Citrus Sinensis ID: 017739

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------

MFLYMFWIRISVNVDFESLILCAFANFSTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAFR

ccHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHHccccEEEEEccccccccHHHEEEEcccccccccccccEEEEcccccHHHHHHHHHHHHHccccccccHHHHHHHcccEEEEEEccEEEEEEEEEEEccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHcccEEcccccccHHHHHHcccccccHHHHccccccccccccccccc

ccHHHEHEEHHHHcccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEccccEcccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccEEcHHHHHHHHHHEEEcccccccccHcccHHHHHHHHHHccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHccccccEEEEccHHHHHHHccHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHccEEEEcccEEEEEEEcccccHHHcHEEEEEEEcHHHcccccHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHcccccccHHHccHHHHHHHHHHHccHHHHHHcccccccEEEccccc

MFLYMFWIRISVNVDFESLILCAFANFSTYEVATACALAIEADKLIciidgpildesgHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAeeditcfghsdsigsvyssqngktfsERRIATfnngvgfdngnglwsseqgfaigGQERLSRLNGYLSELAAAAFVCRrgvqrvhlldgtIGGVLLLELFkrdgmgtmvasdlyegtrtakvtdlsgiKQIIQPlvesgalvrrTDEELLKALDSFYVVEREGQIIACAALFPffkekcgevaaigvspecrgqgqgdKLLDYIEKKAASLGLDMLFLLTTRTadwfksrgfrecsieMIPEERRKRINLSRNSKYYMKKllpdtsgiivdrafr

MFLYMFWIRISVNVDFESLILCAFANFSTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTakvtdlsgikqiiqplvesgalvrRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGvspecrgqgqGDKLLDYIEKKAASLGLDMLFLLTTRTadwfksrgfrecsiemipeerrkrinlsrnskyymkkllpdtsgiivdraFR

MFLYMFWIRISVNVDFESLILCAFANFSTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATfnngvgfdngngLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAFR

*FLYMFWIRISVNVDFESLILCAFANFSTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPE*****INLSRNSKYYMKKLLPDTSGIIV*****

MFLYMFWIRISVNVDFESLILCAFANFSTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVK**EIAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDR***

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		366	2.2.26 [Sep-21-2011]
P22567		432	Amino-acid acetyltransfer	yes	no	0.551	0.467	0.490	6e-47
Q02EG0		432	Amino-acid acetyltransfer	yes	no	0.551	0.467	0.490	6e-47
B7V594		432	Amino-acid acetyltransfer	yes	no	0.551	0.467	0.490	6e-47
A6VDY0		432	Amino-acid acetyltransfer	yes	no	0.551	0.467	0.490	6e-47
A4XP61		432	Amino-acid acetyltransfer	yes	no	0.551	0.467	0.480	5e-45
B0KP70		432	Amino-acid acetyltransfer	yes	no	0.524	0.444	0.473	4e-44
P0A100		432	Amino-acid acetyltransfer	yes	no	0.524	0.444	0.473	7e-44
P0A0Z9		432	Amino-acid acetyltransfer	yes	no	0.524	0.444	0.473	7e-44
Q8ZMB8		443	Amino-acid acetyltransfer	yes	no	0.680	0.562	0.377	1e-43
Q8Z421		443	Amino-acid acetyltransfer	N/A	no	0.680	0.562	0.377	1e-43

>sp\|P22567\|ARGA_PSEAE Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argA PE=1 SV=2	Back alignment and function desciption

 Score =  188 bits (477), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 135/204 (66%), Gaps = 2/204 (0%)

Query: 151 LSRL-NGYLSELA-AAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGT 208
           L RL N Y +EL  AAA  CR GV+R H++  T  G LL ELF R G GT+VA + +E  
Sbjct: 229 LQRLGNSYQAELLDAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQL 288

Query: 209 RTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKE 268
           R A + D+ G+ ++I+PL E G LVRR+ E L + ++ F +VEREG IIACAAL+P    
Sbjct: 289 REAGIEDVGGLIELIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADS 348

Query: 269 KCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSI 328
           + GE+A + V+PE R  G+GD+LL+ IE++A  LGL  LF+LTTRTA WF+ RGF+  S+
Sbjct: 349 EAGELACLAVNPEYRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSV 408

Query: 329 EMIPEERRKRINLSRNSKYYMKKL 352
           E +P  R    N  RNS+ + K L
Sbjct: 409 ERLPAARASLYNFQRNSQVFEKSL 432

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) (taxid: 208964)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1

>sp\|Q02EG0\|ARGA_PSEAB Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=argA PE=3 SV=1	Back alignment and function description

>sp\|B7V594\|ARGA_PSEA8 Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=argA PE=3 SV=1	Back alignment and function description

>sp\|A6VDY0\|ARGA_PSEA7 Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=argA PE=3 SV=1	Back alignment and function description

>sp\|A4XP61\|ARGA_PSEMY Amino-acid acetyltransferase OS=Pseudomonas mendocina (strain ymp) GN=argA PE=3 SV=1	Back alignment and function description

>sp\|B0KP70\|ARGA_PSEPG Amino-acid acetyltransferase OS=Pseudomonas putida (strain GB-1) GN=argA PE=3 SV=1	Back alignment and function description

>sp\|P0A100\|ARGA_PSEPU Amino-acid acetyltransferase OS=Pseudomonas putida GN=argA PE=3 SV=1	Back alignment and function description

>sp\|P0A0Z9\|ARGA_PSEPK Amino-acid acetyltransferase OS=Pseudomonas putida (strain KT2440) GN=argA PE=3 SV=1	Back alignment and function description

>sp\|Q8ZMB8\|ARGA_SALTY Amino-acid acetyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argA PE=3 SV=1	Back alignment and function description

>sp\|Q8Z421\|ARGA_SALTI Amino-acid acetyltransferase OS=Salmonella typhi GN=argA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		366
359494808		357	PREDICTED: amino-acid acetyltransferase-	0.945	0.969	0.794	1e-159
224095037		560	predicted protein [Populus trichocarpa]	0.915	0.598	0.811	1e-156
296088916		340	unnamed protein product [Vitis vinifera]	0.912	0.982	0.795	1e-155
255568615		705	N-acetyltransferase, putative [Ricinus c	0.931	0.483	0.752	1e-152
297821519		609	hypothetical protein ARALYDRAFT_481154 [	0.931	0.559	0.770	1e-151
3445208		620	putative amino acid acetyltransferase [A	0.931	0.55	0.767	1e-151
30681866		609	amino-acid N-acetyltransferase [Arabidop	0.931	0.559	0.767	1e-150
375155307		600	N-acetyl-glutamate synthase [Solanum tor	0.969	0.591	0.734	1e-150
350535106		603	N-acetyl-glutamate synthase [Solanum lyc	0.969	0.588	0.726	1e-149
356514348		617	PREDICTED: LOW QUALITY PROTEIN: amino-ac	0.915	0.542	0.784	1e-149

>gi\|359494808\|ref\|XP_002264391.2\| PREDICTED: amino-acid acetyltransferase-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  568 bits (1464), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 283/356 (79%), Positives = 306/356 (85%), Gaps = 10/356 (2%)

Query: 20  ILCAFANFSTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQ 79
           +LCAF N STYEVATACALAI A+KLIC+IDGPILDE+  LIRFLTLQ+AD+LIR+R KQ
Sbjct: 1   MLCAFINCSTYEVATACALAIGAEKLICVIDGPILDENERLIRFLTLQDADTLIRKRAKQ 60

Query: 80  SEIAANYVKAV----------AEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVG 129
           SEIAANYVKAV           EED+  F HSDS G++ S QNGK  SE   ATF NGVG
Sbjct: 61  SEIAANYVKAVDEEDLAYKAVGEEDLAYFEHSDSNGALTSPQNGKGSSEMYSATFQNGVG 120

Query: 130 FDNGNGLWSSEQGFAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLE 189
           FDNGNGLWS EQGFAIGGQERLSRLNG+LSELAAAAFVCR GVQRVHLLDGTIGGVLLLE
Sbjct: 121 FDNGNGLWSGEQGFAIGGQERLSRLNGFLSELAAAAFVCRGGVQRVHLLDGTIGGVLLLE 180

Query: 190 LFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYV 249
           LF+RDGMGTMVASD+YEGTR A+VTDL GIKQIIQPL ESG L+RRTDEE+LK L+SF V
Sbjct: 181 LFQRDGMGTMVASDVYEGTRMARVTDLPGIKQIIQPLEESGTLIRRTDEEILKTLESFIV 240

Query: 250 VEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFL 309
           VEREG IIACAALFP+FKEKCGEVAAI VS ECRGQGQGDKLLDY+EKK+AS+GL+MLFL
Sbjct: 241 VEREGHIIACAALFPYFKEKCGEVAAIAVSSECRGQGQGDKLLDYVEKKSASMGLEMLFL 300

Query: 310 LTTRTADWFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAF 365
           LTTRTADWF  RGF ECSIE IPEERRK+INLSR SKYY KKL PD SGI V RAF
Sbjct: 301 LTTRTADWFVRRGFSECSIESIPEERRKKINLSRKSKYYTKKLQPDMSGISVARAF 356

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224095037\|ref\|XP_002310336.1\| predicted protein [Populus trichocarpa] gi\|222853239\|gb\|EEE90786.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|296088916\|emb\|CBI38471.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255568615\|ref\|XP_002525281.1\| N-acetyltransferase, putative [Ricinus communis] gi\|223535439\|gb\|EEF37109.1\| N-acetyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|297821519\|ref\|XP_002878642.1\| hypothetical protein ARALYDRAFT_481154 [Arabidopsis lyrata subsp. lyrata] gi\|297324481\|gb\|EFH54901.1\| hypothetical protein ARALYDRAFT_481154 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|3445208\|gb\|AAC32438.1\| putative amino acid acetyltransferase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|30681866\|ref\|NP_179875.2\| amino-acid N-acetyltransferase [Arabidopsis thaliana] gi\|28393691\|gb\|AAO42258.1\| putative amino acid acetyltransferase [Arabidopsis thaliana] gi\|29824347\|gb\|AAP04134.1\| putative amino acid acetyltransferase [Arabidopsis thaliana] gi\|330252278\|gb\|AEC07372.1\| amino-acid N-acetyltransferase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|375155307\|gb\|AFA37977.1\| N-acetyl-glutamate synthase [Solanum torvum]	Back alignment and taxonomy information

>gi\|350535106\|ref\|NP_001234432.1\| N-acetyl-glutamate synthase [Solanum lycopersicum] gi\|237780684\|gb\|ACR19334.1\| N-acetyl-glutamate synthase [Solanum lycopersicum] gi\|449076253\|gb\|AGE83531.1\| calcium-dependent protein kinase 2, partial [Solanum melongena]	Back alignment and taxonomy information

>gi\|356514348\|ref\|XP_003525868.1\| PREDICTED: LOW QUALITY PROTEIN: amino-acid acetyltransferase-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		366
TAIR\|locus:2059165		609	NAGS1 "N-acetyl-l-glutamate sy	0.931	0.559	0.735	6.6e-129
TAIR\|locus:2120130		613	NAGS2 "N-acetyl-l-glutamate sy	0.923	0.551	0.734	1.8e-126
UNIPROTKB\|P22567		432	argA "Amino-acid acetyltransfe	0.551	0.467	0.490	6.8e-51
UNIPROTKB\|P0A6C5		443	argA [Escherichia coli K-12 (t	0.592	0.489	0.403	1.1e-44
TIGR_CMR\|CPS_0465		436	CPS_0465 "amino-acid N-acetylt	0.497	0.417	0.417	2.5e-41
TIGR_CMR\|SO_4245		445	SO_4245 "amino-acid acetyltran	0.540	0.444	0.393	1.2e-39
UNIPROTKB\|Q9KPQ0		445	argA "Amino-acid acetyltransfe	0.524	0.431	0.375	2.2e-38
TIGR_CMR\|VC_2316		445	VC_2316 "N-acetylglutamate syn	0.524	0.431	0.375	2.2e-38
UNIPROTKB\|O33289		174	argA "Amino-acid acetyltransfe	0.325	0.683	0.299	6.8e-09
TIGR_CMR\|GSU_2061		149	GSU_2061 "acetyltransferase, G	0.338	0.832	0.285	6.8e-09

TAIR\|locus:2059165 NAGS1 "N-acetyl-l-glutamate synthase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1265 (450.4 bits), Expect = 6.6e-129, P = 6.6e-129
 Identities = 253/344 (73%), Positives = 286/344 (83%)

Query:    26 NFSTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAAN 85
             N +TYEVATACALAI ADKLICI+DGP+LDE+GHL+RFLTLQEAD+L+R+R +QSEIAAN
Sbjct:   263 NCNTYEVATACALAIGADKLICIMDGPVLDENGHLVRFLTLQEADTLVRKRAQQSEIAAN 322

Query:    86 YVKAVAEEDITCFGHSDSIGSVYSSQN---GKTFSERRIATXXXXXXXXXXXXLWSSEQG 142
             YVKAV +  I+ F        + ++ N   G+   E+   T            LWS EQG
Sbjct:   323 YVKAVGDGGISSFPEPLGYNGMVTTPNNHIGRPIWEKLSPTFQNGVGFDNGNGLWSGEQG 382

Query:   143 FAIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVAS 202
             FAIGG+ER+SRLNGYLSELAAAAFVCR GV+RVHLLDGTI GVLLLELFKRDGMGTMVAS
Sbjct:   383 FAIGGEERISRLNGYLSELAAAAFVCRGGVKRVHLLDGTISGVLLLELFKRDGMGTMVAS 442

Query:   203 DLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAAL 262
             D+YEG R AKV DL+GI+QII+PL ESGALVRRTDEELL+ALDSF VVEREG IIACAAL
Sbjct:   443 DVYEGNREAKVEDLAGIRQIIKPLEESGALVRRTDEELLRALDSFVVVEREGHIIACAAL 502

Query:   263 FPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRG 322
             FPFF+EKCGEVAAI V+ +CRGQGQGDKLLDYIEKKA++LGL+MLFLLTTRTADWF  RG
Sbjct:   503 FPFFEEKCGEVAAIAVASDCRGQGQGDKLLDYIEKKASALGLEMLFLLTTRTADWFVRRG 562

Query:   323 FRECSIEMIPEERRKRINLSRNSKYYMKKLLPDTSGIIVDRAFR 366
             F+EC IEMIPE RR+RINLSR SKYYMKKLLPD SGI V R F+
Sbjct:   563 FQECPIEMIPEARRERINLSRRSKYYMKKLLPDRSGISVVRTFQ 606

GO:0004042 "acetyl-CoA:L-glutamate N-acetyltransferase activity" evidence=IEA;ISS

GO:0005737 "cytoplasm" evidence=ISM;IEA

GO:0006526 "arginine biosynthetic process" evidence=IEA;ISS

GO:0008080 "N-acetyltransferase activity" evidence=IEA

GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA

TAIR\|locus:2120130 NAGS2 "N-acetyl-l-glutamate synthase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|P22567 argA "Amino-acid acetyltransferase" [Pseudomonas aeruginosa PAO1 (taxid:208964)]	Back alignment and assigned GO terms

UNIPROTKB\|P0A6C5 argA [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_0465 CPS_0465 "amino-acid N-acetyltransferase" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_4245 SO_4245 "amino-acid acetyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KPQ0 argA "Amino-acid acetyltransferase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_2316 VC_2316 "N-acetylglutamate synthase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

UNIPROTKB\|O33289 argA "Amino-acid acetyltransferase" [Mycobacterium tuberculosis (taxid:1773)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_2061 GSU_2061 "acetyltransferase, GNAT family" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.3.1	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00010579001	SubName- Full=Chromosome chr7 scaffold_270, whole genome shotgun sequence; (412 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00014587001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (261 aa)	•		•	•	•		0.899
	GSVIVG00015101001	SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (525 aa)	•		•		•		0.838
	GSVIVG00032389001	SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (351 aa)	•		•	•	•	•	0.837
	GSVIVG00036526001	RecName- Full=N-acetyl-gamma-glutamyl-phosphate reductase; EC=1.2.1.38; (398 aa)	•		•		•		0.821
	GSVIVG00017913001	SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (430 aa)	•		•		•		0.745
	GSVIVG00023053001	SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (430 aa)		•			•		0.641
	GSVIVG00017199001	SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (280 aa)					•		0.516
	GSVIVG00034899001	SubName- Full=Chromosome chr4 scaffold_73, whole genome shotgun sequence; (93 aa)	•						0.484
	GSVIVG00020486001	SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (564 aa)	•				•		0.456
	GSVIVG00027272001	SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (403 aa)					•		0.440

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		366
PLN02825		515	PLN02825, PLN02825, amino-acid N-acetyltransferase	0.0
PRK05279		441	PRK05279, PRK05279, N-acetylglutamate synthase; Va	3e-75
TIGR01890		429	TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltran	5e-62
COG1246		153	COG1246, ArgA, N-acetylglutamate synthase and rela	4e-39
PRK07757		152	PRK07757, PRK07757, acetyltransferase; Provisional	3e-21
cd04237		280	cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylgluta	2e-17
PRK12308		614	PRK12308, PRK12308, bifunctional argininosuccinate	3e-17
cd04237		280	cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylgluta	5e-16
PRK07922		169	PRK07922, PRK07922, N-acetylglutamate synthase; Va	4e-15
pfam13508		79	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT	9e-11
pfam00583		80	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT	2e-10
cd04301		65	cd04301, NAT_SF, N-Acyltransferase superfamily: Va	2e-10
PRK05279		441	PRK05279, PRK05279, N-acetylglutamate synthase; Va	2e-08
COG0548		265	COG0548, ArgB, Acetylglutamate kinase [Amino acid	4e-08
COG0456		177	COG0456, RimI, Acetyltransferases [General functio	1e-05
PRK00942		283	PRK00942, PRK00942, acetylglutamate kinase; Provis	2e-05
cd04238		256	cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-	3e-05
cd04250		279	cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutam	5e-05
pfam13673		118	pfam13673, Acetyltransf_10, Acetyltransferase (GNA	6e-05
PRK00942		283	PRK00942, PRK00942, acetylglutamate kinase; Provis	2e-04
pfam13527		127	pfam13527, Acetyltransf_9, Acetyltransferase (GNAT	2e-04
cd04238		256	cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-	7e-04
TIGR01575		131	TIGR01575, rimI, ribosomal-protein-alanine acetylt	9e-04
TIGR01890		429	TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltran	0.001
cd02169		297	cd02169, Citrate_lyase_ligase, Citrate lyase ligas	0.001

>gnl\|CDD\|215441 PLN02825, PLN02825, amino-acid N-acetyltransferase	Back alignment and domain information

 Score =  598 bits (1543), Expect = 0.0
 Identities = 262/330 (79%), Positives = 284/330 (86%), Gaps = 3/330 (0%)

Query: 26  NFSTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQSEIAAN 85
           N +TYEVATACALAI ADKLICI+DGPILDE+G LIRF+TL+EAD LIR+R KQSEIAAN
Sbjct: 187 NCNTYEVATACALAIGADKLICIVDGPILDENGRLIRFMTLEEADMLIRKRAKQSEIAAN 246

Query: 86  YVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIAT--FNNGVGFDNGNGLWSSEQGF 143
           YVKAV  ED +     DS+ +   + NG+ F     AT  F NGVGFDNGNGL S EQGF
Sbjct: 247 YVKAVGGEDYSYSLGLDSVNTTPFNNNGRGFWGSGSATDSFQNGVGFDNGNGL-SGEQGF 305

Query: 144 AIGGQERLSRLNGYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASD 203
           AIGG+ERLSRLNGYLSELAAAAFVCR GVQRVHLLDGTI GVLLLELF RDGMGTM+ASD
Sbjct: 306 AIGGEERLSRLNGYLSELAAAAFVCRGGVQRVHLLDGTIEGVLLLELFTRDGMGTMIASD 365

Query: 204 LYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALF 263
           +YEGTR A+V DL+GI+QII+PL ESG LVRRTDEELL+ALDSF VVEREG IIACAALF
Sbjct: 366 MYEGTRMARVEDLAGIRQIIRPLEESGILVRRTDEELLRALDSFVVVEREGSIIACAALF 425

Query: 264 PFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRGF 323
           PFF+EKCGEVAAI VSPECRGQGQGDKLLDYIEKKAASLGL+ LFLLTTRTADWF  RGF
Sbjct: 426 PFFEEKCGEVAAIAVSPECRGQGQGDKLLDYIEKKAASLGLEKLFLLTTRTADWFVRRGF 485

Query: 324 RECSIEMIPEERRKRINLSRNSKYYMKKLL 353
            ECSIE +PE RRKRINLSR SKYYMKKLL
Sbjct: 486 SECSIESLPEARRKRINLSRGSKYYMKKLL 515

Length = 515

>gnl\|CDD\|235386 PRK05279, PRK05279, N-acetylglutamate synthase; Validated	Back alignment and domain information

>gnl\|CDD\|233620 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|224167 COG1246, ArgA, N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|236088 PRK07757, PRK07757, acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|239770 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts	Back alignment and domain information

>gnl\|CDD\|183425 PRK12308, PRK12308, bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|239770 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts	Back alignment and domain information

>gnl\|CDD\|236132 PRK07922, PRK07922, N-acetylglutamate synthase; Validated	Back alignment and domain information

>gnl\|CDD\|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain	Back alignment and domain information

>gnl\|CDD\|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family	Back alignment and domain information

>gnl\|CDD\|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate	Back alignment and domain information

>gnl\|CDD\|235386 PRK05279, PRK05279, N-acetylglutamate synthase; Validated	Back alignment and domain information

>gnl\|CDD\|223622 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223532 COG0456, RimI, Acetyltransferases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234869 PRK00942, PRK00942, acetylglutamate kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|239771 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like	Back alignment and domain information

>gnl\|CDD\|239783 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis	Back alignment and domain information

>gnl\|CDD\|222309 pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain	Back alignment and domain information

>gnl\|CDD\|234869 PRK00942, PRK00942, acetylglutamate kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|222199 pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain	Back alignment and domain information

>gnl\|CDD\|239771 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like	Back alignment and domain information

>gnl\|CDD\|233477 TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase	Back alignment and domain information

>gnl\|CDD\|233620 TIGR01890, N-Ac-Glu-synth, amino-acid N-acetyltransferase	Back alignment and domain information

>gnl\|CDD\|173920 cd02169, Citrate_lyase_ligase, Citrate lyase ligase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		366
PLN02825		515	amino-acid N-acetyltransferase	100.0
TIGR01890		429	N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi	100.0
PRK05279		441	N-acetylglutamate synthase; Validated	100.0
COG1246		153	ArgA N-acetylglutamate synthase and related acetyl	99.95
KOG2436		520	consensus Acetylglutamate kinase/acetylglutamate s	99.89
PRK04531		398	acetylglutamate kinase; Provisional	99.86
COG0548		265	ArgB Acetylglutamate kinase [Amino acid transport	99.86
cd04237		280	AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG)	99.75
cd04236		271	AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NA	99.73
PRK07757		152	acetyltransferase; Provisional	99.7
PRK10146		144	aminoalkylphosphonic acid N-acetyltransferase; Pro	99.67
CHL00202		284	argB acetylglutamate kinase; Provisional	99.66
cd04252		248	AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutam	99.64
PRK07922		169	N-acetylglutamate synthase; Validated	99.62
PTZ00330		147	acetyltransferase; Provisional	99.61
PRK00942		283	acetylglutamate kinase; Provisional	99.59
PRK12308		614	bifunctional argininosuccinate lyase/N-acetylgluta	99.58
TIGR03827		266	GNAT_ablB putative beta-lysine N-acetyltransferase	99.55
PF13527		127	Acetyltransf_9: Acetyltransferase (GNAT) domain; P	99.55
PRK03624		140	putative acetyltransferase; Provisional	99.55
PLN02512		309	acetylglutamate kinase	99.54
cd04250		279	AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase	99.53
cd04238		256	AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate	99.51
PHA00673		154	acetyltransferase domain containing protein	99.5
PF13673		117	Acetyltransf_10: Acetyltransferase (GNAT) domain;	99.5
PLN02706		150	glucosamine 6-phosphate N-acetyltransferase	99.49
PRK09491		146	rimI ribosomal-protein-alanine N-acetyltransferase	99.49
PF00583		83	Acetyltransf_1: Acetyltransferase (GNAT) family; I	99.48
TIGR02382		191	wecD_rffC TDP-D-fucosamine acetyltransferase. This	99.47
PRK10140		162	putative acetyltransferase YhhY; Provisional	99.45
cd04249		252	AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kina	99.45
KOG3216		163	consensus Diamine acetyltransferase [Amino acid tr	99.45
TIGR02406		157	ectoine_EctA L-2,4-diaminobutyric acid acetyltrans	99.44
PRK10975		194	TDP-fucosamine acetyltransferase; Provisional	99.44
PF13523		152	Acetyltransf_8: Acetyltransferase (GNAT) domain; P	99.44
PRK09831		147	putative acyltransferase; Provisional	99.44
cd04251		257	AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kina	99.43
PRK14058		268	acetylglutamate/acetylaminoadipate kinase; Provisi	99.41
PF13420		155	Acetyltransf_4: Acetyltransferase (GNAT) domain; P	99.41
PF13508		79	Acetyltransf_7: Acetyltransferase (GNAT) domain; P	99.4
TIGR01575		131	rimI ribosomal-protein-alanine acetyltransferase.	99.4
COG1247		169	Sortase and related acyltransferases [Cell envelop	99.38
PRK12352		316	putative carbamate kinase; Reviewed	99.37
PRK10514		145	putative acetyltransferase; Provisional	99.36
COG3153		171	Predicted acetyltransferase [General function pred	99.34
PRK10314		153	putative acyltransferase; Provisional	99.33
KOG3139		165	consensus N-acetyltransferase [General function pr	99.32
TIGR03103		547	trio_acet_GNAT GNAT-family acetyltransferase TIGR0	99.31
COG0456		177	RimI Acetyltransferases [General function predicti	99.31
TIGR01686		320	FkbH FkbH-like domain. The C-terminal portion of t	99.29
cd04241		252	AAK_FomA-like AAK_FomA-like: This CD includes a fo	99.28
PRK10151		179	ribosomal-protein-L7/L12-serine acetyltransferase;	99.27
PRK15130		186	spermidine N1-acetyltransferase; Provisional	99.24
PRK01346		411	hypothetical protein; Provisional	99.24
TIGR00761		231	argB acetylglutamate kinase. This model describes	99.24
TIGR03585		156	PseH pseudaminic acid biosynthesis N-acetyl transf	99.23
TIGR03448		292	mycothiol_MshD mycothiol biosynthesis acetyltransf	99.21
PRK10562		145	putative acetyltransferase; Provisional	99.2
cd02169		297	Citrate_lyase_ligase Citrate lyase ligase. Citrate	99.19
TIGR03448		292	mycothiol_MshD mycothiol biosynthesis acetyltransf	99.18
PRK10809		194	ribosomal-protein-S5-alanine N-acetyltransferase;	99.15
PHA01807		153	hypothetical protein	99.15
cd02115		248	AAK Amino Acid Kinases (AAK) superfamily, catalyti	99.14
KOG3396		150	consensus Glucosamine-phosphate N-acetyltransferas	99.14
PF13302		142	Acetyltransf_3: Acetyltransferase (GNAT) domain; P	99.14
PRK13688		156	hypothetical protein; Provisional	99.11
TIGR00124		332	cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP	99.07
TIGR00746		310	arcC carbamate kinase. The seed alignment for this	99.04
PF00696		242	AA_kinase: Amino acid kinase family Match to Gluta	98.92
PRK12454		313	carbamate kinase-like carbamoyl phosphate syntheta	98.87
COG2153		155	ElaA Predicted acyltransferase [General function p	98.75
cd04242		251	AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K	98.75
PRK12353		314	putative amino acid kinase; Reviewed	98.73
KOG3397		225	consensus Acetyltransferases [General function pre	98.69
KOG2488		202	consensus Acetyltransferase (GNAT) domain-containi	98.69
PF08445		86	FR47: FR47-like protein; InterPro: IPR013653 Prote	98.68
PRK09411		297	carbamate kinase; Reviewed	98.64
cd04301		65	NAT_SF N-Acyltransferase superfamily: Various enzy	98.59
COG3393		268	Predicted acetyltransferase [General function pred	98.58
KOG3235		193	consensus Subunit of the major N alpha-acetyltrans	98.57
PRK05429		372	gamma-glutamyl kinase; Provisional	98.57
cd04256		284	AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase	98.56
KOG3138		187	consensus Predicted N-acetyltransferase [General f	98.51
PRK12686		312	carbamate kinase; Reviewed	98.44
COG1670		187	RimL Acetyltransferases, including N-acetylases of	98.44
TIGR01211		522	ELP3 histone acetyltransferase, ELP3 family. The S	98.41
KOG3234		173	consensus Acetyltransferase, (GNAT) family [Genera	98.37
PF14542		78	Acetyltransf_CG: GCN5-related N-acetyl-transferase	98.36
PF13718		196	GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z	98.34
COG3053		352	CitC Citrate lyase synthetase [Energy production a	98.34
cd04235		308	AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes bot	98.31
PRK12314		266	gamma-glutamyl kinase; Provisional	98.3
cd04240		203	AAK_UC AAK_UC: Uncharacterized (UC) amino acid kin	98.3
COG3981		174	Predicted acetyltransferase [General function pred	98.27
TIGR02076		221	pyrH_arch uridylate kinase, putative. This family	98.24
PRK12354		307	carbamate kinase; Reviewed	98.19
PF04768		170	DUF619: Protein of unknown function (DUF619); Inte	98.19
TIGR01027		363	proB glutamate 5-kinase. Bacterial ProB proteins h	98.16
PRK13402		368	gamma-glutamyl kinase; Provisional	98.13
COG3818		167	Predicted acetyltransferase, GNAT superfamily [Gen	98.13
PTZ00489		264	glutamate 5-kinase; Provisional	98.12
cd04253		221	AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMP	98.07
cd04261		239	AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kina	98.05
cd04255		262	AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes th	98.04
cd04246		239	AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kina	98.03
cd04260		244	AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase	98.02
TIGR01092		715	P5CS delta l-pyrroline-5-carboxylate synthetase. T	97.91
PLN02418		718	delta-1-pyrroline-5-carboxylate synthase	97.88
PF12568		128	DUF3749: Acetyltransferase (GNAT) domain; InterPro	97.86
PF12746		265	GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S	97.85
COG2388		99	Predicted acetyltransferase [General function pred	97.82
cd04239		229	AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-lik	97.76
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	97.7
cd04234		227	AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK)	97.69
COG4552		389	Eis Predicted acetyltransferase involved in intrac	97.61
PF04958		342	AstA: Arginine N-succinyltransferase beta subunit;	97.48
PF08444		89	Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt	97.46
PRK00358		231	pyrH uridylate kinase; Provisional	97.45
COG0454		156	WecD Histone acetyltransferase HPA2 and related ac	97.44
PRK08210		403	aspartate kinase I; Reviewed	97.31
TIGR03694		241	exosort_acyl putative PEP-CTERM/exosortase system-	97.28
PF13480		142	Acetyltransf_6: Acetyltransferase (GNAT) domain	97.23
PRK10456		344	arginine succinyltransferase; Provisional	97.21
KOG4144		190	consensus Arylalkylamine N-acetyltransferase [Gene	97.18
cd04244		298	AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kina	97.17
PF00765		182	Autoind_synth: Autoinducer synthetase; InterPro: I	97.09
COG1608		252	Predicted archaeal kinase [General function predic	97.07
TIGR00657		441	asp_kinases aspartate kinase. The Lys-sensitive en	97.07
TIGR03244		336	arg_catab_AstA arginine N-succinyltransferase. In	96.98
PRK06635		404	aspartate kinase; Reviewed	96.91
TIGR03245		336	arg_AOST_alph arginine/ornithine succinyltransfera	96.9
TIGR03243		335	arg_catab_AOST arginine and ornithine succinyltran	96.85
TIGR00656		401	asp_kin_monofn aspartate kinase, monofunctional cl	96.81
PRK13834		207	putative autoinducer synthesis protein; Provisiona	96.79
cd04254		231	AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbi	96.79
PRK06291		465	aspartate kinase; Provisional	96.69
TIGR02075		233	pyrH_bact uridylate kinase. This protein, also cal	96.63
PRK14558		231	pyrH uridylate kinase; Provisional	96.55
KOG4135		185	consensus Predicted phosphoglucosamine acetyltrans	96.43
PF06852		181	DUF1248: Protein of unknown function (DUF1248); In	96.4
PRK08841		392	aspartate kinase; Validated	96.3
PRK14557		247	pyrH uridylate kinase; Provisional	96.28
COG0549		312	ArcC Carbamate kinase [Amino acid transport and me	96.02
PRK07431		587	aspartate kinase; Provisional	95.93
COG3916		209	LasI N-acyl-L-homoserine lactone synthetase [Signa	95.78
PRK08373		341	aspartate kinase; Validated	95.47
COG0263		369	ProB Glutamate 5-kinase [Amino acid transport and	95.35
COG3138		336	AstA Arginine/ornithine N-succinyltransferase beta	95.3
cd04259		295	AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Super	95.3
COG1243		515	ELP3 Histone acetyltransferase [Transcription / Ch	95.18
PRK14556		249	pyrH uridylate kinase; Provisional	95.07
COG5628		143	Predicted acetyltransferase [General function pred	95.06
COG3882		574	FkbH Predicted enzyme involved in methoxymalonyl-A	94.9
TIGR02078		327	AspKin_pair Pyrococcus aspartate kinase subunit, p	94.82
PF02799		190	NMT_C: Myristoyl-CoA:protein N-myristoyltransferas	94.37
KOG1154		285	consensus Gamma-glutamyl kinase [Amino acid transp	94.32
TIGR03019		330	pepcterm_femAB FemAB-related protein, PEP-CTERM sy	94.31
KOG2036		1011	consensus Predicted P-loop ATPase fused to an acet	93.75
cd04264		99	DUF619-NAGS DUF619 domain of various N-acetylgluta	93.65
PF13880		70	Acetyltransf_13: ESCO1/2 acetyl-transferase	93.37
PF01853		188	MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i	93.08
PF01233		162	NMT: Myristoyl-CoA:protein N-myristoyltransferase,	92.33
PRK01305		240	arginyl-tRNA-protein transferase; Provisional	92.31
KOG2779		421	consensus N-myristoyl transferase [Lipid transport	91.77
cd04265		99	DUF619-NAGS-U DUF619 domain of various N-acetylglu	91.66
cd04243		293	AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kina	91.19
PF04377		128	ATE_C: Arginine-tRNA-protein transferase, C termin	90.74
PLN03238		290	probable histone acetyltransferase MYST; Provision	90.63
PF13444		101	Acetyltransf_5: Acetyltransferase (GNAT) domain	90.32
KOG2535		554	consensus RNA polymerase II elongator complex, sub	89.78
PRK08961		861	bifunctional aspartate kinase/diaminopimelate deca	89.73
PTZ00064		552	histone acetyltransferase; Provisional	89.54
PLN03239		351	histone acetyltransferase; Provisional	88.85
PRK14852		989	hypothetical protein; Provisional	88.52
PLN00104		450	MYST -like histone acetyltransferase; Provisional	87.67
COG2401		593	ABC-type ATPase fused to a predicted acetyltransfe	87.01
cd04245		288	AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Ki	86.84
COG3375		266	Uncharacterized conserved protein [Function unknow	86.55
cd04257		294	AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfa	85.95
PF09924		299	DUF2156: Uncharacterized conserved protein (DUF215	84.5
COG5630		495	ARG2 Acetylglutamate synthase [Amino acid transpor	84.31
KOG2747		396	consensus Histone acetyltransferase (MYST family)	84.05
PRK09436		819	thrA bifunctional aspartokinase I/homoserine dehyd	83.54
cd04247		306	AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfa	83.53
cd04258		292	AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Ki	82.51
TIGR03827		266	GNAT_ablB putative beta-lysine N-acetyltransferase	81.77
PRK09084		448	aspartate kinase III; Validated	80.17

>PLN02825 amino-acid N-acetyltransferase	Back alignment and domain information

Probab=100.00  E-value=1.4e-67  Score=539.25  Aligned_cols=341  Identities=77%  Similarity=1.160  Sum_probs=308.1

Q ss_pred             eeccccCCCccc---------cccccCCHHHHHHHHHHHcCCceEEEEeCCcccCCCCcccccCCHHHHHHHHHHhhhhh
Q 017739           10 ISVNVDFESLIL---------CAFANFSTYEVATACALAIEADKLICIIDGPILDESGHLIRFLTLQEADSLIRQRVKQS   80 (366)
Q Consensus        10 ~~~~~~~~~~~~---------ge~~N~~~~~vA~~~A~~l~AdKli~l~~~~~~~~~g~l~~~l~~~~a~~~l~~~~~~~   80 (366)
                      |...++.|.|||         ||+||||+|+||+++|++|+|||||||||.++++.+|+++++|+++|+++||.+..+|+
T Consensus       162 i~~~L~~g~Ipvisplg~s~~Ge~~NinaD~vA~avA~aL~A~KLI~ltd~~~~~~~g~li~~l~~~e~~~li~~~~~~~  241 (515)
T PLN02825        162 IKERLDSNCIVLLSNLGYSSSGEVLNCNTYEVATACALAIGADKLICIVDGPILDENGRLIRFMTLEEADMLIRKRAKQS  241 (515)
T ss_pred             HHHHHhCCCeEEECCceECCCCCEEeeCHHHHHHHHHHHcCCCeEEEEeCcceecCCCCCcCcCCHHHHHHHHHhhhhcc
Confidence            445678999998         99999999999999999999999999999888899999999999999999998888899


Q ss_pred             HHHHhHHHHhhccccccccCCCC--CCccccCCCCCccc--ccccccccCCCccCCCCCCcccccccccccchhhhhccc
Q 017739           81 EIAANYVKAVAEEDITCFGHSDS--IGSVYSSQNGKTFS--ERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNG  156 (366)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~  156 (366)
                      +|||+++|||++..  +..|-+-  .+..+.+.+|..+|  ....+.|.++.++++++|+ ++.++|+.++.||+++...
T Consensus       242 ~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~  318 (515)
T PLN02825        242 EIAANYVKAVGGED--YSYSLGLDSVNTTPFNNNGRGFWGSGSATDSFQNGVGFDNGNGL-SGEQGFAIGGEERLSRLNG  318 (515)
T ss_pred             hhhhhhhhhccccc--cccccccccccccccccccccccccccccccccccccccCcccc-cccccccccchhhchhhhh
Confidence            99999999998885  3332221  12233334555544  3333456666666666664 6789999999999999999


Q ss_pred             chHHHHHHHHHHhcCCCeEEecccccCchhhhhhhcccCccceeeccccceEEeCCccCHHHHHHHHHHHHHcCcCccCC
Q 017739          157 YLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRT  236 (366)
Q Consensus       157 ~~~~l~~a~~a~~~GV~rvhlvd~~~~g~ll~Elft~~G~GTmI~~~~~~~IR~at~~Di~~I~~Li~~~~~~~~~~~rs  236 (366)
                      ++++|.+|++||++||+||||+|++.+|+||+||||++|+||||++++|+.||+++.+|++.|.+|+++++..++...++
T Consensus       319 ~~~~l~~a~~a~~~gv~r~hl~~~~~~gall~elft~dg~gt~i~~~~~e~IR~At~eDi~~I~~Li~~lee~g~lv~rs  398 (515)
T PLN02825        319 YLSELAAAAFVCRGGVQRVHLLDGTIEGVLLLELFTRDGMGTMIASDMYEGTRMARVEDLAGIRQIIRPLEESGILVRRT  398 (515)
T ss_pred             HHHHHHHHHHHHHcCCCeEEeccCCCCchHHHHhhccCCceeEeccChHhhheeCCHHHHHHHHHHHHHHHHcCCCcCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCcEEEEEECCeEEEEEEEeeecCCCeEEEEEEEECccccCCcHHHHHHHHHHHHHHHCCCCEEEEEcHHHHH
Q 017739          237 DEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTAD  316 (366)
Q Consensus       237 ~e~l~~~i~~~~V~e~dg~IVG~a~l~~~~d~~~~eL~~laV~P~yRGqGiG~~LL~~l~~~Ar~~Gi~~l~l~tt~A~~  316 (366)
                      ++.+..++.+|+|++.||+||||+.++++.+...++|.+++|+|+|||+|+|++||++++++|+++|+++++++|+++.+
T Consensus       399 ~e~le~ei~~f~V~e~Dg~IVG~aal~~~~~~~~aEI~~laV~P~yRGkGiG~~LL~~le~~Ar~~G~~~L~Lltt~a~~  478 (515)
T PLN02825        399 DEELLRALDSFVVVEREGSIIACAALFPFFEEKCGEVAAIAVSPECRGQGQGDKLLDYIEKKAASLGLEKLFLLTTRTAD  478 (515)
T ss_pred             HHHHHhcCCcEEEEEECCEEEEEEEEEeecCCCcEEEEEEEECHHHcCCCHHHHHHHHHHHHHHHCCCCEEEEEeCcHHH
Confidence            99999999999999999999999999988877889999999999999999999999999999999999999999999999


Q ss_pred             HHHHCCCeEeceeccchHHHhhhcCCCCceeEEEecC
Q 017739          317 WFKSRGFRECSIEMIPEERRKRINLSRNSKYYMKKLL  353 (366)
Q Consensus       317 fY~k~GF~~~~~~~Lp~~r~~~Y~~~r~s~vl~k~l~  353 (366)
                      ||+++||++++++.||..|++.||++||||||+|+|+
T Consensus       479 fY~k~GF~~~~~~~lp~~~~~~yn~~r~sk~~~k~l~  515 (515)
T PLN02825        479 WFVRRGFSECSIESLPEARRKRINLSRGSKYYMKKLL  515 (515)
T ss_pred             HHHHCCCEEeChhhCCHHHHhhcCccCCcEEEEEecC
Confidence            9999999999999999999999999999999999984

>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase	Back alignment and domain information

>PRK05279 N-acetylglutamate synthase; Validated	Back alignment and domain information

>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2436 consensus Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK04531 acetylglutamate kinase; Provisional	Back alignment and domain information

>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts	Back alignment and domain information

>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals	Back alignment and domain information

>PRK07757 acetyltransferase; Provisional	Back alignment and domain information

>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional	Back alignment and domain information

>CHL00202 argB acetylglutamate kinase; Provisional	Back alignment and domain information

>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP)	Back alignment and domain information

>PRK07922 N-acetylglutamate synthase; Validated	Back alignment and domain information

>PTZ00330 acetyltransferase; Provisional	Back alignment and domain information

>PRK00942 acetylglutamate kinase; Provisional	Back alignment and domain information

>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional	Back alignment and domain information

>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase	Back alignment and domain information

>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B	Back alignment and domain information

>PRK03624 putative acetyltransferase; Provisional	Back alignment and domain information

>PLN02512 acetylglutamate kinase	Back alignment and domain information

>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis	Back alignment and domain information

>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like	Back alignment and domain information

>PHA00673 acetyltransferase domain containing protein	Back alignment and domain information

>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A	Back alignment and domain information

>PLN02706 glucosamine 6-phosphate N-acetyltransferase	Back alignment and domain information

>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional	Back alignment and domain information

>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2	Back alignment and domain information

>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase	Back alignment and domain information

>PRK10140 putative acetyltransferase YhhY; Provisional	Back alignment and domain information

>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis	Back alignment and domain information

>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase	Back alignment and domain information

>PRK10975 TDP-fucosamine acetyltransferase; Provisional	Back alignment and domain information

>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A	Back alignment and domain information

>PRK09831 putative acyltransferase; Provisional	Back alignment and domain information

>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC)	Back alignment and domain information

>PRK14058 acetylglutamate/acetylaminoadipate kinase; Provisional	Back alignment and domain information

>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A	Back alignment and domain information

>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A	Back alignment and domain information

>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase	Back alignment and domain information

>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK12352 putative carbamate kinase; Reviewed	Back alignment and domain information

>PRK10514 putative acetyltransferase; Provisional	Back alignment and domain information

>COG3153 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK10314 putative acyltransferase; Provisional	Back alignment and domain information

>KOG3139 consensus N-acetyltransferase [General function prediction only]	Back alignment and domain information

>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103	Back alignment and domain information

>COG0456 RimI Acetyltransferases [General function prediction only]	Back alignment and domain information

>TIGR01686 FkbH FkbH-like domain	Back alignment and domain information

>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms	Back alignment and domain information

>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional	Back alignment and domain information

>PRK15130 spermidine N1-acetyltransferase; Provisional	Back alignment and domain information

>PRK01346 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00761 argB acetylglutamate kinase	Back alignment and domain information

>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase	Back alignment and domain information

>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase	Back alignment and domain information

>PRK10562 putative acetyltransferase; Provisional	Back alignment and domain information

>cd02169 Citrate_lyase_ligase Citrate lyase ligase	Back alignment and domain information

>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase	Back alignment and domain information

>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional	Back alignment and domain information

>PHA01807 hypothetical protein	Back alignment and domain information

>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK)	Back alignment and domain information

>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A	Back alignment and domain information

>PRK13688 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase	Back alignment and domain information

>TIGR00746 arcC carbamate kinase	Back alignment and domain information

>PF00696 AA_kinase: Amino acid kinase family Match to Glutamate-5-kinases, C-terminal end of the alignment Match to Aspartate kinases; InterPro: IPR001048 This entry contains proteins with various specificities and includes the aspartate, glutamate and uridylate kinase families	Back alignment and domain information

>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed	Back alignment and domain information

>COG2153 ElaA Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis	Back alignment and domain information

>PRK12353 putative amino acid kinase; Reviewed	Back alignment and domain information

>KOG3397 consensus Acetyltransferases [General function prediction only]	Back alignment and domain information

>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only]	Back alignment and domain information

>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT)	Back alignment and domain information

>PRK09411 carbamate kinase; Reviewed	Back alignment and domain information

>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate	Back alignment and domain information

>COG3393 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK05429 gamma-glutamyl kinase; Provisional	Back alignment and domain information

>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis	Back alignment and domain information

>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK12686 carbamate kinase; Reviewed	Back alignment and domain information

>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01211 ELP3 histone acetyltransferase, ELP3 family	Back alignment and domain information

>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only]	Back alignment and domain information

>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A	Back alignment and domain information

>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B	Back alignment and domain information

>COG3053 CitC Citrate lyase synthetase [Energy production and conversion]	Back alignment and domain information

>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP	Back alignment and domain information

>PRK12314 gamma-glutamyl kinase; Provisional	Back alignment and domain information

>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria	Back alignment and domain information

>COG3981 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>TIGR02076 pyrH_arch uridylate kinase, putative	Back alignment and domain information

>PRK12354 carbamate kinase; Reviewed	Back alignment and domain information

>PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2	Back alignment and domain information

>TIGR01027 proB glutamate 5-kinase	Back alignment and domain information

>PRK13402 gamma-glutamyl kinase; Provisional	Back alignment and domain information

>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only]	Back alignment and domain information

>PTZ00489 glutamate 5-kinase; Provisional	Back alignment and domain information

>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway)

Back alignment and domain information

>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences	Back alignment and domain information

>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis	Back alignment and domain information

>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes

Back alignment and domain information

>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species	Back alignment and domain information

>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase	Back alignment and domain information

>PLN02418 delta-1-pyrroline-5-carboxylate synthase	Back alignment and domain information

>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length	Back alignment and domain information

>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B	Back alignment and domain information

>COG2388 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;)	Back alignment and domain information

>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only]	Back alignment and domain information

>PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine	Back alignment and domain information

>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2	Back alignment and domain information

>PRK00358 pyrH uridylate kinase; Provisional	Back alignment and domain information

>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only]	Back alignment and domain information

>PRK08210 aspartate kinase I; Reviewed	Back alignment and domain information

>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase	Back alignment and domain information

>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain	Back alignment and domain information

>PRK10456 arginine succinyltransferase; Provisional	Back alignment and domain information

>KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only]	Back alignment and domain information

>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants	Back alignment and domain information

>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth	Back alignment and domain information

>COG1608 Predicted archaeal kinase [General function prediction only]	Back alignment and domain information

>TIGR00657 asp_kinases aspartate kinase	Back alignment and domain information

>TIGR03244 arg_catab_AstA arginine N-succinyltransferase	Back alignment and domain information

>PRK06635 aspartate kinase; Reviewed	Back alignment and domain information

>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit	Back alignment and domain information

>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits	Back alignment and domain information

>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class	Back alignment and domain information

>PRK13834 putative autoinducer synthesis protein; Provisional	Back alignment and domain information

>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway)	Back alignment and domain information

>PRK06291 aspartate kinase; Provisional	Back alignment and domain information

>TIGR02075 pyrH_bact uridylate kinase	Back alignment and domain information

>PRK14558 pyrH uridylate kinase; Provisional	Back alignment and domain information

>KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans	Back alignment and domain information

>PRK08841 aspartate kinase; Validated	Back alignment and domain information

>PRK14557 pyrH uridylate kinase; Provisional	Back alignment and domain information

>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK07431 aspartate kinase; Provisional	Back alignment and domain information

>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK08373 aspartate kinase; Validated	Back alignment and domain information

>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism]	Back alignment and domain information

>COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism]	Back alignment and domain information

>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria	Back alignment and domain information

>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics]	Back alignment and domain information

>PRK14556 pyrH uridylate kinase; Provisional	Back alignment and domain information

>COG5628 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative	Back alignment and domain information

>PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2	Back alignment and domain information

>KOG1154 consensus Gamma-glutamyl kinase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated	Back alignment and domain information

>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish	Back alignment and domain information

>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase	Back alignment and domain information

>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus	Back alignment and domain information

>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2	Back alignment and domain information

>PRK01305 arginyl-tRNA-protein transferase; Provisional	Back alignment and domain information

>KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism]	Back alignment and domain information

>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish	Back alignment and domain information

>cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH)	Back alignment and domain information

>PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein	Back alignment and domain information

>PLN03238 probable histone acetyltransferase MYST; Provisional	Back alignment and domain information

>PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain	Back alignment and domain information

>KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional	Back alignment and domain information

>PTZ00064 histone acetyltransferase; Provisional	Back alignment and domain information

>PLN03239 histone acetyltransferase; Provisional	Back alignment and domain information

>PRK14852 hypothetical protein; Provisional	Back alignment and domain information

>PLN00104 MYST -like histone acetyltransferase; Provisional	Back alignment and domain information

>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]	Back alignment and domain information

>cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species	Back alignment and domain information

>COG3375 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH)	Back alignment and domain information

>PF09924 DUF2156: Uncharacterized conserved protein (DUF2156); InterPro: IPR024320 This domain of unknown function is found in uncharacterised proteins and in Lysylphosphatidylglycerol synthetase, which catalyses the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol []	Back alignment and domain information

>COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2747 consensus Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]	Back alignment and domain information

>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional	Back alignment and domain information

>cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains	Back alignment and domain information

>cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII	Back alignment and domain information

>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase	Back alignment and domain information

>PRK09084 aspartate kinase III; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		366
2r8v_A		456	Native Structure Of N-Acetylglutamate Synthase From		7e-35
2r98_A		456	Crystal Structure Of N-Acetylglutamate Synthase (Se		7e-35
3e0k_A		150	Crystal Structure Of C-Termianl Domain Of N-Acetylg		6e-26
2gan_A		190	Crystal Structure Of A Putative Acetyltransferase F		3e-04

>pdb|2R8V|A Chain A, Native Structure Of N-Acetylglutamate Synthase From Neisseria Gonorrhoeae Length = 456

Back alignment and structure

Iteration: 1

Score = 144 bits (363), Expect = 7e-35, Method: Compositional matrix adjust. Identities = 76/194 (39%), Positives = 114/194 (58%), Gaps = 3/194 (1%) Query: 161 LAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIK 220 +++A GV RV +L+G G LL ELF R+G+GT +A + + R A D+ I Sbjct: 262 ISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIA 321 Query: 221 QIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSP 280 +I+PL E G L+ R+ E L + F ++E +G + CAAL F + CGE+A + VSP Sbjct: 322 ALIRPLEEQGILLHRSREYLENHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVSP 381 Query: 281 ECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRK--R 338 + + G G++LL +I KA +G+ LF L+T T +WF RGF+ S + +PE RRK R Sbjct: 382 QAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDELPETRRKDYR 441 Query: 339 INLSRNSKYYMKKL 352 N RNS +++L Sbjct: 442 SN-GRNSHILVRRL 454

PyMOL of 2r8v

>pdb|3E0K|A Chain A, Crystal Structure Of C-Termianl Domain Of N-Acetylglutamate Synthase From Vibrio Parahaemolyticus Length = 150

Back alignment and structure

>pdb|2GAN|A Chain A, Crystal Structure Of A Putative Acetyltransferase From Pyrococcus Horikoshii, Northeast Structural Genomics Target Jr32. Length = 190

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		366
3d2m_A		456	Putative acetylglutamate synthase; protein-COA-Glu	5e-84
3d2m_A		456	Putative acetylglutamate synthase; protein-COA-Glu	2e-08
3e0k_A		150	Amino-acid acetyltransferase; N-acetylglutamate sy	2e-54
1qst_A		160	TGCN5 histone acetyl transferase; GCN5-related N-a	7e-22
3d8p_A		163	Acetyltransferase of GNAT family; NP_373092.1, str	2e-14
2q7b_A		181	Acetyltransferase, GNAT family; NP_689019.1, struc	9e-14
3mgd_A		157	Predicted acetyltransferase; structural genomics,	9e-14
1z4r_A		168	General control of amino acid synthesis protein 5-	2e-13
2fiw_A		172	GCN5-related N-acetyltransferase:aminotransferase	3e-13
3jvn_A		166	Acetyltransferase; alpha-beta protein, structural	3e-13
1yvk_A		163	Hypothetical protein BSU33890; ALPHS-beta protein,	2e-12
2q0y_A		153	GCN5-related N-acetyltransferase; YP_295895.1, ace	2e-12
4e0a_A		164	BH1408 protein; structural genomics, PSI-biology,	2e-12
1y9k_A		157	IAA acetyltransferase; structural genomics, midwes	6e-12
3lod_A		162	Putative acyl-COA N-acyltransferase; structural ge	2e-11
2gan_A		190	182AA long hypothetical protein; alpha-beta protei	3e-11
1yx0_A		159	Hypothetical protein YSNE; NESG, GFT structral gen	3e-11
2dxq_A		150	AGR_C_4057P, acetyltransferase; structural genomic	3e-11
2aj6_A		159	Hypothetical protein MW0638; structural genomics,	3e-11
3i3g_A		161	N-acetyltransferase; malaria, structural genomics,	4e-11
1n71_A		180	AAC(6')-II; aminoglycoside 6'-N-acetyltransferase,	5e-11
1y9w_A		140	Acetyltransferase; structural genomics, Pro struct	6e-11
1mk4_A		157	Hypothetical protein YQJY; alpha-beta-alpha sandwi	1e-10
2fia_A		162	Acetyltransferase; structural genomics, PSI, prote	1e-10
3t9y_A		150	Acetyltransferase, GNAT family; PSI-biology, struc	1e-10
4evy_A		166	Aminoglycoside N(6')-acetyltransferase type 1; cen	3e-10
2i00_A		406	Acetyltransferase, GNAT family; structural genomic	3e-10
2vez_A		190	Putative glucosamine 6-phosphate acetyltransferase	4e-10
2ae6_A		166	Acetyltransferase, GNAT family; GCN5-related N-ace	4e-10
2atr_A		138	Acetyltransferase, GNAT family; MCSG, structural g	5e-10
1vkc_A		158	Putative acetyl transferase; structural genomics,	5e-10
2ob0_A		170	Human MAK3 homolog; acetyltransferase, structural	5e-10
2g3a_A		152	Acetyltransferase; structural genomics, PSI, prote	7e-10
1ghe_A		177	Acetyltransferase; acyl coenzyme A complex; HET: A	1e-09
1s3z_A		165	Aminoglycoside 6'-N-acetyltransferase; GNAT, amino	1e-09
3gy9_A		150	GCN5-related N-acetyltransferase; YP_001815201.1,	1e-09
2r7h_A		177	Putative D-alanine N-acetyltransferase of GNAT FA;	2e-09
2i6c_A		160	Putative acetyltransferase; GNAT family, structura	3e-09
1i12_A		160	Glucosamine-phosphate N-acetyltransferase; GNAT, a	4e-09
3c26_A		266	Putative acetyltransferase TA0821; NP_394282.1, A	4e-09
3n7z_A		388	Acetyltransferase, GNAT family; PSI2, MCSG, struct	4e-09
3t90_A		149	Glucose-6-phosphate acetyltransferase 1; GNAT fold	5e-09
3ec4_A		228	Putative acetyltransferase from the GNAT family; Y	9e-09
3dsb_A		157	Putative acetyltransferase; APC60368.2, ST genomic	9e-09
3kkw_A		182	Putative uncharacterized protein; acetyltransferas	1e-08
1bo4_A		168	Protein (serratia marcescens aminoglycoside-3-N- a	1e-08
1z4e_A		153	Transcriptional regulator; nysgxrc target T2017, G	1e-08
2r1i_A		172	GCN5-related N-acetyltransferase; YP_831484.1, put	1e-08
3dr6_A		174	YNCA; acetyltransferase, csgid target, essential g	2e-08
3fyn_A		176	Integron gene cassette protein HFX_CASS3; integron	2e-08
2ozg_A		396	GCN5-related N-acetyltransferase; YP_325469.1, ace	2e-08
3frm_A		254	Uncharacterized conserved protein; APC61048, staph	2e-08
2pdo_A		144	Acetyltransferase YPEA; alpha-beta-alpha sandwich,	2e-08
1ufh_A		180	YYCN protein; alpha and beta, fold, acetyltransfer	2e-08
3s6f_A		145	Hypothetical acetyltransferase; acyl-COA N-acyltra	2e-08
1on0_A		158	YYCN protein; structural genomics, alpha-beta prot	3e-08
3ddd_A		288	Putative acetyltransferase; NP_142035.1, structura	4e-08
2hv2_A		400	Hypothetical protein; PSI, protein structure initi	5e-08
2cnt_A		160	Modification of 30S ribosomal subunit protein S18;	5e-08
3pp9_A		187	Putative streptothricin acetyltransferase; toxin p	6e-08
2o28_A		184	Glucosamine 6-phosphate N-acetyltransferase; struc	6e-08
2oh1_A		179	Acetyltransferase, GNAT family; YP_013287.1, struc	6e-08
2ozh_A		142	Hypothetical protein XCC2953; structural genomics,	6e-08
1yr0_A		175	AGR_C_1654P, phosphinothricin acetyltransferase; s	7e-08
1y7r_A		133	Hypothetical protein SA2161; structural genomics,	7e-08
2ge3_A		170	Probable acetyltransferase; structural GEN PSI, pr	9e-08
1u6m_A		199	Acetyltransferase, GNAT family; structural genomic	1e-07
3ey5_A		181	Acetyltransferase-like, GNAT family; structural ge	2e-07
3g8w_A		169	Lactococcal prophage PS3 protein 05; APC61042, ace	3e-07
1tiq_A		180	Protease synthase and sporulation negative regulat	3e-07
1vhs_A		175	Similar to phosphinothricin acetyltransferase; str	4e-07
4ag7_A		165	Glucosamine-6-phosphate N-acetyltransferase; HET:	4e-07
3fix_A		183	N-acetyltransferase; termoplasma acidophilum, stru	5e-07
3bln_A		143	Acetyltransferase GNAT family; NP_981174.1, struct	5e-07
3f8k_A		160	Protein acetyltransferase; GCN5-related N-acetyltr	7e-07
2i79_A		172	Acetyltransferase, GNAT family; acetyl coenzyme *A	7e-07
1ygh_A		164	ADA4, protein (transcriptional activator GCN5); tr	1e-06
2eui_A		153	Probable acetyltransferase; dimer, structural geno	1e-06
2wpx_A		339	ORF14; transferase, acetyl transferase, antibiotic	2e-06
3ld2_A		197	SMU.2055, putative acetyltransferase; HET: COA; 2.	2e-06
2j8m_A		172	Acetyltransferase PA4866 from P. aeruginosa; GCN5	2e-06
1wwz_A		159	Hypothetical protein PH1933; structural genomics,	2e-06
2v5h_A		321	Acetylglutamate kinase; amino-acid biosynthesis, t	2e-06
3exn_A		160	Probable acetyltransferase; GCN5-related N-acetylt	3e-06
1m4i_A		181	Aminoglycoside 2'-N-acetyltransferase; COA binding	3e-06
2x7b_A		168	N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf	3e-06
2jlm_A		182	Putative phosphinothricin N-acetyltransferase; met	5e-06
2ap9_A		299	NAG kinase, acetylglutamate kinase, AGK; structura	6e-06
2bty_A		282	Acetylglutamate kinase; N-acetyl-L-glutamate kinas	7e-06
2cy2_A		174	TTHA1209, probable acetyltransferase; structural g	7e-06
1q2y_A		140	Protein YJCF, similar to hypothetical proteins; GC	1e-05
2rd5_A		298	Acetylglutamate kinase-like protein; protein-prote	1e-05
1sqh_A		312	Hypothetical protein CG14615-PA; structural genomi	1e-05
2buf_A		300	Acetylglutamate kinase; acetyglutamate kinase, ADP	1e-05
1kux_A		207	Aralkylamine, serotonin N-acetyltransferase; enzym	1e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
1cjw_A		166	Protein (serotonin N-acetyltransferase); HET: COT;	2e-05
3fnc_A		163	Protein LIN0611, putative acetyltransferase; GNAT,	4e-05
3iwg_A		276	Acetyltransferase, GNAT family; structural genomic	6e-05
4ab7_A		464	Protein Arg5,6, mitochondrial; transferase, argini	6e-05
3efa_A		147	Putative acetyltransferase; structural genom 2, pr	7e-05
3d3s_A		189	L-2,4-diaminobutyric acid acetyltransferase; alpha	7e-05
2pc1_A		201	Acetyltransferase, GNAT family; NP_688560.1, struc	8e-05
2kcw_A		147	Uncharacterized acetyltransferase YJAB; GNAT fold,	8e-05
3s6g_A		460	N-acetylglutamate kinase / N-acetylglutamate SYNT;	1e-04
3sxn_A		422	Enhanced intracellular surviVal protein; GNAT fold	2e-04
3h4q_A		188	Putative acetyltransferase; NP_371943.1, structura	2e-04
3r1k_A		428	Enhanced intracellular surviVal protein; GNAT, ace	2e-04
2ree_A		224	CURA; GNAT, S-acetyltransferase, decarboxylase, po	4e-04
3s6k_A		467	Acetylglutamate kinase; synthase, transferase; 2.8	4e-04
3qb8_A		197	A654L protein; GNAT N-acetyltransferase, acetyltra	6e-04
2b5g_A		171	Diamine acetyltransferase 1; structural genomics,	7e-04

>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456	Back alignment and structure

 Score =  261 bits (670), Expect = 5e-84
 Identities = 74/193 (38%), Positives = 113/193 (58%), Gaps = 1/193 (0%)

Query: 161 LAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIK 220
           +++A      GV RV +L+G   G LL ELF R+G+GT +A + +   R A   D+  I 
Sbjct: 262 ISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIA 321

Query: 221 QIIQPLVESGALVRRTDEELLKALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSP 280
            +I+PL E G L+ R+ E L   +  F ++E +G +  CAAL  F +  CGE+A + VSP
Sbjct: 322 ALIRPLEEQGILLHRSREYLENHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVSP 381

Query: 281 ECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSRGFRECSIEMIPEERRKRIN 340
           + +  G G++LL +I  KA  +G+  LF L+T T +WF  RGF+  S + +PE RRK   
Sbjct: 382 QAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDELPETRRKDYR 441

Query: 341 LS-RNSKYYMKKL 352
            + RNS   +++L
Sbjct: 442 SNGRNSHILVRRL 454

PyMOL of 3d2m

>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Length = 456	Back alignment and structure

>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150	Back alignment and structure

>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Length = 160	Back alignment and structure

>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Length = 163	Back alignment and structure

>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Length = 181	Back alignment and structure

>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157	Back alignment and structure

>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Length = 168	Back alignment and structure

>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172	Back alignment and structure

>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166	Back alignment and structure

>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163	Back alignment and structure

>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153	Back alignment and structure

>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164	Back alignment and structure

>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157	Back alignment and structure

>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Length = 162	Back alignment and structure

>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190	Back alignment and structure

>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 159	Back alignment and structure

>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150	Back alignment and structure

>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159	Back alignment and structure

>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Length = 161	Back alignment and structure

>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180	Back alignment and structure

>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140	Back alignment and structure

>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157	Back alignment and structure

>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 162	Back alignment and structure

>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150	Back alignment and structure

>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166	Back alignment and structure

>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 406	Back alignment and structure

>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190	Back alignment and structure

>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166	Back alignment and structure

>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138	Back alignment and structure

>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158	Back alignment and structure

>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Length = 170	Back alignment and structure

>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 152	Back alignment and structure

>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Length = 177	Back alignment and structure

>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165	Back alignment and structure

>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Length = 150	Back alignment and structure

>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177	Back alignment and structure

>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160	Back alignment and structure

>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160	Back alignment and structure

>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266	Back alignment and structure

>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Length = 388	Back alignment and structure

>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149	Back alignment and structure

>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228	Back alignment and structure

>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157	Back alignment and structure

>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182	Back alignment and structure

>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168	Back alignment and structure

>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153	Back alignment and structure

>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Length = 172	Back alignment and structure

>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} PDB: 3dr8_A* Length = 174	Back alignment and structure

>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176	Back alignment and structure

>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Length = 396	Back alignment and structure

>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254	Back alignment and structure

>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144	Back alignment and structure

>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180	Back alignment and structure

>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145	Back alignment and structure

>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158	Back alignment and structure

>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288	Back alignment and structure

>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 400	Back alignment and structure

>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Length = 160	Back alignment and structure

>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187	Back alignment and structure

>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184	Back alignment and structure

>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Length = 179	Back alignment and structure

>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Length = 142	Back alignment and structure

>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 175	Back alignment and structure

>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133	Back alignment and structure

>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170	Back alignment and structure

>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199	Back alignment and structure

>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181	Back alignment and structure

>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169	Back alignment and structure

>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Length = 180	Back alignment and structure

>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Length = 175	Back alignment and structure

>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165	Back alignment and structure

>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Length = 183	Back alignment and structure

>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143	Back alignment and structure

>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160	Back alignment and structure

>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172	Back alignment and structure

>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 164	Back alignment and structure

>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Length = 153	Back alignment and structure

>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339	Back alignment and structure

>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197	Back alignment and structure

>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Length = 172	Back alignment and structure

>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 159	Back alignment and structure

>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A* Length = 321	Back alignment and structure

>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160	Back alignment and structure

>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181	Back alignment and structure

>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Length = 168	Back alignment and structure

>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Length = 182	Back alignment and structure

>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2 Length = 299	Back alignment and structure

>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2 Length = 282	Back alignment and structure

>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Length = 174	Back alignment and structure

>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Length = 140	Back alignment and structure

>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana} Length = 298	Back alignment and structure

>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312	Back alignment and structure

>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2 Length = 300	Back alignment and structure

>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166	Back alignment and structure

>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} Length = 163	Back alignment and structure

>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Length = 276	Back alignment and structure

>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Length = 464	Back alignment and structure

>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Length = 147	Back alignment and structure

>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189	Back alignment and structure

>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Length = 201	Back alignment and structure

>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Length = 147	Back alignment and structure

>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Length = 460	Back alignment and structure

>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Length = 422	Back alignment and structure

>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Length = 188	Back alignment and structure

>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} Length = 428	Back alignment and structure

>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Length = 224	Back alignment and structure

>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Length = 467	Back alignment and structure

>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Length = 197	Back alignment and structure

>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Length = 171	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		366
3d2m_A		456	Putative acetylglutamate synthase; protein-COA-Glu	100.0
3s6g_A		460	N-acetylglutamate kinase / N-acetylglutamate SYNT;	99.94
3e0k_A		150	Amino-acid acetyltransferase; N-acetylglutamate sy	99.92
3s6k_A		467	Acetylglutamate kinase; synthase, transferase; 2.8	99.91
4ab7_A		464	Protein Arg5,6, mitochondrial; transferase, argini	99.86
3lod_A		162	Putative acyl-COA N-acyltransferase; structural ge	99.74
1tiq_A		180	Protease synthase and sporulation negative regulat	99.73
3kkw_A		182	Putative uncharacterized protein; acetyltransferas	99.73
3efa_A		147	Putative acetyltransferase; structural genom 2, pr	99.72
2x7b_A		168	N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf	99.71
3d8p_A		163	Acetyltransferase of GNAT family; NP_373092.1, str	99.71
2pdo_A		144	Acetyltransferase YPEA; alpha-beta-alpha sandwich,	99.71
2fia_A		162	Acetyltransferase; structural genomics, PSI, prote	99.71
2dxq_A		150	AGR_C_4057P, acetyltransferase; structural genomic	99.71
2ob0_A		170	Human MAK3 homolog; acetyltransferase, structural	99.7
1u6m_A		199	Acetyltransferase, GNAT family; structural genomic	99.7
3gy9_A		150	GCN5-related N-acetyltransferase; YP_001815201.1,	99.7
3fix_A		183	N-acetyltransferase; termoplasma acidophilum, stru	99.7
2i6c_A		160	Putative acetyltransferase; GNAT family, structura	99.69
1cjw_A		166	Protein (serotonin N-acetyltransferase); HET: COT;	99.69
2ge3_A		170	Probable acetyltransferase; structural GEN PSI, pr	99.69
4h89_A		173	GCN5-related N-acetyltransferase; N-acyltransferas	99.69
2q0y_A		153	GCN5-related N-acetyltransferase; YP_295895.1, ace	99.69
4e0a_A		164	BH1408 protein; structural genomics, PSI-biology,	99.69
1n71_A		180	AAC(6')-II; aminoglycoside 6'-N-acetyltransferase,	99.68
4evy_A		166	Aminoglycoside N(6')-acetyltransferase type 1; cen	99.68
2fe7_A		166	Probable N-acetyltransferase; structural genomics,	99.68
3dr6_A		174	YNCA; acetyltransferase, csgid target, essential g	99.68
2bei_A		170	Diamine acetyltransferase 2; SSAT2, BC011751, AAH1	99.68
1vhs_A		175	Similar to phosphinothricin acetyltransferase; str	99.68
2cnt_A		160	Modification of 30S ribosomal subunit protein S18;	99.68
3i9s_A		183	Integron cassette protein; oyster POND, woods HOLE	99.67
3fnc_A		163	Protein LIN0611, putative acetyltransferase; GNAT,	99.67
1ghe_A		177	Acetyltransferase; acyl coenzyme A complex; HET: A	99.67
2q7b_A		181	Acetyltransferase, GNAT family; NP_689019.1, struc	99.67
3i3g_A		161	N-acetyltransferase; malaria, structural genomics,	99.67
1z4e_A		153	Transcriptional regulator; nysgxrc target T2017, G	99.67
3mgd_A		157	Predicted acetyltransferase; structural genomics,	99.67
1mk4_A		157	Hypothetical protein YQJY; alpha-beta-alpha sandwi	99.67
3dsb_A		157	Putative acetyltransferase; APC60368.2, ST genomic	99.66
2oh1_A		179	Acetyltransferase, GNAT family; YP_013287.1, struc	99.66
2i79_A		172	Acetyltransferase, GNAT family; acetyl coenzyme *A	99.66
2ae6_A		166	Acetyltransferase, GNAT family; GCN5-related N-ace	99.65
3t9y_A		150	Acetyltransferase, GNAT family; PSI-biology, struc	99.65
2fiw_A		172	GCN5-related N-acetyltransferase:aminotransferase	99.65
2r7h_A		177	Putative D-alanine N-acetyltransferase of GNAT FA;	99.64
1s3z_A		165	Aminoglycoside 6'-N-acetyltransferase; GNAT, amino	99.64
2ozh_A		142	Hypothetical protein XCC2953; structural genomics,	99.64
1qsm_A		152	HPA2 histone acetyltransferase; protein-acetyl coe	99.64
3bln_A		143	Acetyltransferase GNAT family; NP_981174.1, struct	99.64
4fd4_A		217	Arylalkylamine N-acetyltransferase like 5B; GNAT;	99.64
3owc_A		188	Probable acetyltransferase; structural genomics, P	99.64
2j8m_A		172	Acetyltransferase PA4866 from P. aeruginosa; GCN5	99.64
3t90_A		149	Glucose-6-phosphate acetyltransferase 1; GNAT fold	99.64
3fyn_A		176	Integron gene cassette protein HFX_CASS3; integron	99.64
1y9w_A		140	Acetyltransferase; structural genomics, Pro struct	99.63
2eui_A		153	Probable acetyltransferase; dimer, structural geno	99.63
1vkc_A		158	Putative acetyl transferase; structural genomics,	99.63
3fbu_A		168	Acetyltransferase, GNAT family; structur genomics,	99.63
3g8w_A		169	Lactococcal prophage PS3 protein 05; APC61042, ace	99.62
1wwz_A		159	Hypothetical protein PH1933; structural genomics,	99.62
1kux_A		207	Aralkylamine, serotonin N-acetyltransferase; enzym	99.62
2cy2_A		174	TTHA1209, probable acetyltransferase; structural g	99.62
1yr0_A		175	AGR_C_1654P, phosphinothricin acetyltransferase; s	99.61
1y7r_A		133	Hypothetical protein SA2161; structural genomics,	99.61
1i12_A		160	Glucosamine-phosphate N-acetyltransferase; GNAT, a	99.61
3igr_A		184	Ribosomal-protein-S5-alanine N-acetyltransferase;	99.61
2jlm_A		182	Putative phosphinothricin N-acetyltransferase; met	99.61
3exn_A		160	Probable acetyltransferase; GCN5-related N-acetylt	99.61
4ag7_A		165	Glucosamine-6-phosphate N-acetyltransferase; HET:	99.61
2atr_A		138	Acetyltransferase, GNAT family; MCSG, structural g	99.61
2jdc_A		146	Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.	99.6
2r1i_A		172	GCN5-related N-acetyltransferase; YP_831484.1, put	99.6
1ufh_A		180	YYCN protein; alpha and beta, fold, acetyltransfer	99.6
1on0_A		158	YYCN protein; structural genomics, alpha-beta prot	99.6
2pc1_A		201	Acetyltransferase, GNAT family; NP_688560.1, struc	99.6
3ec4_A		228	Putative acetyltransferase from the GNAT family; Y	99.59
3jvn_A		166	Acetyltransferase; alpha-beta protein, structural	99.59
3ld2_A		197	SMU.2055, putative acetyltransferase; HET: COA; 2.	99.59
1y9k_A		157	IAA acetyltransferase; structural genomics, midwes	99.59
2ree_A		224	CURA; GNAT, S-acetyltransferase, decarboxylase, po	99.59
1yx0_A		159	Hypothetical protein YSNE; NESG, GFT structral gen	99.59
2bue_A		202	AAC(6')-IB; GNAT, transferase, aminoglycoside, flu	99.59
2b5g_A		171	Diamine acetyltransferase 1; structural genomics,	99.59
1s7k_A		182	Acetyl transferase; GNAT; 1.80A {Salmonella typhim	99.59
3f8k_A		160	Protein acetyltransferase; GCN5-related N-acetyltr	99.59
2vi7_A		177	Acetyltransferase PA1377; GNAT, GCN5 family, N-ace	99.58
3pp9_A		187	Putative streptothricin acetyltransferase; toxin p	99.58
2aj6_A		159	Hypothetical protein MW0638; structural genomics,	99.57
1xeb_A		150	Hypothetical protein PA0115; midwest center for st	99.57
3h4q_A		188	Putative acetyltransferase; NP_371943.1, structura	99.57
2o28_A		184	Glucosamine 6-phosphate N-acetyltransferase; struc	99.57
3ey5_A		181	Acetyltransferase-like, GNAT family; structural ge	99.57
1q2y_A		140	Protein YJCF, similar to hypothetical proteins; GC	99.57
2v5h_A		321	Acetylglutamate kinase; amino-acid biosynthesis, t	99.57
1bo4_A		168	Protein (serratia marcescens aminoglycoside-3-N- a	99.56
2buf_A		300	Acetylglutamate kinase; acetyglutamate kinase, ADP	99.56
3f5b_A		182	Aminoglycoside N(6')acetyltransferase; APC60744, l	99.56
2fl4_A		149	Spermine/spermidine acetyltransferase; structural	99.56
1z4r_A		168	General control of amino acid synthesis protein 5-	99.56
3juw_A		175	Probable GNAT-family acetyltransferase; structural	99.56
3r9f_A		188	MCCE protein; microcin C7, acetyltransferase, SELF	99.55
2ap9_A		299	NAG kinase, acetylglutamate kinase, AGK; structura	99.55
1qst_A		160	TGCN5 histone acetyl transferase; GCN5-related N-a	99.55
3tth_A		170	Spermidine N1-acetyltransferase; central intermedi	99.54
2g3a_A		152	Acetyltransferase; structural genomics, PSI, prote	99.54
3d3s_A		189	L-2,4-diaminobutyric acid acetyltransferase; alpha	99.54
3eg7_A		176	Spermidine N1-acetyltransferase; structural genomi	99.54
3eo4_A		164	Uncharacterized protein MJ1062; APC60792.2,MJ_1062	99.54
4fd5_A		222	Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A	99.54
2rd5_A		298	Acetylglutamate kinase-like protein; protein-prote	99.54
2qec_A		204	Histone acetyltransferase HPA2 and related acetylt	99.53
1nsl_A		184	Probable acetyltransferase; structural genomics, h	99.53
3ddd_A		288	Putative acetyltransferase; NP_142035.1, structura	99.53
2vez_A		190	Putative glucosamine 6-phosphate acetyltransferase	99.53
1yre_A		197	Hypothetical protein PA3270; APC5563, midwest cent	99.52
3qb8_A		197	A654L protein; GNAT N-acetyltransferase, acetyltra	99.52
2fsr_A		195	Acetyltransferase; alpha-beta-sandwich, structural	99.52
3te4_A		215	GH12636P, dopamine N acetyltransferase, isoform A;	99.51
2bty_A		282	Acetylglutamate kinase; N-acetyl-L-glutamate kinas	99.51
3iwg_A		276	Acetyltransferase, GNAT family; structural genomic	99.5
1ygh_A		164	ADA4, protein (transcriptional activator GCN5); tr	99.5
2fck_A		181	Ribosomal-protein-serine acetyltransferase, putat;	99.49
3pzj_A		209	Probable acetyltransferases; MCSG, PSI-2, structur	99.49
2z10_A		194	Ribosomal-protein-alanine acetyltransferase; alpha	99.48
2kcw_A		147	Uncharacterized acetyltransferase YJAB; GNAT fold,	99.48
1m4i_A		181	Aminoglycoside 2'-N-acetyltransferase; COA binding	99.48
3tt2_A		330	GCN5-related N-acetyltransferase; structural genom	99.46
2d4p_A		141	Hypothetical protein TTHA1254; structural genomics	99.46
2wpx_A		339	ORF14; transferase, acetyl transferase, antibiotic	99.46
2vzy_A		218	RV0802C; transferase, GCN5-related N-acetyltransfe	99.45
2qml_A		198	BH2621 protein; structural genomics, joint center	99.45
1yk3_A		210	Hypothetical protein RV1347C/MT1389; acyltransfera	99.45
2k5t_A		128	Uncharacterized protein YHHK; N-acetyl transferase	99.44
2gan_A		190	182AA long hypothetical protein; alpha-beta protei	99.43
1gs5_A		258	Acetylglutamate kinase; carbamate kinase, amino ac	99.43
3zzh_A		307	Acetylglutamate kinase; transferase, arginine bios	99.42
2ozg_A		396	GCN5-related N-acetyltransferase; YP_325469.1, ace	99.42
3ll9_A		269	Isopentenyl phosphate kinase; mevalonate biosynthe	99.42
3s6f_A		145	Hypothetical acetyltransferase; acyl-COA N-acyltra	99.41
3c26_A		266	Putative acetyltransferase TA0821; NP_394282.1, A	99.4
3tcv_A		246	GCN5-related N-acetyltransferase; GRAM negative co	99.4
4fd7_A		238	Putative arylalkylamine N-acetyltransferase 7; GNA	99.4
3n7z_A		388	Acetyltransferase, GNAT family; PSI2, MCSG, struct	99.4
2i00_A		406	Acetyltransferase, GNAT family; structural genomic	99.39
1yvk_A		163	Hypothetical protein BSU33890; ALPHS-beta protein,	99.39
1p0h_A		318	Hypothetical protein RV0819; GNAT fold, acetyltran	99.38
3frm_A		254	Uncharacterized conserved protein; APC61048, staph	99.38
3k4o_A		266	Isopentenyl phosphate kinase; small molecule kinas	99.38
2hv2_A		400	Hypothetical protein; PSI, protein structure initi	99.38
2g0b_A		198	FEEM; N-acyl transferase, environmental DNA, prote	99.37
3l86_A		279	Acetylglutamate kinase; ARGB, amino-acid biosynthe	99.36
3tt2_A		330	GCN5-related N-acetyltransferase; structural genom	99.35
3r1k_A		428	Enhanced intracellular surviVal protein; GNAT, ace	99.34
2egx_A		269	Putative acetylglutamate kinase; struc genomics, N	99.33
2wpx_A		339	ORF14; transferase, acetyl transferase, antibiotic	99.32
4ava_A		333	Lysine acetyltransferase; allosteric regulation, d	99.32
2we5_A		310	Carbamate kinase 1; arginine catabolism, arginine	99.28
3sxn_A		422	Enhanced intracellular surviVal protein; GNAT fold	99.28
2zw5_A		301	Bleomycin acetyltransferase; dimer, two domains; H	99.26
2j4j_A		226	Uridylate kinase; transferase, nucleoside monophos	99.26
2ako_A		251	Glutamate 5-kinase; structural genomics, PSI, prot	99.26
3kzf_A		317	Carbamate kinase; arginine dihydrolase pathway, gi	99.25
2pr1_A		163	Uncharacterized N-acetyltransferase YLBP; YIBP pro	99.24
3ll5_A		249	Gamma-glutamyl kinase related protein; alternate m	99.22
2e9y_A		316	Carbamate kinase; transferase, structural genomics	99.2
1r57_A		102	Conserved hypothetical protein; GCN5, N-acetyltran	99.2
3g3s_A		249	GCN5-related N-acetyltransferase; ZP_00874857.1, a	99.18
2q04_A		211	Acetoin utilization protein; ZP_00540088.1, struct	99.17
2ij9_A		219	Uridylate kinase; structural genomics, protein str	99.17
3d40_A		286	FOMA protein; fosfomycin, antibiotic resistance, k	99.16
1e19_A		314	Carbamate kinase-like carbamoylphosphate synthetas	99.14
1sqh_A		312	Hypothetical protein CG14615-PA; structural genomi	99.13
4a7w_A		240	Uridylate kinase; transferase; HET: GTP; 1.80A {He	99.1
2ft0_A		235	TDP-fucosamine acetyltransferase; GNAT fold acetyl	99.1
2brx_A		244	Uridylate kinase; UMP kinase, amino acid kinase, p	99.09
2j5v_A		367	Glutamate 5-kinase; proline biosynthesis, gamma gl	99.09
1p0h_A		318	Hypothetical protein RV0819; GNAT fold, acetyltran	99.07
1z9d_A		252	Uridylate kinase, UK, UMP kinase; structural genom	98.99
4axs_A		332	Carbamate kinase; oxidoreductase; 2.50A {Mycoplasm	98.96
2zpa_A		671	Uncharacterized protein YPFI; RNA modification enz	98.94
1ro5_A		201	Autoinducer synthesis protein LASI; alpha-beta-alp	98.91
2ogx_B		270	Molybdenum storage protein subunit beta; open alph	98.85
1ybd_A		239	Uridylate kinase; alpha/beta/alpha fold, hexamer,	98.85
2ogx_A		276	Molybdenum storage protein subunit alpha; open alp	98.84
3ek6_A		243	Uridylate kinase; UMPK unique GTP B site, alloster	98.82
2va1_A		256	Uridylate kinase; UMPK, transferase, pyrimidine bi	98.76
2a1f_A		247	Uridylate kinase; PYRH, structural genomics, PSI,	98.73
3nwy_A		281	Uridylate kinase; allosterically activated form, A	98.7
3p2h_A		201	AHL synthase; acyl-ACP binding, SAM binding, signa	98.67
1xmt_A		103	Putative acetyltransferase; structural genomics, p	98.64
3shp_A		176	Putative acetyltransferase STHE_0691; PSI-biology,	98.61
1bob_A		320	HAT1, histone acetyltransferase; histone modificat	98.57
2jjx_A		255	Uridylate kinase, UMP kinase; structural genomics,	98.54
3ab4_A		421	Aspartokinase; aspartate kinase, concerted inhibit	98.54
1kzf_A		230	Acyl-homoserinelactone synthase ESAI; alpha-beta,	98.4
1yle_A		342	Arginine N-succinyltransferase, alpha chain; struc	98.37
3dns_A		135	Ribosomal-protein-alanine acetyltransferase; N-ter	98.0
3c1m_A		473	Probable aspartokinase; allosteric inhibition, thr	97.86
3l76_A		600	Aspartokinase; allostery, ACT domains, kinase tran	97.52
2j0w_A		449	Lysine-sensitive aspartokinase 3; feedback inhibit	97.4
2cdq_A		510	Aspartokinase; aspartate kinase, amino acid metabo	96.4
2p0w_A		324	Histone acetyltransferase type B catalytic subuni;	96.15
3ddd_A		288	Putative acetyltransferase; NP_142035.1, structura	95.74
3tvi_A		446	Aspartokinase; structural genomics, ACT domains, r	94.8
3iwg_A		276	Acetyltransferase, GNAT family; structural genomic	94.16
3gkr_A		336	FEMX; FEMX, peptidoglycan, hexapeptide, transferas	93.87
4hkf_A		191	Alpha-tubulin N-acetyltransferase; tubulin acetylt	93.67
2wuu_A		421	N-myristoyltransferase; acyltransferase; HET: NHM;	92.97
4b14_A		385	Glycylpeptide N-tetradecanoyltransferase; malaria,	92.88
3to7_A		276	Histone acetyltransferase ESA1; MYST family; HET:	91.36
4b14_A		385	Glycylpeptide N-tetradecanoyltransferase; malaria,	91.32
4b5o_A		200	Alpha-tubulin N-acetyltransferase; microtubules, c	91.25
2ou2_A		280	Histone acetyltransferase htatip; structural genom	90.77
2ozu_A		284	Histone acetyltransferase MYST3; structural genomi	90.71
1iic_A		422	Peptide N-myristoyltransferase; HET: MYA; 2.20A {S	90.54
3iu1_A		383	Glycylpeptide N-tetradecanoyltransferase 1; N-myri	90.44
3iu1_A		383	Glycylpeptide N-tetradecanoyltransferase 1; N-myri	90.01
2pq8_A		278	Probable histone acetyltransferase MYST1; MOF, str	89.81
1iyk_A		392	Myristoyl-COA:protein N-myristoyltransferase; HET:	89.4
2wuu_A		421	N-myristoyltransferase; acyltransferase; HET: NHM;	88.84
4gs4_A		240	Alpha-tubulin N-acetyltransferase; acetyl coenzyme	88.17
1lrz_A		426	FEMA, factor essential for expression of methicill	87.6
1iyk_A		392	Myristoyl-COA:protein N-myristoyltransferase; HET:	87.11
4h6u_A		200	Alpha-tubulin N-acetyltransferase; tubulin acetylt	86.79
1iic_A		422	Peptide N-myristoyltransferase; HET: MYA; 2.20A {S	86.63
2ozg_A		396	GCN5-related N-acetyltransferase; YP_325469.1, ace	85.69
2i00_A		406	Acetyltransferase, GNAT family; structural genomic	83.57

>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A*	Back alignment and structure

Probab=100.00  E-value=6.3e-40  Score=332.48  Aligned_cols=265  Identities=34%  Similarity=0.588  Sum_probs=245.1

Q ss_pred             ccccCCCccc---------cccccCCHHHHHHHHHHHcCCceEEEEeCCc-ccCCCCcccccCCHHHHHHHHHHhhhhhH
Q 017739           12 VNVDFESLIL---------CAFANFSTYEVATACALAIEADKLICIIDGP-ILDESGHLIRFLTLQEADSLIRQRVKQSE   81 (366)
Q Consensus        12 ~~~~~~~~~~---------ge~~N~~~~~vA~~~A~~l~AdKli~l~~~~-~~~~~g~l~~~l~~~~a~~~l~~~~~~~~   81 (366)
                      .-++.|.||+         ||.+|+|+|.+|+.+|.+|+|||||++||.+ +.+.++++++.++..|+++++...     
T Consensus       180 ~lL~~g~ipIi~~~~~~~~g~~~~~~~D~~Aa~lA~~l~Ad~li~lTdvdGv~~~~~~~i~~i~~~e~~~~~~~g-----  254 (456)
T 3d2m_A          180 FQLDAGNIVWMPPLGHSYGGKTFNLDMVQAAASVAVSLQAEKLVYLTLSDGISRPDGTLAETLSAQEAQSLAEHA-----  254 (456)
T ss_dssp             HHHHTTCEEEECSEEECTTSCEEECCHHHHHHHHHHHHTCSEEEEEESSSSCBCTTSCBCSEEEHHHHHHHHTTC-----
T ss_pred             HHHHCCCeEEECCcccCCCCCEEEECHHHHHHHHHHHcCCCEEEEEECCccccCCCCCccccCCHHHHHHHHhcc-----
Confidence            4567788887         8999999999999999999999999999998 677789999999999999886210     


Q ss_pred             HHHhHHHHhhccccccccCCCCCCccccCCCCCcccccccccccCCCccCCCCCCcccccccccccchhhhhcccchHHH
Q 017739           82 IAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSEL  161 (366)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~l  161 (366)
                                                                        .                      .+|.++|
T Consensus       255 --------------------------------------------------~----------------------ggm~~Kl  262 (456)
T 3d2m_A          255 --------------------------------------------------A----------------------SETRRLI  262 (456)
T ss_dssp             --------------------------------------------------C----------------------HHHHHHH
T ss_pred             --------------------------------------------------C----------------------CChHHHH
Confidence                                                              0                      1289999


Q ss_pred             HHHHHHHhcCCCeEEecccccCchhhhhhhcccCccceeeccccceEEeCCccCHHHHHHHHHHHHHcCcCccCCHHHHH
Q 017739          162 AAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLYEGTRTAKVTDLSGIKQIIQPLVESGALVRRTDEELL  241 (366)
Q Consensus       162 ~~a~~a~~~GV~rvhlvd~~~~g~ll~Elft~~G~GTmI~~~~~~~IR~at~~Di~~I~~Li~~~~~~~~~~~rs~e~l~  241 (366)
                      .+|..||+.||+++||++++.++.++.++|+..+.||++..+.++.||+++++|++.+.+++......++..+++.+.+.
T Consensus       263 ~aa~~a~~~gv~~v~I~~~~~~~~ll~~l~~~~~~GT~i~~~~~~~IR~a~~~D~~~i~~l~~~~~~~~~~~~~~~~~~~  342 (456)
T 3d2m_A          263 SSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIAALIRPLEEQGILLHRSREYLE  342 (456)
T ss_dssp             HHHHHHHHTTCSEEEEEETTSTTHHHHHHHCSSCSSEEEECCCCCEEEECCGGGHHHHHHHHHHHHHHTSSCCCCHHHHH
T ss_pred             HHHHHHHHhCCCEEEEecCcCCchHHHHHHhhcCCceeeecccceeeCCCCHHHHHHHHHHHHHHHhcCCCccCCHHHHH
Confidence            99999999999999999999999999999999999999999988999999999999999999988888888889999999


Q ss_pred             hhcCcEEEEEECCeEEEEEEEeeecCCCeEEEEEEEECccccCCcHHHHHHHHHHHHHHHCCCCEEEEEcHHHHHHHHHC
Q 017739          242 KALDSFYVVEREGQIIACAALFPFFKEKCGEVAAIGVSPECRGQGQGDKLLDYIEKKAASLGLDMLFLLTTRTADWFKSR  321 (366)
Q Consensus       242 ~~i~~~~V~e~dg~IVG~a~l~~~~d~~~~eL~~laV~P~yRGqGiG~~LL~~l~~~Ar~~Gi~~l~l~tt~A~~fY~k~  321 (366)
                      .++..+++++.+|++|||+.+....+...++|..++|+|+|||+|+|++||+++++++++.|++.+++.++.+.+||+|+
T Consensus       343 ~~l~~~~va~~~g~iVG~~~~~~~~~~~~~~I~~l~V~p~~rg~GiG~~Ll~~~~~~a~~~g~~~i~l~N~~a~~fY~k~  422 (456)
T 3d2m_A          343 NHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAER  422 (456)
T ss_dssp             HHGGGEEEEEETTEEEEEEEEEECSSTTEEEEEEEEECGGGTTSSHHHHHHHHHHHHHHHTTCCEEEEEESSCHHHHHTT
T ss_pred             HHHhhEEEEEECCEEEEEEEEEecCCCCEEEEEEEEECHHHcCCCHHHHHHHHHHHHHHHcCCCEEEEEcHHHHHHHHHC
Confidence            99989999999999999999998766688999999999999999999999999999999999999999888899999999


Q ss_pred             CCeEeceeccchHHHhhhcCC-CCceeEEEecC
Q 017739          322 GFRECSIEMIPEERRKRINLS-RNSKYYMKKLL  353 (366)
Q Consensus       322 GF~~~~~~~Lp~~r~~~Y~~~-r~s~vl~k~l~  353 (366)
                      ||+..+...+|..++..|+++ |++++|+|+|+
T Consensus       423 GF~~~~~~~~p~~~~~~y~~~~r~~~v~~k~L~  455 (456)
T 3d2m_A          423 GFQTASEDELPETRRKDYRSNGRNSHILVRRLH  455 (456)
T ss_dssp             TCEEECGGGSCHHHHHHHHHHCCCCEEEEEECC
T ss_pred             CCEEeCcccCCHHHHhhcccccCCeEEEEEEcC
Confidence            999999999999999999999 99999999985

PyMOL of 3d2m

>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A*	Back alignment and structure

>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus}	Back alignment and structure

>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV}	Back alignment and structure

>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A*	Back alignment and structure

>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus}	Back alignment and structure

>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp}	Back alignment and structure

>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A}	Back alignment and structure

>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str}	Back alignment and structure

>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A*	Back alignment and structure

>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A*	Back alignment and structure

>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A*	Back alignment and structure

>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A*	Back alignment and structure

>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A	Back alignment and structure

>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1	Back alignment and structure

>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida}	Back alignment and structure

>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134}	Back alignment and structure

>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A*	Back alignment and structure

>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A*	Back alignment and structure

>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A	Back alignment and structure

>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1	Back alignment and structure

>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A*	Back alignment and structure

>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A*	Back alignment and structure

>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A*	Back alignment and structure

>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae}	Back alignment and structure

>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0	Back alignment and structure

>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A*	Back alignment and structure

>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V}	Back alignment and structure

>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A	Back alignment and structure

>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1	Back alignment and structure

>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum}	Back alignment and structure

>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile}	Back alignment and structure

>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str}	Back alignment and structure

>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae}	Back alignment and structure

>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus}	Back alignment and structure

>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1	Back alignment and structure

>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A*	Back alignment and structure

>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV}	Back alignment and structure

>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A	Back alignment and structure

>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus}	Back alignment and structure

>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti}	Back alignment and structure

>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A	Back alignment and structure

>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana}	Back alignment and structure

>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium}	Back alignment and structure

>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1	Back alignment and structure

>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1	Back alignment and structure

>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1	Back alignment and structure

>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str}	Back alignment and structure

>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228}	Back alignment and structure

>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1	Back alignment and structure

>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E*	Back alignment and structure

>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A*	Back alignment and structure

>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1	Back alignment and structure

>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1	Back alignment and structure

>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A	Back alignment and structure

>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0	Back alignment and structure

>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi}	Back alignment and structure

>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus}	Back alignment and structure

>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A*	Back alignment and structure

>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1	Back alignment and structure

>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A*	Back alignment and structure

>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP}	Back alignment and structure

>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1	Back alignment and structure

>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V}	Back alignment and structure

>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri}	Back alignment and structure

>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans}	Back alignment and structure

>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1	Back alignment and structure

>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A*	Back alignment and structure

>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1	Back alignment and structure

>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A*	Back alignment and structure

>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A*	Back alignment and structure

>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A	Back alignment and structure

>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2}	Back alignment and structure

>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa}	Back alignment and structure

>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis}	Back alignment and structure

>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1	Back alignment and structure

>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1	Back alignment and structure

>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp}	Back alignment and structure

>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A	Back alignment and structure

>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>2v5h_A Acetylglutamate kinase; amino-acid biosynthesis, transcription regulation, transfera cyanobacteria, transcription; HET: NLG; 2.75A {Synechococcus elongatus} PDB: 2jj4_A*	Back alignment and structure

>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1	Back alignment and structure

>2buf_A Acetylglutamate kinase; acetyglutamate kinase, ADP, arginine biosynthesis, FEED-BACK inhibition, hexamer, transferase; HET: NLG ADP; 2.95A {Pseudomonas aeruginosa} SCOP: c.73.1.2	Back alignment and structure

>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp}	Back alignment and structure

>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B*	Back alignment and structure

>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis}	Back alignment and structure

>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A*	Back alignment and structure

>2ap9_A NAG kinase, acetylglutamate kinase, AGK; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.80A {Mycobacterium tuberculosis} SCOP: c.73.1.2	Back alignment and structure

>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A*	Back alignment and structure

>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii}	Back alignment and structure

>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1	Back alignment and structure

>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822}	Back alignment and structure

>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0	Back alignment and structure

>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii}	Back alignment and structure

>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A	Back alignment and structure

>2rd5_A Acetylglutamate kinase-like protein; protein-protein complex, regulation of arginine biosynthesis nitrogen metabolism, kinase, transferase, transcription; HET: ARG ADP NLG ATP; 2.51A {Arabidopsis thaliana}	Back alignment and structure

>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii}	Back alignment and structure

>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A*	Back alignment and structure

>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1	Back alignment and structure

>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1}	Back alignment and structure

>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1	Back alignment and structure

>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A*	Back alignment and structure

>2bty_A Acetylglutamate kinase; N-acetyl-L-glutamate kinase, amino acid kinase, phosphoryl group transfer, arginine metabolism, transferase; HET: ARG NLG; 2.75A {Thermotoga maritima} SCOP: c.73.1.2	Back alignment and structure

>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea}	Back alignment and structure

>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1	Back alignment and structure

>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1	Back alignment and structure

>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum}	Back alignment and structure

>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A*	Back alignment and structure

>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli}	Back alignment and structure

>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A*	Back alignment and structure

>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus}	Back alignment and structure

>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A	Back alignment and structure

>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A*	Back alignment and structure

>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A*	Back alignment and structure

>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans}	Back alignment and structure

>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1	Back alignment and structure

>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12}	Back alignment and structure

>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1	Back alignment and structure

>1gs5_A Acetylglutamate kinase; carbamate kinase, amino acid kinase, arginine biosynthesis, phosphoryl group transfer, protein crystallography; HET: NLG ANP; 1.5A {Escherichia coli} SCOP: c.73.1.2 PDB: 1gsj_A* 1oh9_A* 1oha_A* 1ohb_A* 2wxb_A 2x2w_A* 3t7b_A*	Back alignment and structure

>3zzh_A Acetylglutamate kinase; transferase, arginine biosynthesis; HET: ARG NLG; 2.10A {Saccharomyces cerevisiae} PDB: 3zzg_A 3zzf_A*	Back alignment and structure

>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>3ll9_A Isopentenyl phosphate kinase; mevalonate biosynthesis isoprenoid, transferase; HET: ADP; 2.15A {Methanothermobacter thermautotrophicusorganism_taxid}	Back alignment and structure

>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans}	Back alignment and structure

>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID}	Back alignment and structure

>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti}	Back alignment and structure

>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis}	Back alignment and structure

>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1	Back alignment and structure

>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A*	Back alignment and structure

>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis}	Back alignment and structure

>3k4o_A Isopentenyl phosphate kinase; small molecule kinase, ATP-binding, transferase, methanocald jannaschii, isopentenyl monophosphate; 2.05A {Methanocaldococcus jannaschii} PDB: 3k4y_A* 3k52_A* 3k56_A*	Back alignment and structure

>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium}	Back alignment and structure

>3l86_A Acetylglutamate kinase; ARGB, amino-acid biosynthesis, arginine biosynthesi binding, nucleotide-binding, transferase; HET: ADP NLG; 2.06A {Streptococcus mutans}	Back alignment and structure

>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus}	Back alignment and structure

>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A	Back alignment and structure

>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A*	Back alignment and structure

>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A*	Back alignment and structure

>2we5_A Carbamate kinase 1; arginine catabolism, arginine metabolism, ATP synthesys, open alpha/beta sheet, phosphotransferase, transferase; HET: ADP; 1.39A {Enterococcus faecalis} PDB: 1b7b_A 2we4_A*	Back alignment and structure

>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis}	Back alignment and structure

>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A*	Back alignment and structure

>2j4j_A Uridylate kinase; transferase, nucleoside monophosphate kinase, UMP kinase, aspartokinase fold, pyrimidine nucleotide synthesis; HET: U5P ACP 4TC; 2.1A {Sulfolobus solfataricus} PDB: 2j4k_A* 2j4l_A*	Back alignment and structure

>2ako_A Glutamate 5-kinase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: ADP; 2.20A {Campylobacter jejuni} SCOP: c.73.1.3	Back alignment and structure

>3kzf_A Carbamate kinase; arginine dihydrolase pathway, giardia LAMB target, transferase; 3.00A {Giardia lamblia atcc 50803}	Back alignment and structure

>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis}	Back alignment and structure

>3ll5_A Gamma-glutamyl kinase related protein; alternate mevalonate pathway, isopentenyl phsophate kinase, beta-alpha sandwich fold; HET: MSE ADP IPE ATP IP8; 1.99A {Thermoplasma acidophilum} PDB: 3lkk_A*	Back alignment and structure

>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.80A {Aeropyrum pernix}	Back alignment and structure

>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A*	Back alignment and structure

>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis}	Back alignment and structure

>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum}	Back alignment and structure

>2ij9_A Uridylate kinase; structural genomics, protein structure initiative, P nysgxrc; 2.90A {Archaeoglobus fulgidus} SCOP: c.73.1.3	Back alignment and structure

>3d40_A FOMA protein; fosfomycin, antibiotic resistance, kinase, phosphoryl transfer, transferase; 1.53A {Streptomyces wedmorensis} PDB: 3d41_A* 3qun_A* 3quo_A* 3qur_A* 3qvf_A* 3qvh_A*	Back alignment and structure

>1e19_A Carbamate kinase-like carbamoylphosphate synthetase; transferase, hyperthermophiles, ADP site, phosphoryl group transfer; HET: ADP; 1.5A {Pyrococcus furiosus} SCOP: c.73.1.1	Back alignment and structure

>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5	Back alignment and structure

>4a7w_A Uridylate kinase; transferase; HET: GTP; 1.80A {Helicobacter pylori} PDB: 4a7x_A*	Back alignment and structure

>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A*	Back alignment and structure

>2brx_A Uridylate kinase; UMP kinase, amino acid kinase, phosphoryl group transfer, pyrimidine biosynthesis, transferase; 2.40A {Pyrococcus furiosus} SCOP: c.73.1.3 PDB: 2ji5_A* 2bmu_A* 2bri_A*	Back alignment and structure

>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A	Back alignment and structure

>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A*	Back alignment and structure

>1z9d_A Uridylate kinase, UK, UMP kinase; structural genomics, protein structure initiative, NYSGXRC, PYRH, putative uridylate kinase, PSI; 2.80A {Streptococcus pyogenes} SCOP: c.73.1.3	Back alignment and structure

>4axs_A Carbamate kinase; oxidoreductase; 2.50A {Mycoplasma penetrans}	Back alignment and structure

>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12}	Back alignment and structure

>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3	Back alignment and structure

>2ogx_B Molybdenum storage protein subunit beta; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii}	Back alignment and structure

>1ybd_A Uridylate kinase; alpha/beta/alpha fold, hexamer, structural genomics, structure initiative, PSI; 2.60A {Neisseria meningitidis} SCOP: c.73.1.3	Back alignment and structure

>2ogx_A Molybdenum storage protein subunit alpha; open alpha/beta structure, metal binding protein; HET: ATP; 1.60A {Azotobacter vinelandii}	Back alignment and structure

>3ek6_A Uridylate kinase; UMPK unique GTP B site, allosteric regulation, ATP-binding, nucleotid binding, pyrimidine biosynthesis, transferase; 2.34A {Xanthomonas campestris PV} SCOP: c.73.1.0 PDB: 3ek5_A	Back alignment and structure

>2va1_A Uridylate kinase; UMPK, transferase, pyrimidine biosynthesis, amino acid kinase family; 2.50A {Ureaplasma parvum}	Back alignment and structure

>2a1f_A Uridylate kinase; PYRH, structural genomics, PSI, protein ST initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.10A {Haemophilus influenzae} SCOP: c.73.1.3 PDB: 2bne_A* 2bnf_A* 2v4y_A* 2bnd_A*	Back alignment and structure

>3nwy_A Uridylate kinase; allosterically activated form, AAK fold, UMP kinase, transfe; HET: GTP UDP; 2.54A {Mycobacterium tuberculosis}	Back alignment and structure

>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A*	Back alignment and structure

>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A*	Back alignment and structure

>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus}	Back alignment and structure

>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1	Back alignment and structure

>2jjx_A Uridylate kinase, UMP kinase; structural genomics, pyrimidine biosynthesis, ATP-binding, nucleotide-binding, OPPF, PYRH, cytoplasm; HET: ATP; 2.82A {Bacillus anthracis}	Back alignment and structure

>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A	Back alignment and structure

>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A	Back alignment and structure

>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8	Back alignment and structure

>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis}	Back alignment and structure

>2j0w_A Lysine-sensitive aspartokinase 3; feedback inhibition, allosteric regulation, ACT domain, transferase, amino acid biosynthesis; HET: ADP; 2.5A {Escherichia coli} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 PDB: 2j0x_A*	Back alignment and structure

>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10	Back alignment and structure

>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens}	Back alignment and structure

>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii}	Back alignment and structure

>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum}	Back alignment and structure

>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea}	Back alignment and structure

>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A	Back alignment and structure

>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A*	Back alignment and structure

>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A*	Back alignment and structure

>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A*	Back alignment and structure

>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A*	Back alignment and structure

>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A*	Back alignment and structure

>4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A*	Back alignment and structure

>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens}	Back alignment and structure

>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A	Back alignment and structure

>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A*	Back alignment and structure

>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A*	Back alignment and structure

>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A*	Back alignment and structure

>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A*	Back alignment and structure

>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A	Back alignment and structure

>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A*	Back alignment and structure

>4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens}	Back alignment and structure

>1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4	Back alignment and structure

>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A	Back alignment and structure

>4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A*	Back alignment and structure

>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A*	Back alignment and structure

>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		366
d2bufa1		300	c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Ps	1e-11
d1qsra_		162	d.108.1.1 (A:) Catalytic domain of GCN5 histone ac	2e-11
d2gana1		182	d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P	4e-11
d2btya1		282	c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Th	6e-11
d2ap9a1		291	c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {My	7e-11
d1i12a_		157	d.108.1.1 (A:) Glucosamine-phosphate N-acetyltrans	8e-11
d1n71a_		180	d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera	1e-10
d1ygha_		164	d.108.1.1 (A:) Catalytic domain of GCN5 histone ac	1e-10
d1r57a_		102	d.108.1.1 (A:) Hypothetical protein SA2309 {Staphy	1e-10
d1yx0a1		151	d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bac	1e-09
d1z4ra1		162	d.108.1.1 (A:497-658) Catalytic domain of GCN5 his	2e-09
d2hv2a2		285	d.108.1.10 (A:2-286) Hypothetical protein EF1021 {	5e-09
d1gs5a_		258	c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escheri	1e-08
d1sqha_		297	d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr	2e-08
d1y9ka1		152	d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillu	3e-08
d2i00a2		291	d.108.1.10 (A:10-300) Putative acetyltransferase E	8e-08
d1y9wa1		140	d.108.1.1 (A:1-140) Probable acetyltransferase BC2	1e-07
d1vkca_		149	d.108.1.1 (A:) Putative acetyltransferase PF0028 {	2e-07
d2aj6a1		118	d.108.1.1 (A:1-118) Hypothetical protein MW0638 {S	3e-07
d1m4ia_		181	d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransfera	3e-07
d1z4ea1		150	d.108.1.1 (A:4-153) Transcriptional regulator BH19	1e-06
d2fiaa1		157	d.108.1.1 (A:1-157) Probable acetyltransferase EF1	1e-06
d2i6ca1		160	d.108.1.1 (A:1001-1160) Putative acetyltransferase	1e-06
d2g3aa1		137	d.108.1.1 (A:1-137) Probable acetyltransferase Atu	4e-06
d1p0ha_		308	d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter	5e-05
d1b7ba_		307	c.73.1.1 (A:) Carbamate kinase {Enterococcus faeci	1e-04
d1u6ma_		189	d.108.1.1 (A:) Putative acetyltransferase EF0945 {	1e-04
d1ghea_		170	d.108.1.1 (A:) Tabtoxin resistance protein {Pseudo	2e-04
d1cjwa_		166	d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep	3e-04
d1tiqa_		173	d.108.1.1 (A:) Protease synthase and sporulation n	3e-04
d1s3za_		147	d.108.1.1 (A:) Aminoglycoside N-acetyltransferase	7e-04
d1ufha_		155	d.108.1.1 (A:) Putative acetyltransferase YycN {Ba	8e-04

>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]} Length = 300	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: N-acetyl-l-glutamate kinase
domain: N-acetyl-l-glutamate kinase
species: Pseudomonas aeruginosa [TaxId: 287]

 Score = 62.5 bits (151), Expect = 1e-11
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 156 GYLSELAAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLY 205
           G L ++  A    + GV   H++DG +   +LLE+F   G+GT++++   
Sbjct: 250 GMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISNRKR 299

PyMOL of d2bufa1

>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Length = 162	Back information, alignment and structure

>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182	Back information, alignment and structure

>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]} Length = 282	Back information, alignment and structure

>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 291	Back information, alignment and structure

>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 157	Back information, alignment and structure

>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180	Back information, alignment and structure

>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164	Back information, alignment and structure

>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Length = 102	Back information, alignment and structure

>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Length = 151	Back information, alignment and structure

>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Length = 285	Back information, alignment and structure

>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} Length = 258	Back information, alignment and structure

>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297	Back information, alignment and structure

>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Length = 152	Back information, alignment and structure

>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Length = 291	Back information, alignment and structure

>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Length = 140	Back information, alignment and structure

>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149	Back information, alignment and structure

>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Length = 118	Back information, alignment and structure

>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181	Back information, alignment and structure

>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Length = 150	Back information, alignment and structure

>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Length = 157	Back information, alignment and structure

>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Length = 160	Back information, alignment and structure

>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Length = 137	Back information, alignment and structure

>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308	Back information, alignment and structure

>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]} Length = 307	Back information, alignment and structure

>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Length = 189	Back information, alignment and structure

>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Length = 170	Back information, alignment and structure

>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166	Back information, alignment and structure

>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Length = 173	Back information, alignment and structure

>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Length = 147	Back information, alignment and structure

>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Length = 155	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		366
d2bufa1		300	N-acetyl-l-glutamate kinase {Pseudomonas aeruginos	99.85
d2btya1		282	N-acetyl-l-glutamate kinase {Thermotoga maritima [	99.79
d2fiwa1		156	Probable N-acetyltransferase RPA1999 {Rhodopseudom	99.77
d2ap9a1		291	N-acetyl-l-glutamate kinase {Mycobacterium tubercu	99.76
d1tiqa_		173	Protease synthase and sporulation negative regulat	99.74
d1yr0a1		163	Phosphinothricin acetyltransferase {Agrobacterium	99.73
d2fiaa1		157	Probable acetyltransferase EF1919 {Enterococcus fa	99.73
d1n71a_		180	Aminoglycoside 6'-N-acetyltransferase {Enterococcu	99.73
d2i6ca1		160	Putative acetyltransferase PA4794 {Pseudomonas aer	99.73
d2fe7a1		156	Probable N-acetyltransferase PA0478 {Pseudomonas a	99.72
d1qsra_		162	Catalytic domain of GCN5 histone acetyltransferase	99.72
d1mk4a_		157	Hypothetical protein YqiY {Bacillus subtilis [TaxI	99.72
d1yvoa1		169	Hypothetical protein PA4866 {Pseudomonas aeruginos	99.71
d1ghea_		170	Tabtoxin resistance protein {Pseudomonas syringae	99.71
d1y9wa1		140	Probable acetyltransferase BC2806 {Bacillus cereus	99.7
d1yx0a1		151	Hypothetical protein YsnE {Bacillus subtilis [TaxI	99.69
d1z4ea1		150	Transcriptional regulator BH1968 {Bacillus halodur	99.68
d1vhsa_		165	Putative phosphinothricin acetyltransferase YwnH {	99.68
d1ygha_		164	Catalytic domain of GCN5 histone acetyltransferase	99.67
d1s3za_		147	Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal	99.67
d2atra1		137	Probable acetyltransferase SP0256 {Streptococcus p	99.67
d1u6ma_		189	Putative acetyltransferase EF0945 {Enterococcus fa	99.66
d1i12a_		157	Glucosamine-phosphate N-acetyltransferase GNA1 {Ba	99.66
d2ae6a1		161	Putative acetyltransferase EF0244 {Enterococcus fa	99.65
d2cy2a1		174	Probable acetyltransferase TTHA1209 {Thermus therm	99.64
d1cjwa_		166	Serotonin N-acetyltranferase {Sheep (Ovis aries) [	99.63
d1ufha_		155	Putative acetyltransferase YycN {Bacillus subtilis	99.61
d1y7ra1		133	Hypothetical protein SA2161 {Staphylococcus aureus	99.61
d2ge3a1		164	Probable acetyltransferase Atu2290 {Agrobacterium	99.6
d1y9ka1		152	IAA acetyltransferase {Bacillus cereus [TaxId: 139	99.6
d1z4ra1		162	Catalytic domain of GCN5 histone acetyltransferase	99.6
d1qsma_		150	Histone acetyltransferase HPA2 {Baker's yeast (Sac	99.6
d2b5ga1		167	Diamine acetyltransferase 1 {Human (Homo sapiens)	99.6
d2g3aa1		137	Probable acetyltransferase Atu2258 {Agrobacterium	99.59
d2fl4a1		146	Probable spermine/spermidine acetyltransferase EF1	99.59
d2euia1		153	Probable acetyltransferase PA4026 {Pseudomonas aer	99.58
d2jdca1		145	Probable acetyltransferase YitI {Bacillus lichenif	99.57
d2beia1		167	Diamine acetyltransferase 2 {Human (Homo sapiens)	99.56
d1yvka1		152	Hypothetical protein YvbK (BSu33890) {Bacillus sub	99.55
d1q2ya_		140	Probable acetyltransferase YjcF {Bacillus subtilis	99.55
d1b7ba_		307	Carbamate kinase {Enterococcus faecium [TaxId: 135	99.55
d1wwza1		157	Hypothetical protein PH1933 {Pyrococcus horikoshii	99.54
d1vkca_		149	Putative acetyltransferase PF0028 {Pyrococcus furi	99.54
d2gana1		182	Hypothetical protein PH0736 {Pyrococcus horikoshii	99.53
d1bo4a_		137	Aminoglycoside 3-N-acetyltransferase {Serratia mar	99.48
d2aj6a1		118	Hypothetical protein MW0638 {Staphylococcus aureus	99.45
d1e19a_		313	Carbamate kinase {Archaeon Pyrococcus furiosus [Ta	99.42
d2ozga2		283	Putative acetyltransferase Ava4977 {Anabaena varia	99.41
d1xeba_		149	Hypothetical protein PA0115 {Pseudomonas aeruginos	99.37
d1p0ha_		308	Mycothiol synthase MshD {Mycobacterium tuberculosi	99.37
d2i00a2		291	Putative acetyltransferase EF2353 {Enterococcus fa	99.35
d2hv2a2		285	Hypothetical protein EF1021 {Enterococcus faecalis	99.34
d1yk3a1		198	Hypothetical protein Rv1347c/MT1389 {Mycobacterium	99.33
d1nsla_		180	Probable acetyltransferase YdaF {Bacillus subtilis	99.32
d1s7ka1		174	L7/L12-Ribosomal-protein-serine acetyltransferase	99.3
d1yrea1		183	Hypothetical protein PA3270 {Pseudomonas aeruginos	99.3
d1m4ia_		181	Aminoglycoside 2'-N-acetyltransferase {Mycobacteri	99.26
d2fcka1		178	Putative ribosomal-protein-serine acetyltransferas	99.24
d2fsra1		164	Probable acetyltranferase Atu2435 {Agrobacterium t	99.2
d1sqha_		297	Hypothetical protein cg14615-pa {Fruit fly (Drosop	99.18
d1r57a_		102	Hypothetical protein SA2309 {Staphylococcus aureus	99.12
d1gs5a_		258	N-acetyl-l-glutamate kinase {Escherichia coli [Tax	99.07
d1p0ha_		308	Mycothiol synthase MshD {Mycobacterium tuberculosi	98.7
d2brxa1		225	Uridylate kinase PyrH {Pyrococcus furiosus [TaxId:	98.41
d1ro5a_		197	Autoinducer synthesis protein LasI {Pseudomonas ae	98.23
d2akoa1		250	Glutamate 5-kinase {Campylobacter jejuni [TaxId: 1	98.13
d2ij9a1		219	Uridylate kinase PyrH {Archaeoglobus fulgidus [Tax	97.79
d1ylea1		338	Arginine N-succinyltransferase, alpha chain, AstA	97.75
d1kzfa_		210	Acyl-homoserinelactone synthase EsaI {Pantoea stew	97.62
d1xmta_		95	Hypothetical protein AT1g77540 {Thale cress (Arabi	97.52
d2a1fa1		236	Uridylate kinase PyrH {Haemophilus influenzae [Tax	97.23
d1lrza3		182	Methicillin resistance protein FemA {Staphylococcu	97.04
d1ybda1		236	Uridylate kinase PyrH {Neisseria meningitidis [Tax	96.41
d1ne9a2		171	Peptidyltransferase FemX {Weissella viridescens [T	95.54
d1boba_		315	Histone acetyltransferase HAT1 {Baker's yeast (Sac	95.38
d1z9da1		238	Uridylate kinase PyrH {Streptococcus pyogenes [Tax	94.15
d1iica2		237	N-myristoyl transferase, NMT {Baker's yeast (Sacch	94.08
d1iyka1		165	N-myristoyl transferase, NMT {Yeast (Candida albic	94.01
d1rxta1		141	N-myristoyl transferase, NMT {Human (Homo sapiens)	93.72
d1iyka2		227	N-myristoyl transferase, NMT {Yeast (Candida albic	93.44
d1iica1		185	N-myristoyl transferase, NMT {Baker's yeast (Sacch	93.42
d2giva1		271	Probable histone acetyltransferase MYST1 {Human (H	92.79
d2ozua1		270	Histone acetyltransferase MYST3 {Human (Homo sapie	92.07
d2d4pa1		130	Hypothetical protein TTHA1254 {Thermus thermophilu	90.99
d1fy7a_		273	Histone acetyltransferase ESA1 {Baker's yeast (Sac	90.78
d1rxta2		201	N-myristoyl transferase, NMT {Human (Homo sapiens)	83.62
d2ozga2		283	Putative acetyltransferase Ava4977 {Anabaena varia	80.54

>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Carbamate kinase-like
superfamily: Carbamate kinase-like
family: N-acetyl-l-glutamate kinase
domain: N-acetyl-l-glutamate kinase
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.85  E-value=5.5e-22  Score=188.64  Aligned_cols=119  Identities=25%  Similarity=0.423  Sum_probs=106.8

Q ss_pred             ccccCCCccc---------cccccCCHHHHHHHHHHHcCCceEEEEeCCc-ccCCCCcccccCCHHHHHHHHHHhhhhhH
Q 017739           12 VNVDFESLIL---------CAFANFSTYEVATACALAIEADKLICIIDGP-ILDESGHLIRFLTLQEADSLIRQRVKQSE   81 (366)
Q Consensus        12 ~~~~~~~~~~---------ge~~N~~~~~vA~~~A~~l~AdKli~l~~~~-~~~~~g~l~~~l~~~~a~~~l~~~~~~~~   81 (366)
                      .-++.+.||+         |+.||+|+|++|+++|.+|+|||||||||.+ ++|.+|.++++++.+++++++.+..    
T Consensus       171 ~ll~~g~Ipvis~~~~~~~G~~~nin~D~~Aa~lA~~L~AdkLI~Ltdv~Gv~~~~g~~~~~l~~~~~~~li~~~~----  246 (300)
T d2bufa1         171 MLVKGDFIPVIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGT----  246 (300)
T ss_dssp             HHHHTTCEEEEEEEEECTTSCEEECCHHHHHHHHHHHHTCSEEEEEESSSCCBCTTSCBCCEECHHHHHHHHHTTC----
T ss_pred             HHhcCCCeEEecccccCcccchhcccHHHHHHHHHHHcCCCeEEEEcCCCccccCCCcchhhccHHHHHHHHHcCC----
Confidence            3467788887         9999999999999999999999999999998 7789999999999999999985422    


Q ss_pred             HHHhHHHHhhccccccccCCCCCCccccCCCCCcccccccccccCCCccCCCCCCcccccccccccchhhhhcccchHHH
Q 017739           82 IAANYVKAVAEEDITCFGHSDSIGSVYSSQNGKTFSERRIATFNNGVGFDNGNGLWSSEQGFAIGGQERLSRLNGYLSEL  161 (366)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~l  161 (366)
                                      .                                 .+ |                     |.++|
T Consensus       247 ----------------i---------------------------------~g-G---------------------M~~Kl  255 (300)
T d2bufa1         247 ----------------I---------------------------------YG-G---------------------MLPKI  255 (300)
T ss_dssp             ----------------S---------------------------------CT-T---------------------HHHHH
T ss_pred             ----------------c---------------------------------Cc-h---------------------HHHHH
Confidence                            0                                 11 2                     89999


Q ss_pred             HHHHHHHhcCCCeEEecccccCchhhhhhhcccCccceeecccc
Q 017739          162 AAAAFVCRRGVQRVHLLDGTIGGVLLLELFKRDGMGTMVASDLY  205 (366)
Q Consensus       162 ~~a~~a~~~GV~rvhlvd~~~~g~ll~Elft~~G~GTmI~~~~~  205 (366)
                      .+|..||+.||+||||+|++.+++|+.||||++|+||+|+++.|
T Consensus       256 ~aa~~a~~~Gv~rv~Ii~g~~~~~ll~eLft~~g~GT~I~~~~~  299 (300)
T d2bufa1         256 RCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISNRKR  299 (300)
T ss_dssp             HHHHHHHHTTCSEEEEEETTSTTHHHHHHSSTTCCSEEEECCCC
T ss_pred             HHHHHHHHcCCCEEEEecCCCCCHHHHHHcCCCCceeEEecCCC
Confidence            99999999999999999999999999999999999999998765

PyMOL of d2bufa1

>d2btya1 c.73.1.2 (A:1-282) N-acetyl-l-glutamate kinase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]}	Back information, alignment and structure

>d2ap9a1 c.73.1.2 (A:6-296) N-acetyl-l-glutamate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}	Back information, alignment and structure

>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}	Back information, alignment and structure

>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]}	Back information, alignment and structure

>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]}	Back information, alignment and structure

>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1b7ba_ c.73.1.1 (A:) Carbamate kinase {Enterococcus faecium [TaxId: 1352]}	Back information, alignment and structure

>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1e19a_ c.73.1.1 (A:) Carbamate kinase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1gs5a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2brxa1 c.73.1.3 (A:1-225) Uridylate kinase PyrH {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2akoa1 c.73.1.3 (A:2-251) Glutamate 5-kinase {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d2ij9a1 c.73.1.3 (A:1-219) Uridylate kinase PyrH {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]}	Back information, alignment and structure

>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2a1fa1 c.73.1.3 (A:2-237) Uridylate kinase PyrH {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1ybda1 c.73.1.3 (A:6-241) Uridylate kinase PyrH {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}	Back information, alignment and structure

>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1z9da1 c.73.1.3 (A:4-241) Uridylate kinase PyrH {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1rxta2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure