + SLT ++ +   
Sbjct: 280 PLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDI--SPVSSLTKLQRLFFA 337

Query: 106 NNSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNN 155
           NN  S         L  +  L  GHN  S   P  L     +T L L++ 
Sbjct: 338 NNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query368
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.54
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.51
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.49
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.47
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.37
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.32
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.25
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.21
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.14
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.11
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.03
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.03
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.01
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.98
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.96
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.9
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.82
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.81
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.71
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.43
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.14
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.1
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.07
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.05
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.93
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.55
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.78
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.89
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.94  E-value=2.8e-27  Score=220.62  Aligned_cols=158  Identities=28%  Similarity=0.489  Sum_probs=145.1

Q ss_pred             CcHHHHHHHHHHHHhccCCCCCCCCCCCCCCCCCCCCC--cceeEeCC----CcEEEEEecCCCCcc--cCchhhcCCCC
Q 017648           27 SLNDEGLALLRLRERVVRDPYGALTSWRSCDTENNPCS--WFGVECSD----GKVVNLNLKDLCLEG--TLAPEIQSLTH   98 (368)
Q Consensus        27 ~~~~~~~aLl~~k~~~~~~~~~~l~~W~~~~~~~~~C~--w~Gv~C~~----~~v~~L~L~~n~l~g--~~p~~l~~L~~   98 (368)
                      |.++|++||++||+.+. ++ ..+.+|.   .+.|||.  |.||+|+.    .||+.|+|+++++.|  .+|.+|++|++
T Consensus         3 c~~~e~~aLl~~k~~~~-~~-~~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~   77 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLG-NP-TTLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPY   77 (313)
T ss_dssp             SCHHHHHHHHHHHHHTT-CC-GGGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred             CCHHHHHHHHHHHHHCC-CC-CcCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCcc
Confidence            68899999999999995 44 3688997   4679994  99999982    479999999999998  58899999999


Q ss_pred             CCEEEeec-CCCCcCCccccCCCCCCCEEEccCCcCCCCCCcccCCCCCCCEEEccCCcCCccCchhhcCCCCCCEEecc
Q 017648           99 IKSIILRN-NSFSGIIPEGFGELEELEVLDFGHNNFSGPLPNDLGINHSLTILLLDNNDFVGSLSPEIYKLQVLSESQVD  177 (368)
Q Consensus        99 L~~L~Ls~-N~l~g~~P~~~~~l~~L~~L~Ls~N~l~g~lP~~l~~l~~L~~L~Ls~N~l~g~iP~~l~~l~~L~~L~L~  177 (368)
                      |++|+|++ |+++|.+|.+|++|++|++|+|++|++.+..+..+..+..|+++++++|.+.+.+|..+.++++|++++++
T Consensus        78 L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~  157 (313)
T d1ogqa_          78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD  157 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred             ccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecc
Confidence            99999997 89999999999999999999999999999999889999999999999999999999999999999999999


Q ss_pred             CCCCCccCCCCc
Q 017648          178 EGQLSSAAKKEQ  189 (368)
Q Consensus       178 ~N~l~g~ip~~~  189 (368)
                      +|.++|.+|...
T Consensus       158 ~n~l~~~ip~~~  169 (313)
T d1ogqa_         158 GNRISGAIPDSY  169 (313)
T ss_dssp             SSCCEEECCGGG
T ss_pred             cccccccccccc
Confidence            999999999643



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure