Citrus Sinensis ID: 017808
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 365 | 2.2.26 [Sep-21-2011] | |||||||
| Q9SKX5 | 490 | Probable polyamine oxidas | yes | no | 1.0 | 0.744 | 0.819 | 0.0 | |
| Q9LYT1 | 488 | Polyamine oxidase 3 OS=Ar | no | no | 0.986 | 0.737 | 0.798 | 1e-169 | |
| Q8H191 | 497 | Probable polyamine oxidas | no | no | 1.0 | 0.734 | 0.606 | 1e-130 | |
| Q6YYZ1 | 763 | Lysine-specific histone d | no | no | 0.887 | 0.424 | 0.339 | 3e-39 | |
| Q9LID0 | 746 | Lysine-specific histone d | no | no | 0.780 | 0.382 | 0.360 | 2e-38 | |
| Q6ZQ88 | 853 | Lysine-specific histone d | yes | no | 0.734 | 0.314 | 0.343 | 1e-35 | |
| O60341 | 852 | Lysine-specific histone d | yes | no | 0.734 | 0.314 | 0.343 | 1e-35 | |
| Q9CAE3 | 789 | Lysine-specific histone d | no | no | 0.873 | 0.404 | 0.334 | 2e-35 | |
| Q6Z690 | 849 | Lysine-specific histone d | no | no | 0.915 | 0.393 | 0.307 | 8e-35 | |
| Q8VXV7 | 844 | Lysine-specific histone d | no | no | 0.901 | 0.389 | 0.323 | 2e-32 |
| >sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 636 bits (1641), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 299/365 (81%), Positives = 330/365 (90%)
Query: 1 MDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHK 60
MDGNQVPQELVT++G FE IL+E +KVR+E D D+SI +A SIVF R+PELRLEGLAH
Sbjct: 126 MDGNQVPQELVTQIGVTFERILEEINKVRDEQDADISISQAFSIVFSRKPELRLEGLAHN 185
Query: 61 VLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHR 120
VLQWY+CRMEGWFAADAETIS K WD+EELLPGGHGLMVRGY PVINTLAKGLDIR+GHR
Sbjct: 186 VLQWYVCRMEGWFAADAETISAKCWDQEELLPGGHGLMVRGYRPVINTLAKGLDIRVGHR 245
Query: 121 VTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVG 180
VTKI R Y GVKVT E G+TFVADA V+AVPLGVLK+ TIKFEP+LP+WK+ AI+DLGVG
Sbjct: 246 VTKIVRRYNGVKVTTENGQTFVADAAVIAVPLGVLKSGTIKFEPKLPEWKQEAINDLGVG 305
Query: 181 IENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKM 240
IENKII+HF+KVFWP VEFLGVV++TSYGCSYFLNLHKATGH VLVYMPAGQLA+DIEKM
Sbjct: 306 IENKIILHFEKVFWPKVEFLGVVAETSYGCSYFLNLHKATGHPVLVYMPAGQLAKDIEKM 365
Query: 241 SDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPV 300
SDEAAANFA QL++ILPDA P+QYLVS WG+D NS+GSYSYD VGK HDLYERLR+PV
Sbjct: 366 SDEAAANFAVLQLQRILPDALPPVQYLVSRWGSDVNSMGSYSYDIVGKPHDLYERLRVPV 425
Query: 301 DNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEETPISVPF 360
DNLFFAGEATS S+PGSVHGA+STGLMAAEDCRMRVLERYGELDLFQPVMGEE P SVP
Sbjct: 426 DNLFFAGEATSSSFPGSVHGAYSTGLMAAEDCRMRVLERYGELDLFQPVMGEEGPASVPL 485
Query: 361 LISRL 365
LISRL
Sbjct: 486 LISRL 490
|
Flavoenzyme that catalyzes the oxidation of the secondary amino group of polyamines. Arabidopsis thaliana (taxid: 3702) EC: 1EC: .EC: 5EC: .EC: 3EC: .EC: - |
| >sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9CAE3|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 365 | ||||||
| 255561152 | 491 | amine oxidase, putative [Ricinus communi | 1.0 | 0.743 | 0.868 | 0.0 | |
| 224082614 | 482 | predicted protein [Populus trichocarpa] | 1.0 | 0.757 | 0.868 | 0.0 | |
| 356567482 | 490 | PREDICTED: probable polyamine oxidase 2- | 1.0 | 0.744 | 0.830 | 0.0 | |
| 224066525 | 513 | predicted protein [Populus trichocarpa] | 1.0 | 0.711 | 0.811 | 0.0 | |
| 225446763 | 490 | PREDICTED: probable polyamine oxidase 2 | 1.0 | 0.744 | 0.824 | 0.0 | |
| 15224204 | 490 | putative polyamine oxidase 2 [Arabidopsi | 1.0 | 0.744 | 0.819 | 1e-180 | |
| 297824269 | 490 | ATPAO2 [Arabidopsis lyrata subsp. lyrata | 1.0 | 0.744 | 0.819 | 1e-179 | |
| 18650598 | 490 | At2g43020/MFL8.12 [Arabidopsis thaliana] | 1.0 | 0.744 | 0.816 | 1e-179 | |
| 449463595 | 489 | PREDICTED: probable polyamine oxidase 2- | 0.997 | 0.744 | 0.8 | 1e-179 | |
| 356526932 | 490 | PREDICTED: probable polyamine oxidase 2- | 1.0 | 0.744 | 0.805 | 1e-179 |
| >gi|255561152|ref|XP_002521588.1| amine oxidase, putative [Ricinus communis] gi|223539266|gb|EEF40859.1| amine oxidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 669 bits (1726), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 317/365 (86%), Positives = 339/365 (92%)
Query: 1 MDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHK 60
MDGNQVPQELV++VGE FE ILKET+KVR+E+ EDMSI A SIVF+RRPELRLEGLAHK
Sbjct: 127 MDGNQVPQELVSEVGETFEIILKETEKVRQEYSEDMSISNAFSIVFERRPELRLEGLAHK 186
Query: 61 VLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHR 120
VLQWYLCRMEGWFAADA+TISLK WD+EELLPGGHGLMVRGYLPVINTLAKGLDIRLGHR
Sbjct: 187 VLQWYLCRMEGWFAADADTISLKCWDQEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHR 246
Query: 121 VTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVG 180
VTKI R + GVKVT E G+TF+ADA V+AVPLGVLK+RTI FEPRLPDWKE AI DLGVG
Sbjct: 247 VTKIVRRHNGVKVTTEDGRTFMADAAVIAVPLGVLKSRTITFEPRLPDWKEEAIKDLGVG 306
Query: 181 IENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKM 240
IENKI++HFDKVFWPNVEFLGVVS+TSYGCSYFLNLHKATGH VLVYMPAGQLA+DIEKM
Sbjct: 307 IENKIVLHFDKVFWPNVEFLGVVSETSYGCSYFLNLHKATGHSVLVYMPAGQLAKDIEKM 366
Query: 241 SDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPV 300
SDEAAANFAF QLKKILP+AS PIQYLVS WG+D NSLGSYSYDTVGK HDLYERLR+PV
Sbjct: 367 SDEAAANFAFMQLKKILPEASDPIQYLVSRWGSDVNSLGSYSYDTVGKPHDLYERLRVPV 426
Query: 301 DNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEETPISVPF 360
DNLFFAGEATS SYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEE +SVP
Sbjct: 427 DNLFFAGEATSASYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEEAAVSVPL 486
Query: 361 LISRL 365
LISR+
Sbjct: 487 LISRM 491
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224082614|ref|XP_002306765.1| predicted protein [Populus trichocarpa] gi|222856214|gb|EEE93761.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356567482|ref|XP_003551948.1| PREDICTED: probable polyamine oxidase 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224066525|ref|XP_002302123.1| predicted protein [Populus trichocarpa] gi|222843849|gb|EEE81396.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225446763|ref|XP_002282970.1| PREDICTED: probable polyamine oxidase 2 [Vitis vinifera] gi|302143503|emb|CBI22064.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15224204|ref|NP_181830.1| putative polyamine oxidase 2 [Arabidopsis thaliana] gi|75206576|sp|Q9SKX5.1|PAO2_ARATH RecName: Full=Probable polyamine oxidase 2; Short=AtPAO2; AltName: Full=Amine oxidase 1 gi|29468124|gb|AAO85404.1|AF364952_1 putative amine oxidase 1 [Arabidopsis thaliana] gi|4531444|gb|AAD22129.1| putative amine oxidase [Arabidopsis thaliana] gi|115311507|gb|ABI93934.1| At2g43020 [Arabidopsis thaliana] gi|330255105|gb|AEC10199.1| putative polyamine oxidase 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297824269|ref|XP_002880017.1| ATPAO2 [Arabidopsis lyrata subsp. lyrata] gi|297325856|gb|EFH56276.1| ATPAO2 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18650598|gb|AAL75899.1| At2g43020/MFL8.12 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449463595|ref|XP_004149519.1| PREDICTED: probable polyamine oxidase 2-like [Cucumis sativus] gi|449505802|ref|XP_004162572.1| PREDICTED: probable polyamine oxidase 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356526932|ref|XP_003532069.1| PREDICTED: probable polyamine oxidase 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 365 | ||||||
| TAIR|locus:2053723 | 490 | PAO2 "AT2G43020" [Arabidopsis | 1.0 | 0.744 | 0.819 | 4.3e-164 | |
| TAIR|locus:2077670 | 488 | PAO3 "polyamine oxidase 3" [Ar | 0.986 | 0.737 | 0.798 | 7.2e-155 | |
| TAIR|locus:2018571 | 497 | PAO4 "polyamine oxidase 4" [Ar | 1.0 | 0.734 | 0.606 | 1.8e-119 | |
| TAIR|locus:2130454 | 1628 | LDL3 "LSD1-like 3" [Arabidopsi | 0.838 | 0.187 | 0.353 | 1.5e-43 | |
| TAIR|locus:2091501 | 746 | LDL2 "LSD1-like2" [Arabidopsis | 0.920 | 0.450 | 0.353 | 1.2e-37 | |
| UNIPROTKB|F1LVQ3 | 735 | Kdm1 "Protein Kdm1" [Rattus no | 0.830 | 0.412 | 0.334 | 1.1e-36 | |
| UNIPROTKB|F1NDF4 | 755 | KDM1A "Uncharacterized protein | 0.830 | 0.401 | 0.334 | 1.3e-36 | |
| RGD|1562975 | 755 | Kdm1a "lysine (K)-specific dem | 0.830 | 0.401 | 0.334 | 1.3e-36 | |
| UNIPROTKB|F1STX7 | 853 | KDM1A "Uncharacterized protein | 0.893 | 0.382 | 0.326 | 2.1e-36 | |
| UNIPROTKB|F1STX8 | 873 | KDM1A "Uncharacterized protein | 0.893 | 0.373 | 0.326 | 2.3e-36 |
| TAIR|locus:2053723 PAO2 "AT2G43020" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1597 (567.2 bits), Expect = 4.3e-164, P = 4.3e-164
Identities = 299/365 (81%), Positives = 330/365 (90%)
Query: 1 MDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHK 60
MDGNQVPQELVT++G FE IL+E +KVR+E D D+SI +A SIVF R+PELRLEGLAH
Sbjct: 126 MDGNQVPQELVTQIGVTFERILEEINKVRDEQDADISISQAFSIVFSRKPELRLEGLAHN 185
Query: 61 VLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHR 120
VLQWY+CRMEGWFAADAETIS K WD+EELLPGGHGLMVRGY PVINTLAKGLDIR+GHR
Sbjct: 186 VLQWYVCRMEGWFAADAETISAKCWDQEELLPGGHGLMVRGYRPVINTLAKGLDIRVGHR 245
Query: 121 VTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVG 180
VTKI R Y GVKVT E G+TFVADA V+AVPLGVLK+ TIKFEP+LP+WK+ AI+DLGVG
Sbjct: 246 VTKIVRRYNGVKVTTENGQTFVADAAVIAVPLGVLKSGTIKFEPKLPEWKQEAINDLGVG 305
Query: 181 IENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKM 240
IENKII+HF+KVFWP VEFLGVV++TSYGCSYFLNLHKATGH VLVYMPAGQLA+DIEKM
Sbjct: 306 IENKIILHFEKVFWPKVEFLGVVAETSYGCSYFLNLHKATGHPVLVYMPAGQLAKDIEKM 365
Query: 241 SDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPV 300
SDEAAANFA QL++ILPDA P+QYLVS WG+D NS+GSYSYD VGK HDLYERLR+PV
Sbjct: 366 SDEAAANFAVLQLQRILPDALPPVQYLVSRWGSDVNSMGSYSYDIVGKPHDLYERLRVPV 425
Query: 301 DNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVLERYGELDLFQPVMGEETPISVPF 360
DNLFFAGEATS S+PGSVHGA+STGLMAAEDCRMRVLERYGELDLFQPVMGEE P SVP
Sbjct: 426 DNLFFAGEATSSSFPGSVHGAYSTGLMAAEDCRMRVLERYGELDLFQPVMGEEGPASVPL 485
Query: 361 LISRL 365
LISRL
Sbjct: 486 LISRL 490
|
|
| TAIR|locus:2077670 PAO3 "polyamine oxidase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018571 PAO4 "polyamine oxidase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130454 LDL3 "LSD1-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091501 LDL2 "LSD1-like2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LVQ3 Kdm1 "Protein Kdm1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDF4 KDM1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1562975 Kdm1a "lysine (K)-specific demethylase 1A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STX7 KDM1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STX8 KDM1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9SKX5 | PAO2_ARATH | 1, ., 5, ., 3, ., - | 0.8191 | 1.0 | 0.7448 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.5.3 | 0.963 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 365 | |||
| PLN02268 | 435 | PLN02268, PLN02268, probable polyamine oxidase | 0.0 | |
| pfam01593 | 444 | pfam01593, Amino_oxidase, Flavin containing amine | 5e-64 | |
| PLN02976 | 1713 | PLN02976, PLN02976, amine oxidase | 2e-58 | |
| PLN02529 | 738 | PLN02529, PLN02529, lysine-specific histone demeth | 5e-46 | |
| PLN03000 | 881 | PLN03000, PLN03000, amine oxidase | 6e-41 | |
| PLN02328 | 808 | PLN02328, PLN02328, lysine-specific histone demeth | 6e-38 | |
| PLN02676 | 487 | PLN02676, PLN02676, polyamine oxidase | 1e-34 | |
| PLN02568 | 539 | PLN02568, PLN02568, polyamine oxidase | 2e-31 | |
| COG1231 | 450 | COG1231, COG1231, Monoamine oxidase [Amino acid tr | 1e-25 | |
| COG1232 | 444 | COG1232, HemY, Protoporphyrinogen oxidase [Coenzym | 4e-13 | |
| PRK07233 | 434 | PRK07233, PRK07233, hypothetical protein; Provisio | 6e-08 | |
| PLN02612 | 567 | PLN02612, PLN02612, phytoene desaturase | 4e-06 | |
| TIGR02731 | 453 | TIGR02731, phytoene_desat, phytoene desaturase | 6e-05 | |
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 2e-04 | |
| PRK11883 | 451 | PRK11883, PRK11883, protoporphyrinogen oxidase; Re | 3e-04 | |
| PRK06416 | 462 | PRK06416, PRK06416, dihydrolipoamide dehydrogenase | 7e-04 | |
| TIGR03467 | 411 | TIGR03467, HpnE, squalene-associated FAD-dependent | 0.003 |
| >gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase | Back alignment and domain information |
|---|
Score = 705 bits (1821), Expect = 0.0
Identities = 277/337 (82%), Positives = 304/337 (90%)
Query: 1 MDGNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHK 60
MDGNQVPQELVTKVGE FE IL+ET+KVR+EH+EDMS+ +AISIV +R PELRLEGLAH+
Sbjct: 99 MDGNQVPQELVTKVGETFERILEETEKVRDEHEEDMSLLQAISIVLERHPELRLEGLAHE 158
Query: 61 VLQWYLCRMEGWFAADAETISLKSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHR 120
VLQWYLCRMEGWFAADA+TISLKSWD+EELL GGHGLMVRGY PVINTLAKGLDIRL HR
Sbjct: 159 VLQWYLCRMEGWFAADADTISLKSWDQEELLEGGHGLMVRGYDPVINTLAKGLDIRLNHR 218
Query: 121 VTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKFEPRLPDWKEAAIDDLGVG 180
VTKI R Y GVKVTVE G TFVADA ++AVPLGVLKA IKFEP LP+WKE AI DLGVG
Sbjct: 219 VTKIVRRYNGVKVTVEDGTTFVADAAIIAVPLGVLKANIIKFEPELPEWKEEAISDLGVG 278
Query: 181 IENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKM 240
IENKI +HFD VFWPNVEFLGVV+ TSYGCSYFLNLHKATGH VLVYMPAG+LARDIEK+
Sbjct: 279 IENKIALHFDSVFWPNVEFLGVVAPTSYGCSYFLNLHKATGHPVLVYMPAGRLARDIEKL 338
Query: 241 SDEAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPV 300
SDEAAANFA +QLKK+LPDA+ P+QYLVS WG+D NSLG YSYD VGK HDLYERLR PV
Sbjct: 339 SDEAAANFAMSQLKKMLPDATEPVQYLVSRWGSDPNSLGCYSYDLVGKPHDLYERLRAPV 398
Query: 301 DNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVL 337
DNLFFAGEATS +PGSVHGA+STG+MAAE+CRMR+L
Sbjct: 399 DNLFFAGEATSSDFPGSVHGAYSTGVMAAEECRMRLL 435
|
Length = 435 |
| >gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|215527 PLN02976, PLN02976, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|178578 PLN03000, PLN03000, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 365 | |||
| PLN02268 | 435 | probable polyamine oxidase | 100.0 | |
| PLN02976 | 1713 | amine oxidase | 100.0 | |
| PLN03000 | 881 | amine oxidase | 100.0 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 100.0 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 100.0 | |
| PLN02568 | 539 | polyamine oxidase | 100.0 | |
| PLN02676 | 487 | polyamine oxidase | 100.0 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 100.0 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 100.0 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 100.0 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 99.97 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 99.96 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 99.96 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 99.96 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 99.95 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 99.95 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 99.94 | |
| PLN02612 | 567 | phytoene desaturase | 99.94 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 99.92 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 99.92 | |
| PLN02487 | 569 | zeta-carotene desaturase | 99.88 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 99.88 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 99.88 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 99.81 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 99.8 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 99.75 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 99.73 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 99.71 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 99.14 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 99.11 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 98.99 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 98.64 | |
| PF07156 | 368 | Prenylcys_lyase: Prenylcysteine lyase; InterPro: I | 98.56 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 97.98 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 97.73 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 97.5 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 97.41 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 97.1 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 97.1 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 97.09 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 97.0 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 96.99 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.96 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 96.93 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.91 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 96.78 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 96.67 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 96.65 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 96.63 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 96.5 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 96.45 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 96.45 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 96.45 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 96.35 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 96.3 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 96.13 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 96.11 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 96.09 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 95.96 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 95.78 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 95.76 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 95.36 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 95.22 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 95.17 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 94.93 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 94.83 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 94.36 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 94.01 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 93.93 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 93.62 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 93.52 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 93.32 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 93.27 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 93.23 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 92.99 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 92.95 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 92.59 | |
| PRK05868 | 372 | hypothetical protein; Validated | 92.55 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 92.4 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 92.06 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 92.0 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 91.95 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 91.78 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 91.58 | |
| PRK06116 | 450 | glutathione reductase; Validated | 91.58 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 91.58 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 91.52 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 91.26 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 91.24 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 91.21 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 91.2 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 91.11 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 91.11 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 90.94 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 90.52 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 90.51 | |
| PLN02507 | 499 | glutathione reductase | 90.46 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 90.28 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 90.16 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 90.15 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 90.1 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 89.99 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 89.87 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 89.63 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 89.51 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 89.17 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 89.13 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 89.11 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 89.1 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 88.97 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 88.65 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 88.62 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 88.44 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 88.24 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 87.11 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 87.08 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 86.51 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 86.33 | |
| PLN02463 | 447 | lycopene beta cyclase | 86.31 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 86.3 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 86.1 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 85.8 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 85.73 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 85.68 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 85.64 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 85.54 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 85.05 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 84.84 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 84.81 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 84.73 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 84.7 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 84.58 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 84.53 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 83.8 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 83.05 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 83.03 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 82.62 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 82.33 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 81.92 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 81.59 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 81.42 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 81.34 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 80.83 | |
| PRK06370 | 463 | mercuric reductase; Validated | 80.57 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 80.43 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 80.16 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 80.02 |
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-48 Score=374.94 Aligned_cols=334 Identities=82% Similarity=1.328 Sum_probs=289.9
Q ss_pred CcccCHHHHHHHHHHHHHHHHHHHHHHhhCCCCCCHHHHHHHHHccCchhhhhhHHHHHHHHHHHhhhhhcCCCCcccCh
Q 017808 3 GNQVPQELVTKVGEAFESILKETDKVREEHDEDMSIQRAISIVFDRRPELRLEGLAHKVLQWYLCRMEGWFAADAETISL 82 (365)
Q Consensus 3 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~S~ 82 (365)
+.++|++....+...+.++.+...+.......|+|+.+++++++.+.+..+.+++.++++++++.++.++++.+++++|+
T Consensus 101 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~ 180 (435)
T PLN02268 101 GNQVPQELVTKVGETFERILEETEKVRDEHEEDMSLLQAISIVLERHPELRLEGLAHEVLQWYLCRMEGWFAADADTISL 180 (435)
T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHhccCCCcCHHHHHHHHhhhCcccccchHHHHHHHHHHHHHHHHhCCChHhCch
Confidence 45788888888888888888877765554567899999998776554333334588889988877778889999999999
Q ss_pred hccccccccCCCceeccCChHHHHHHHhccCCeecCceeEEEEecCCeeEEEEcCCcEEEcCEEEEecChhhhhcCCccc
Q 017808 83 KSWDKEELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTIKF 162 (365)
Q Consensus 83 ~~~~~~~~~~g~~~~~~gG~~~L~~~L~~~l~I~l~~~V~~I~~~~~~v~V~~~~g~~~~ad~VI~t~p~~~l~~~~i~f 162 (365)
..+.....+.|++..+.+||++|+++|+++++|++|++|++|.+.+++|.|++.+|+++.||+||+|+|++++++..+.|
T Consensus 181 ~~~~~~~~~~g~~~~~~~G~~~l~~~l~~~~~i~~~~~V~~i~~~~~~v~v~~~~g~~~~ad~VIva~P~~~l~~~~i~f 260 (435)
T PLN02268 181 KSWDQEELLEGGHGLMVRGYDPVINTLAKGLDIRLNHRVTKIVRRYNGVKVTVEDGTTFVADAAIIAVPLGVLKANIIKF 260 (435)
T ss_pred hhcCCccccCCCceeecCCHHHHHHHHhccCceeCCCeeEEEEEcCCcEEEEECCCcEEEcCEEEEecCHHHHhcCccee
Confidence 88765444566677899999999999999999999999999999999999999999889999999999999998766889
Q ss_pred cCCCcHHHHHHHhhcCCccccEEEEEcCCCCCCCCCcceeecCCCCceeEeeeccCCCCCceEEEEecchhhHHHhcCCH
Q 017808 163 EPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSD 242 (365)
Q Consensus 163 ~p~Lp~~~~~ai~~~~~~~~~kv~l~~~~~~w~~~~~~g~~~~~~~~~~~~~~~~~~~g~~~l~~~~~g~~a~~~~~~~~ 242 (365)
.|+||+.+++++++++||+..|+++.|+++||++..++|.+.++...+.++.+.....+.++|++++.|+.+..+..+++
T Consensus 261 ~p~lp~~~~~ai~~~~~g~~~Kv~l~f~~~fw~~~~~~g~~~~~~~~~~~~~~~~~~~g~~~l~~~~~g~~a~~~~~~~~ 340 (435)
T PLN02268 261 EPELPEWKEEAISDLGVGIENKIALHFDSVFWPNVEFLGVVAPTSYGCSYFLNLHKATGHPVLVYMPAGRLARDIEKLSD 340 (435)
T ss_pred cCCCCHHHHHHHHhCCccceeEEEEEeCCCCCCCCceeeccCCCCCCceEEEecccCCCCCEEEEEeccHHHHHHHhCCH
Confidence 99999999999999999999999999999999876777877654444555555555566778999999998999999999
Q ss_pred HHHHHHHHHHHHHhcCCCCCccEEEeccCCCCCCCCCcCCCCCCCCCHHHHHHHhCCCCCEEEeccccCCCCcchhHHHH
Q 017808 243 EAAANFAFTQLKKILPDASSPIQYLVSHWGTDANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAF 322 (365)
Q Consensus 243 ~e~~~~~~~~L~~~~~~~~~p~~~~~~~W~~~~~~~g~y~~~~~g~~~~~~~~l~~p~~~l~~aG~~~~~~~~g~v~gA~ 322 (365)
+++++.++++|+++||...+|..+..++|.++||++|+|++..||+....++.+++|+++||||||+|+..|+|+||||+
T Consensus 341 ~e~~~~v~~~L~~~~~~~~~p~~~~~~~W~~dp~~~G~~~~~~~g~~~~~~~~l~~p~~~l~FAGe~ts~~~~g~~eGA~ 420 (435)
T PLN02268 341 EAAANFAMSQLKKMLPDATEPVQYLVSRWGSDPNSLGCYSYDLVGKPHDLYERLRAPVDNLFFAGEATSSDFPGSVHGAY 420 (435)
T ss_pred HHHHHHHHHHHHHHcCCCCCccEEEecccCCCCCCCccCCCCCCCCCHHHHHHHhCCCCCeEEeeccCCCcccccHHHHH
Confidence 99999999999999987778999999999999999999999889987778889999999999999999998999999999
Q ss_pred HHHHHHHHHHHHHH
Q 017808 323 STGLMAAEDCRMRV 336 (365)
Q Consensus 323 ~SG~~aA~~i~~~l 336 (365)
+||+|||++|++.|
T Consensus 421 ~sG~raA~~v~~~l 434 (435)
T PLN02268 421 STGVMAAEECRMRL 434 (435)
T ss_pred HHHHHHHHHHHHhh
Confidence 99999999998765
|
|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 365 | ||||
| 2v1d_A | 730 | Structural Basis Of Lsd1-Corest Selectivity In Hist | 5e-37 | ||
| 2hko_A | 664 | Crystal Structure Of Lsd1 Length = 664 | 5e-37 | ||
| 2iw5_A | 666 | Structural Basis For Corest-dependent Demethylation | 6e-37 | ||
| 2dw4_A | 660 | Crystal Structure Of Human Lsd1 At 2.3 A Resolution | 6e-37 | ||
| 2ejr_A | 662 | Lsd1-Tranylcypromine Complex Length = 662 | 6e-37 | ||
| 2x0l_A | 734 | Crystal Structure Of A Neuro-Specific Splicing Vari | 6e-37 | ||
| 2h94_A | 664 | Crystal Structure And Mechanism Of Human Lysine-Spe | 6e-37 | ||
| 2xaf_A | 852 | Crystal Structure Of Lsd1-Corest In Complex With Pa | 1e-36 | ||
| 4gu1_A | 784 | Crystal Structure Of Lsd2 Length = 784 | 2e-31 | ||
| 4gur_A | 776 | Crystal Structure Of Lsd2-npac With H3 In Space Gro | 2e-31 | ||
| 4fwe_A | 796 | Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup | 2e-31 | ||
| 1b37_A | 472 | A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys | 4e-25 | ||
| 3kpf_A | 478 | X-Ray Structure Of The Mutant Lys300met Of Polyamin | 2e-24 | ||
| 4ech_A | 516 | Yeast Polyamine Oxidase Fms1, H67q Mutant Length = | 7e-12 | ||
| 4gdp_A | 516 | Yeast Polyamine Oxidase Fms1, N195a Mutant Length = | 7e-12 | ||
| 1z6l_A | 516 | Crystal Structure Of Fms1 In Complex With Its Subst | 8e-12 | ||
| 1yy5_A | 513 | Crystal Structure Of Fms1, A Polyamine Oxidase From | 9e-12 | ||
| 1rsg_A | 516 | Crystal Structure Of The Polyamine Oxidase Fms1 Fro | 3e-11 | ||
| 2bxr_A | 527 | Human Monoamine Oxidase A In Complex With Clorgylin | 3e-10 | ||
| 2z5y_A | 513 | Crystal Structure Of Human Monoamine Oxidase A (G11 | 3e-10 | ||
| 2z5x_A | 513 | Crystal Structure Of Human Monoamine Oxidase A With | 3e-10 | ||
| 3kve_A | 486 | Structure Of Native L-Amino Acid Oxidase From Viper | 1e-09 | ||
| 2c72_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 1e-09 | ||
| 1gos_A | 520 | Human Monoamine Oxidase B Length = 520 | 2e-09 | ||
| 2xfu_A | 519 | Human Monoamine Oxidase B With Tranylcypromine Leng | 2e-09 | ||
| 2c73_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 2e-09 | ||
| 2c75_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 2e-09 | ||
| 2c76_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 2e-09 | ||
| 2bk4_A | 520 | Human Monoamine Oxidase B: I199f Mutant In Complex | 3e-09 | ||
| 2xfo_A | 520 | Tranylcypromine-Inhibited Human Monoamine Oxidase B | 4e-09 | ||
| 4e0v_A | 497 | Structure Of L-Amino Acid Oxidase From The B. Jarar | 5e-09 | ||
| 1o5w_A | 534 | The Structure Basis Of Specific Recognitions For Su | 3e-08 | ||
| 3zyx_A | 519 | Crystal Structure Of Human Monoamine Oxidase B In C | 4e-08 | ||
| 1reo_A | 486 | L-Amino Acid Oxidase From Agkistrodon Halys Pallas | 1e-07 | ||
| 2yg7_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 5e-06 | ||
| 3k7t_A | 425 | Crystal Structure Of Apo-Form 6-Hydroxy-L-Nicotine | 1e-05 | ||
| 3k7m_X | 431 | Crystal Structure Of 6-Hydroxy-L-Nicotine Oxidase F | 1e-05 | ||
| 2yg3_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 3e-05 | ||
| 2yg6_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 4e-05 | ||
| 2yg5_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 4e-05 | ||
| 1f8r_A | 498 | Crystal Structure Of L-Amino Acid Oxidase From Call | 8e-04 |
| >pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 | Back alignment and structure |
|
| >pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 | Back alignment and structure |
| >pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 | Back alignment and structure |
| >pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 | Back alignment and structure |
| >pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 | Back alignment and structure |
| >pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 | Back alignment and structure |
| >pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 | Back alignment and structure |
| >pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 | Back alignment and structure |
| >pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 | Back alignment and structure |
| >pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 | Back alignment and structure |
| >pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 | Back alignment and structure |
| >pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 | Back alignment and structure |
| >pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 | Back alignment and structure |
| >pdb|4ECH|A Chain A, Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 516 | Back alignment and structure |
| >pdb|4GDP|A Chain A, Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 516 | Back alignment and structure |
| >pdb|1Z6L|A Chain A, Crystal Structure Of Fms1 In Complex With Its Substrate Length = 516 | Back alignment and structure |
| >pdb|1YY5|A Chain A, Crystal Structure Of Fms1, A Polyamine Oxidase From Yeast Length = 513 | Back alignment and structure |
| >pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 | Back alignment and structure |
| >pdb|2BXR|A Chain A, Human Monoamine Oxidase A In Complex With Clorgyline, Crystal Form A Length = 527 | Back alignment and structure |
| >pdb|2Z5Y|A Chain A, Crystal Structure Of Human Monoamine Oxidase A (G110a) With Harmine Length = 513 | Back alignment and structure |
| >pdb|2Z5X|A Chain A, Crystal Structure Of Human Monoamine Oxidase A With Harmine Length = 513 | Back alignment and structure |
| >pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 | Back alignment and structure |
| >pdb|2C72|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|1GOS|A Chain A, Human Monoamine Oxidase B Length = 520 | Back alignment and structure |
| >pdb|2XFU|A Chain A, Human Monoamine Oxidase B With Tranylcypromine Length = 519 | Back alignment and structure |
| >pdb|2C73|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2C75|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2C76|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2BK4|A Chain A, Human Monoamine Oxidase B: I199f Mutant In Complex With Rasagiline Length = 520 | Back alignment and structure |
| >pdb|2XFO|A Chain A, Tranylcypromine-Inhibited Human Monoamine Oxidase B Ile199ala Mutant In Complex With 2-(2-Benzofuranyl)-2- Imidazoline Length = 520 | Back alignment and structure |
| >pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 | Back alignment and structure |
| >pdb|1O5W|A Chain A, The Structure Basis Of Specific Recognitions For Substrates And Inhibitors Of Rat Monoamine Oxidase A Length = 534 | Back alignment and structure |
| >pdb|3ZYX|A Chain A, Crystal Structure Of Human Monoamine Oxidase B In Complex With Methylene Blue And Bearing The Double Mutation I199a- Y326a Length = 519 | Back alignment and structure |
| >pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 | Back alignment and structure |
| >pdb|2YG7|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c-A396t-Q431g Triple Mutant Length = 453 | Back alignment and structure |
| >pdb|3K7T|A Chain A, Crystal Structure Of Apo-Form 6-Hydroxy-L-Nicotine Oxidase, Crystal Form P3121 Length = 425 | Back alignment and structure |
| >pdb|3K7M|X Chain X, Crystal Structure Of 6-Hydroxy-L-Nicotine Oxidase From Arthrobacter Nicotinovorans Length = 431 | Back alignment and structure |
| >pdb|2YG3|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: Wild Type Enzyme Length = 453 | Back alignment and structure |
| >pdb|2YG6|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: P15i-A394c Double Mutant Length = 453 | Back alignment and structure |
| >pdb|2YG5|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c Mutant Length = 453 | Back alignment and structure |
| >pdb|1F8R|A Chain A, Crystal Structure Of L-Amino Acid Oxidase From Calloselasma Rhodostoma Complexed With Citrate Length = 498 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 | Back alignment and structure |
|---|
Score = 286 bits (734), Expect = 1e-93
Identities = 97/368 (26%), Positives = 154/368 (41%), Gaps = 34/368 (9%)
Query: 2 DGNQVPQELVTKVGEAFESILKETDKVREEHDE---DMSIQRAISIVFDRRPELRLEGLA 58
DG ++ V K E +S+ + +K+ D A+ + + +P
Sbjct: 100 DGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPAT-PV 158
Query: 59 HKVLQWYLCRMEGWFAADAETISLKSWDKEELLP--GGHGLMV---RGYLPVINTLAKGL 113
V+ +Y + + FA SL++ G V RGY V+ LA
Sbjct: 159 DMVVDYY--KFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQY 216
Query: 114 -------------DIRLGHRVTKITRHYIGVKVTVEGGKTFVADAVVVAVPLGVLKARTI 160
++L V +I GV V E + AD V+V+ LGVL++ I
Sbjct: 217 LKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLI 276
Query: 161 KFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPNVE----FLGVVSDTSYGCSYFLNL 216
+F+P+LP WK AI + + KI + F + FWP + FL S Y +
Sbjct: 277 QFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFE 336
Query: 217 HKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILP--DASSPIQYLVSHWGTD 274
+ VL+ + +R IE+ SDE L+K+ P D LV W +D
Sbjct: 337 KQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSD 396
Query: 275 ANSLGSYSYDTVGKSHDLYERLRIPVDNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRM 334
G++S VG + Y++LR PV ++F GE TS Y G VHGA+ +G+ +AE
Sbjct: 397 RFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAE---- 452
Query: 335 RVLERYGE 342
++ +
Sbjct: 453 ILINCAQK 460
|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 130 | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 365 | |||
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 100.0 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 100.0 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 100.0 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 100.0 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 100.0 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 100.0 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 100.0 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 100.0 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 100.0 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 100.0 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 99.97 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 99.97 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 99.96 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 99.96 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 99.95 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 99.95 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 99.95 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 99.94 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 99.9 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 99.86 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 99.83 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 99.83 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 99.83 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.83 | |
| 2e1m_C | 181 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 99.81 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 99.75 | |
| 2e1m_B | 130 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 99.52 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 99.36 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 99.28 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 99.24 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 98.96 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 98.36 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 98.2 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 98.18 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 98.0 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 97.79 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 97.28 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 96.81 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 95.7 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 95.62 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 95.62 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 95.53 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 95.35 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 95.22 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 94.93 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 94.89 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 94.85 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 94.47 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 94.33 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 94.18 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 94.12 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 94.09 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 94.08 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 93.97 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 93.97 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 93.88 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 93.85 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 93.83 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 93.78 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 93.73 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 93.72 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 93.57 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 93.53 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 93.34 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 93.28 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 93.27 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 93.1 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 92.9 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 92.66 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 92.61 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 92.58 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 92.35 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 92.3 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 92.21 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 92.05 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 92.02 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 91.95 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 91.89 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 91.64 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 91.35 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 91.34 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 91.1 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 91.04 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 91.01 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 90.74 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 90.54 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 90.42 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 90.4 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 90.29 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 90.27 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 90.26 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 90.16 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 89.98 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 89.96 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 89.94 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 89.93 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 89.89 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 89.65 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 89.59 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 89.45 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 89.38 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 89.23 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 89.19 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 89.04 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 88.88 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 88.44 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 88.34 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 88.31 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 88.07 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 88.05 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 88.05 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 88.02 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 87.93 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 87.87 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 87.82 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 87.75 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 87.73 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 87.72 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 87.64 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 87.63 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 87.51 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 87.42 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 87.26 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 87.1 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 87.05 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 86.99 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 86.95 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 86.81 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 86.65 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 86.6 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 86.56 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 86.52 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 86.5 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 86.45 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 86.41 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 86.32 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 86.13 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 86.1 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 85.9 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 85.87 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 85.82 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 85.81 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 85.59 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 85.53 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 84.89 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 84.6 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 84.37 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 84.25 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 84.2 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 83.44 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 83.25 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 83.24 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 83.16 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 83.03 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 82.9 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 82.71 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 82.13 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 82.03 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 81.87 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 81.57 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 81.43 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 81.36 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 81.12 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 81.11 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 81.1 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 80.93 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 80.66 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 80.43 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 80.32 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 80.17 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 80.1 |
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-40 Score=333.88 Aligned_cols=277 Identities=35% Similarity=0.591 Sum_probs=234.3
Q ss_pred HHHHHHHHHHhhhhhcCCCCcccChhccccc--cccCCCceeccCChHHHHHHHhccCCeecCceeEEEEecCCeeEEEE
Q 017808 58 AHKVLQWYLCRMEGWFAADAETISLKSWDKE--ELLPGGHGLMVRGYLPVINTLAKGLDIRLGHRVTKITRHYIGVKVTV 135 (365)
Q Consensus 58 ~~~~~~~~~~~~~~~~g~~~~~~S~~~~~~~--~~~~g~~~~~~gG~~~L~~~L~~~l~I~l~~~V~~I~~~~~~v~V~~ 135 (365)
.+.+++|++..++...+.+.+.+|+..|.++ ..+.|..+.++|||++|+++|+++++|++|++|++|.+++++|.|++
T Consensus 354 ~~~~l~~~~~~~~~~~~~~l~~ls~~~~~~~~~~~~~g~~~~~~gG~~~l~~~La~~l~I~l~~~V~~I~~~~~~v~V~~ 433 (662)
T 2z3y_A 354 DRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIA 433 (662)
T ss_dssp HHHHHHHHHHHHHHHTTSCGGGBBTTTTTTTGGGCCBSCCEEETTCTTHHHHHHTTTCEEETTEEEEEEEEETTEEEEEE
T ss_pred HHHHHHHHHHHHHHhcCCChhhcCHhhcCCCcccccCCceeeecCcHHHHHHHHHhcCceecCCeEEEEEECCCcEEEEE
Confidence 3456666655555556788899999877643 23456788999999999999999999999999999999999999998
Q ss_pred cC------CcEEEcCEEEEecChhhhhc--CCccccCCCcHHHHHHHhhcCCccccEEEEEcCCCCCCC-CCcceeecCC
Q 017808 136 EG------GKTFVADAVVVAVPLGVLKA--RTIKFEPRLPDWKEAAIDDLGVGIENKIIMHFDKVFWPN-VEFLGVVSDT 206 (365)
Q Consensus 136 ~~------g~~~~ad~VI~t~p~~~l~~--~~i~f~p~Lp~~~~~ai~~~~~~~~~kv~l~~~~~~w~~-~~~~g~~~~~ 206 (365)
.+ |+++.||+||+|+|+++|++ ..+.|.|+||+.+.+++++++|+++.||++.|+++||++ ...+|.+.+.
T Consensus 434 ~~~~~~~~~~~~~Ad~VI~tvP~~vL~~l~~~i~f~P~LP~~k~~Ai~~l~~g~~~KV~l~f~~~fW~~~~~~~G~l~~~ 513 (662)
T 2z3y_A 434 VNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGST 513 (662)
T ss_dssp EESSCTTCEEEEEESEEEECCCHHHHHCSSCSSEEESCCCHHHHHHHHHSEECCCEEEEEECSSCCSCTTCSEEEECCSS
T ss_pred eecccCCCCeEEEeCEEEECCCHHHHhcccCceEEcCCCCHHHHHHHHhCCccceeEEEEEcCcccccCCCCceeeecCC
Confidence 76 57899999999999999987 347899999999999999999999999999999999964 4677776443
Q ss_pred CC---ceeEeeeccCCCCCceEEEEecchhhHHHhcCCHHHHHHHHHHHHHHhcCC--CCCccEEEeccCCCCCCCCCcC
Q 017808 207 SY---GCSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLKKILPD--ASSPIQYLVSHWGTDANSLGSY 281 (365)
Q Consensus 207 ~~---~~~~~~~~~~~~g~~~l~~~~~g~~a~~~~~~~~~e~~~~~~~~L~~~~~~--~~~p~~~~~~~W~~~~~~~g~y 281 (365)
.. ....+++.. +.++|++|+.|+.+..+..++++++++.++++|+++||. .++|..+.+++|.++||++|+|
T Consensus 514 ~~~~~~~~~~~~~~---~~~vL~~~~~G~~a~~~~~lsdee~~~~~l~~L~~~~g~~~~~~p~~~~v~~W~~dp~~~Gsy 590 (662)
T 2z3y_A 514 TASRGELFLFWNLY---KAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSY 590 (662)
T ss_dssp STTTTEEEEEECCS---SSSEEEEEECTHHHHHHTTSCHHHHHHHHHHHHHHHHCTTSSCCCSEEEECCTTTCTTTSSSC
T ss_pred CCCCCceeEEEeCC---CCCEEEEEeccHhHHHHHhCCHHHHHHHHHHHHHHHhCCcccCCCceeEEEEECCCCCCCccc
Confidence 21 123333332 456899999999999999999999999999999999986 4579999999999999999999
Q ss_pred CCCCCCCCHHHHHHHhCCC-------------CCEEEeccccCCCCcchhHHHHHHHHHHHHHHHHHHH
Q 017808 282 SYDTVGKSHDLYERLRIPV-------------DNLFFAGEATSMSYPGSVHGAFSTGLMAAEDCRMRVL 337 (365)
Q Consensus 282 ~~~~~g~~~~~~~~l~~p~-------------~~l~~aG~~~~~~~~g~v~gA~~SG~~aA~~i~~~l~ 337 (365)
++.++|.....++.+++|+ ++||||||+|+..|+|+||||++||+|||++|++.+.
T Consensus 591 s~~~pg~~~~~~~~l~~p~~~~~~~~~~~~~~grl~FAGe~ts~~~~g~v~GAi~SG~raA~~i~~~~~ 659 (662)
T 2z3y_A 591 SYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFL 659 (662)
T ss_dssp EECBTTCCTHHHHHHHCCBCC---------CCCCEEECSGGGCTTSTTSHHHHHHHHHHHHHHHHHHHT
T ss_pred ccCCCCCchhhHHHHhCcCccccccccccCCCCcEEEEeccccCCCCcCHHHHHHHHHHHHHHHHHHcc
Confidence 9999998777778887775 6899999999998899999999999999999988753
|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 365 | ||||
| d2dw4a3 | 109 | d.16.1.5 (A:655-763) Lysine-specific histone demet | 7e-22 | |
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 5e-20 | |
| d1b5qa2 | 112 | d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea | 4e-19 | |
| d2v5za2 | 112 | d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H | 3e-18 | |
| d2v5za1 | 383 | c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H | 3e-17 | |
| d2iida2 | 113 | d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan | 4e-16 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 2e-10 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 1e-07 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 4e-09 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 6e-07 | |
| d1m6ia2 | 137 | c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF | 3e-05 | |
| d1gesa2 | 116 | c.3.1.5 (A:147-262) Glutathione reductase {Escheri | 9e-05 | |
| d1aoga2 | 117 | c.3.1.5 (A:170-286) Trypanothione reductase {Trypa | 2e-04 | |
| d3lada2 | 119 | c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase | 9e-04 | |
| d1seza1 | 373 | c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox | 9e-04 | |
| d1d7ya2 | 121 | c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu | 0.001 | |
| d1feca2 | 117 | c.3.1.5 (A:170-286) Trypanothione reductase {Crith | 0.002 |
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FAD-linked reductases, C-terminal domain superfamily: FAD-linked reductases, C-terminal domain family: L-aminoacid/polyamine oxidase domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 87.2 bits (215), Expect = 7e-22
Identities = 33/109 (30%), Positives = 49/109 (44%), Gaps = 3/109 (2%)
Query: 178 GVGIENKIIMHFDKVFWP-NVEFLGVVSDTSYGCSYFLNLHKATGHCVLVYMPAGQLARD 236
G G NK+++ FD+VFW +V G V T+ +L+ + AG+ A
Sbjct: 1 GFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGI 60
Query: 237 IEKMSDEAAANFAFTQLKKIL--PDASSPIQYLVSHWGTDANSLGSYSY 283
+E +SD+ LK I P + +VS W D + GSYSY
Sbjct: 61 MENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSY 109
|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 113 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 365 | |||
| d2v5za2 | 112 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.68 | |
| d2dw4a3 | 109 | Lysine-specific histone demethylase 1, LSD1 {Human | 99.68 | |
| d1b5qa2 | 112 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.61 | |
| d2iida2 | 113 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.52 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.5 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.46 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.41 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 98.73 | |
| d2ivda2 | 108 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.64 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 98.53 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.41 | |
| d1seza2 | 112 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 98.36 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 98.17 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 97.78 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 97.3 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.21 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 97.0 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 96.95 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 96.76 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 96.72 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 96.71 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 96.63 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 96.1 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 96.06 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 96.04 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 95.98 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 95.85 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 95.7 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 95.63 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 95.4 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 95.23 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 95.04 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 94.87 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 94.81 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 94.73 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 93.61 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 93.23 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 93.01 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 93.0 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 92.01 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 90.79 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 88.86 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 88.76 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 87.94 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 86.15 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 85.8 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 85.53 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 85.47 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 84.83 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 82.87 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 82.56 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 80.75 |
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FAD-linked reductases, C-terminal domain superfamily: FAD-linked reductases, C-terminal domain family: L-aminoacid/polyamine oxidase domain: Monoamine oxidase B species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68 E-value=6.2e-17 Score=122.90 Aligned_cols=106 Identities=17% Similarity=0.288 Sum_probs=86.6
Q ss_pred CCccccEEEEEcCCCCCCCCCcceeecCCC--Cc-eeEeeeccCCCCCceEEEEecchhhHHHhcCCHHHHHHHHHHHHH
Q 017808 178 GVGIENKIIMHFDKVFWPNVEFLGVVSDTS--YG-CSYFLNLHKATGHCVLVYMPAGQLARDIEKMSDEAAANFAFTQLK 254 (365)
Q Consensus 178 ~~~~~~kv~l~~~~~~w~~~~~~g~~~~~~--~~-~~~~~~~~~~~g~~~l~~~~~g~~a~~~~~~~~~e~~~~~~~~L~ 254 (365)
+||+++||+|.|+++||++.+..|...... .. ...+++..+..+.++|++|+.|+.+..++.++++++++.+++.|+
T Consensus 1 pmG~~~Kv~l~f~~~FW~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~vL~~~~~G~~a~~~~~ls~~e~~~~~l~~L~ 80 (112)
T d2v5za2 1 PLGSVIKCIVYYKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEERLKKLCELYA 80 (112)
T ss_dssp CBCCEEEEEEECSSCGGGGGTEEEEEEECSTTCSCSEEEECCCTTSCSCEEEEEEETHHHHHHTTSCHHHHHHHHHHHHH
T ss_pred CchheEEEEEEcCCCCCCCCCceeeEEecCCCCcEEEEccCcCccCCCcEEEEEeCcHHHHHHHhCCHHHHHHHHHHHHH
Confidence 689999999999999997666666543222 12 223334444455679999999999999999999999999999999
Q ss_pred HhcCC--CCCccEEEeccCCCCCCCCCcCCC
Q 017808 255 KILPD--ASSPIQYLVSHWGTDANSLGSYSY 283 (365)
Q Consensus 255 ~~~~~--~~~p~~~~~~~W~~~~~~~g~y~~ 283 (365)
++||+ +++|..+.+++|.+|||++|+|+.
T Consensus 81 ~~~g~~~~~~~~~~~~~~W~~dp~~~GsYs~ 111 (112)
T d2v5za2 81 KVLGSLEALEPVHYEEKNWCEEQYSGGCYTT 111 (112)
T ss_dssp HHHTCGGGGCCSEEEEEEGGGCTTTCSSSCB
T ss_pred HHhCccccCCccEEEEcccCCCCccCccccc
Confidence 99986 567899999999999999999984
|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|