Citrus Sinensis ID: 017858

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MKVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHAIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLVDKSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIEGICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKISYLQDPGFAEVKYLHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLTAKIPNPTLMPRMKN
cEEEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHHcccccEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHcccccccccHHHHHEEccccccccHHHHHHHHHHcccccccccHHHcccccEEEccccEEEccHHHHHHHHHHHHHccccccccccccccHHHHHHHccccccccEEEEEEEcccccEEEEcHHHHcccccccEEEEEccccccccccccccccccccccccEEEEccccccccccccccccEEEEEccccccccccccccccccccEEEcccccccccccccccccccccc
cEEEEEEccccHHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHEEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHccEEEEcccccEEHHHHHHHHHHHHHHcccccccccEEcccHHHHHHHHHccccccEEEEEEEEcccccEEEccHHHHHHccccEEEEEEccccccccEEEcccccHHccHHccEEEccccccccccccccHHHEEEEEcccccHHHHcccccccccccEEEccccHHHHHccccccccccccc
MKVLIVFDDVTCFSQIESLigsldwltpvsRIIITTRNKQVLRNWGVRKIYEMKALEYHHAIRLFSrhafkqnhpdvgyeELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYdslddkeknIFLDVacffqgedVDLVMKFFnasgfypeigmsvlvdksliaidshKKITMHDLLQELGREIVrqesidpanrsrlwhhedIYEVLtyntgtekieGICLDMSkikeirlnpstftkmpklrFLKFYRssvngknkckisylqdpgfaeVKYLHwygyplkslpsnlsakklvlvevpdsdieRLWHCVKHYSKLNQIIHAACNMLtakipnptlmprmkn
MKVLIVFDDVTCFSQIEsligsldwltpvSRIIittrnkqvlrnwGVRKIYEMKALEYHHAIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLVDKSLIAIDSHKKITMHDLLQELGREIVRQEsidpanrsrlwhhedIYEVLTYNTGTEKIEGICLDMSKIKEIRlnpstftkmpklrFLKFYrssvngknkckISYLQDPGFAEVKYLHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLtakipnptlmprmkn
MKVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHAIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLVDKSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIEGICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKISYLQDPGFAEVKYLHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLTAKIPNPTLMPRMKN
**VLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHAIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLVDKSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIEGICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKISYLQDPGFAEVKYLHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLTAKI***********
MKVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHAIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLVDKSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIEGICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKISYLQDPGFAEVKYLHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLTAKIPNPTLMPRMK*
MKVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHAIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLVDKSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIEGICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKISYLQDPGFAEVKYLHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLTAKIPNPTLMPRMKN
MKVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHAIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLVDKSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIEGICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKISYLQDPGFAEVKYLHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLTAKIPNPTL******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHAIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLVDKSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIEGICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKISYLQDPGFAEVKYLHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLTAKIPNPTLMPRMKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
Q40392 1144 TMV resistance protein N N/A no 0.958 0.305 0.370 5e-59
Q9FH83 1288 Probable WRKY transcripti no no 0.923 0.261 0.390 1e-58
Q9FL92 1372 Probable WRKY transcripti no no 0.917 0.244 0.375 9e-57
O82500 1095 Putative disease resistan no no 0.909 0.303 0.373 3e-55
Q9SZ67 1895 Probable WRKY transcripti no no 0.876 0.168 0.366 2e-51
O23530 1301 Protein SUPPRESSOR OF npr no no 0.945 0.265 0.342 1e-45
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.920 0.208 0.347 1e-43
Q9LVT1 623 Putative disease resistan no no 0.567 0.332 0.235 3e-10
Q9FKZ1 809 Probable disease resistan no no 0.572 0.258 0.254 7e-09
Q9FLB4 874 Putative disease resistan no no 0.454 0.189 0.292 2e-08
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  228 bits (581), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 208/364 (57%), Gaps = 14/364 (3%)

Query: 2   KVLIVFDDVTCFSQ-IESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHH 60
           KVLIV DD+      +E L G LDW    SRIIITTR+K ++    +  IYE+ AL  H 
Sbjct: 295 KVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDI--IYEVTALPDHE 352

Query: 61  AIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQ 120
           +I+LF +HAF +  P+  +E+LS +V+ YA+G+PLALKV G  LH      W+SA + ++
Sbjct: 353 SIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMK 412

Query: 121 RILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLV 180
              Y  I++ LKISYD L+ K++ +FLD+ACF +GE+ D +++   +     E G+ +L+
Sbjct: 413 NNSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILI 472

Query: 181 DKSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIE 240
           DKSL+ I  + ++ MHDL+Q++G+ IV  +  DP  RSRLW  +++ EV++ NTGT  +E
Sbjct: 473 DKSLVFISEYNQVQMHDLIQDMGKYIVNFQK-DPGERSRLWLAKEVEEVMSNNTGTMAME 531

Query: 241 GICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKISYLQDPGFAEVKYLHWY 300
            I +  S    +R +      M +LR     RSS +      I YL +     ++     
Sbjct: 532 AIWVS-SYSSTLRFSNQAVKNMKRLRVFNMGRSSTH----YAIDYLPN----NLRCFVCT 582

Query: 301 GYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLTAKIPNPTLM 360
            YP +S PS    K LV +++  + +  LW   KH   L +I  +    LT + P+ T M
Sbjct: 583 NYPWESFPSTFELKMLVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLT-RTPDFTGM 641

Query: 361 PRMK 364
           P ++
Sbjct: 642 PNLE 645
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description
>sp|Q9FKZ1|DRL42_ARATH Probable disease resistance protein At5g66900 OS=Arabidopsis thaliana GN=At5g66900 PE=3 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
255537139 1137 leucine-rich repeat-containing protein, 0.928 0.298 0.513 8e-87
356528847 1137 PREDICTED: TMV resistance protein N-like 0.983 0.315 0.466 8e-85
359495289 1133 PREDICTED: TMV resistance protein N-like 0.909 0.293 0.489 8e-84
357515077 1266 NBS-LRR resistance-like protein 4G [Medi 0.980 0.282 0.448 1e-83
359496026 1250 PREDICTED: TMV resistance protein N-like 0.989 0.288 0.461 2e-83
357471111 1264 NBS-LRR resistance-like protein 4G [Medi 0.980 0.283 0.448 2e-83
255561520465 conserved hypothetical protein [Ricinus 0.917 0.720 0.482 3e-82
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.953 0.236 0.461 6e-82
359486071 1261 PREDICTED: TMV resistance protein N-like 0.986 0.285 0.446 2e-81
296090597 1201 unnamed protein product [Vitis vinifera] 0.926 0.281 0.484 2e-81
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  326 bits (836), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 234/345 (67%), Gaps = 6/345 (1%)

Query: 2   KVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHA 61
           +VLIV DD     Q++ L+GS DW  P SRII+T+R+KQVL    V  IYE+K L +H A
Sbjct: 290 RVLIVVDDANDSEQLDLLVGSHDWFGPGSRIIVTSRDKQVLTKI-VDDIYEVKELVHHEA 348

Query: 62  IRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQR 121
           ++LF++  FK+      Y  LS  V++YA+GVPLALKVLG FL  + K  WESA DKL++
Sbjct: 349 LQLFNQTTFKKKCVPEDYSYLSDLVIEYAKGVPLALKVLGSFLFGKSKTEWESALDKLKK 408

Query: 122 ILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLVD 181
             + +   VLKISYD LD +EKNIFLD+ACFF+GE V++V K  +  GF  +IG+ +LVD
Sbjct: 409 APHRATQNVLKISYDGLDAEEKNIFLDIACFFRGESVEMVTKILDGCGFSTKIGLCLLVD 468

Query: 182 KSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIEG 241
           KSLI I  + K+ MHDLLQE+G+EIV QES  P+ R+RLW+HEDI  V + N GTE IEG
Sbjct: 469 KSLITI-LNDKVEMHDLLQEMGKEIVLQESKQPSQRTRLWNHEDILHVFSRNLGTETIEG 527

Query: 242 ICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNG--KNKCKISYLQ--DPGFAEVKYL 297
           +CL+ S I +I LN + F +M  LRFLKFY+S ++G  K   KI   Q  D    E++YL
Sbjct: 528 MCLNTSMINKIELNSNAFGRMYNLRFLKFYQSYIHGGFKECTKIRLPQGLDSLSNELRYL 587

Query: 298 HWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQI 342
           HW+GYPLKSLP+ +    LV++ +P S ++RLW   K   KL  I
Sbjct: 588 HWHGYPLKSLPARIHLMNLVVLVLPYSKVKRLWKGCKDLKKLKVI 632

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356528847|ref|XP_003533009.1| PREDICTED: TMV resistance protein N-like [Glycine max] Back     alignment and taxonomy information
>gi|359495289|ref|XP_002276927.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357515077|ref|XP_003627827.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] gi|355521849|gb|AET02303.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357471111|ref|XP_003605840.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] gi|355506895|gb|AES88037.1| NBS-LRR resistance-like protein 4G [Medicago truncatula] Back     alignment and taxonomy information
>gi|255561520|ref|XP_002521770.1| conserved hypothetical protein [Ricinus communis] gi|223538983|gb|EEF40580.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359486071|ref|XP_002272667.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090597|emb|CBI40966.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.950 0.268 0.387 4.1e-65
TAIR|locus:2146243 900 AT5G18360 [Arabidopsis thalian 0.934 0.378 0.387 1.8e-58
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.958 0.305 0.370 1.1e-56
TAIR|locus:2162439 1008 AT5G22690 [Arabidopsis thalian 0.928 0.336 0.381 3.6e-55
TAIR|locus:2195478 1031 AT1G63870 [Arabidopsis thalian 0.978 0.346 0.346 8.3e-55
TAIR|locus:2161513 780 AT5G17970 [Arabidopsis thalian 0.969 0.453 0.361 2.1e-54
TAIR|locus:2158485 1288 RRS1 "RESISTANT TO RALSTONIA S 0.923 0.261 0.393 3.5e-54
TAIR|locus:2136108 1095 AT4G11170 [Arabidopsis thalian 0.950 0.316 0.362 5.9e-54
TAIR|locus:2122955 1309 AT4G19500 [Arabidopsis thalian 0.901 0.251 0.397 2.1e-53
TAIR|locus:2151491 1123 AT5G46450 [Arabidopsis thalian 0.972 0.316 0.365 4.7e-53
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 673 (242.0 bits), Expect = 4.1e-65, P = 4.1e-65
 Identities = 140/361 (38%), Positives = 231/361 (63%)

Query:     3 VLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHAI 62
             V IV DDV    Q+  L+    W  P SRII+TTR++ +L + G+  +Y++K L    A+
Sbjct:   290 VFIVLDDVDRSEQLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINLVYKVKCLPKKEAL 349

Query:    63 RLFSRHAFKQNH--PDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQ 120
             +LF  +AF++    P  G+EELS + + YA G+PLAL+VLG FL++R +  WES   +L+
Sbjct:   350 QLFCNYAFREEIILPH-GFEELSVQAVNYASGLPLALRVLGSFLYRRSQIEWESTLARLK 408

Query:   121 RILYPSILEVLKISYDSLDDKEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLV 180
                +  I+EVL++SYD LD++EK IFL ++CF+  + VD V K  +  G+  EIG+++L 
Sbjct:   409 TYPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMKQVDYVRKLLDLCGYAAEIGITILT 468

Query:   181 DKSLIAIDSHKKITMHDLLQELGREIVRQESID-PANRSRLWHHEDIYEVLTYNTGTEKI 239
             +KSLI ++S+  + +HDLL+++GRE+VRQ++++ PA R  LW  EDI  +L+ N+GT+ +
Sbjct:   469 EKSLI-VESNGCVKIHDLLEQMGRELVRQQAVNNPAQRLLLWDPEDICHLLSENSGTQLV 527

Query:   240 EGICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKI----SYLQDPGFAEVK 295
             EGI L++S+I E+  +   F  +  L+ L FY  S +G+ +  +    SYL  P   +++
Sbjct:   528 EGISLNLSEISEVFASDRAFEGLSNLKLLNFYDLSFDGETRVHLPNGLSYL--P--RKLR 583

Query:   296 YLHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQIIHAACNMLTAKIP 355
             YL W GYPLK++PS    + LV + + +S++E+LW  ++    L ++  + C  L  ++P
Sbjct:   584 YLRWDGYPLKTMPSRFFPEFLVELCMSNSNLEKLWDGIQPLRNLKKMDLSRCKYLV-EVP 642

Query:   356 N 356
             +
Sbjct:   643 D 643
GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195478 AT1G63870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161513 AT5G17970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158485 RRS1 "RESISTANT TO RALSTONIA SOLANACEARUM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122955 AT4G19500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151491 AT5G46450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
PLN03210 1153 PLN03210, PLN03210, Resistant to P 7e-70
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-19
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  236 bits (604), Expect = 7e-70
 Identities = 134/369 (36%), Positives = 205/369 (55%), Gaps = 11/369 (2%)

Query: 2   KVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVRKIYEMKALEYHHA 61
           KVLI  DD+     +++L G   W    SRII+ T++K  LR  G+  IYE+       A
Sbjct: 297 KVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELA 356

Query: 62  IRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQR 121
           + +F R AFK+N P  G+ EL+ +V   A  +PL L VLG +L  R+KE W     +L+ 
Sbjct: 357 LEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRN 416

Query: 122 ILYPSILEVLKISYDSLDD-KEKNIFLDVACFFQGEDVDLVMKFFNASGFYPEIGMSVLV 180
            L   I + L++SYD L++ K+K IF  +AC F GE V+ +      S     IG+  LV
Sbjct: 417 GLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNLV 476

Query: 181 DKSLIAIDSHKKITMHDLLQELGREIVRQESIDPANRSRLWHHEDIYEVLTYNTGTEKIE 240
           DKSLI +     + MH LLQE+G+EIVR +S +P  R  L   +DI +VL  NTGT+K+ 
Sbjct: 477 DKSLIHV-REDIVEMHSLLQEMGKEIVRAQSNEPGEREFLVDAKDICDVLEDNTGTKKVL 535

Query: 241 GICLDMSKIKEIRLNPSTFTKMPKLRFLKFYRSSVNGKNKCKISYLQDPGF----AEVKY 296
           GI LD+ +I E+ ++ + F  M  L FLKFY    + K   ++ +    GF     +++ 
Sbjct: 536 GITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKK--EVRWHLPEGFDYLPPKLRL 593

Query: 297 LHWYGYPLKSLPSNLSAKKLVLVEVPDSDIERLWHCVKHYSKLNQI-IHAACNMLTAKIP 355
           L W  YPL+ +PSN   + LV +++  S +E+LW  V   + L  I +  + N+   +IP
Sbjct: 594 LRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNL--KEIP 651

Query: 356 NPTLMPRMK 364
           + ++   ++
Sbjct: 652 DLSMATNLE 660

syringae 6; Provisional. Length = 1153
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.96
KOG0617264 consensus Ras suppressor protein (contains leucine 99.19
KOG0617 264 consensus Ras suppressor protein (contains leucine 98.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.95
PRK04841 903 transcriptional regulator MalT; Provisional 98.89
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.79
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.75
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.67
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.65
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.64
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.62
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.62
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.62
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.59
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.49
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.4
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.34
PLN03150623 hypothetical protein; Provisional 98.34
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.34
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.32
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.26
PLN03150 623 hypothetical protein; Provisional 98.21
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.15
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.12
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.09
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.02
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.02
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.95
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.91
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.82
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.74
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.71
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.64
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.55
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.52
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.52
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.46
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.39
COG3903414 Predicted ATPase [General function prediction only 97.36
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.3
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.25
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.23
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.15
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.09
PF05729166 NACHT: NACHT domain 97.02
PRK06893229 DNA replication initiation factor; Validated 96.94
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.94
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 96.92
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.84
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.78
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.71
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.68
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.6
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.55
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.39
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.39
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.37
PRK15386 426 type III secretion protein GogB; Provisional 96.06
PRK15386 426 type III secretion protein GogB; Provisional 96.05
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.64
COG3899 849 Predicted ATPase [General function prediction only 95.48
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.44
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.29
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.17
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.13
PRK09087226 hypothetical protein; Validated 94.95
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.66
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 94.59
PRK07471365 DNA polymerase III subunit delta'; Validated 94.59
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.54
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 94.05
PRK05564313 DNA polymerase III subunit delta'; Validated 93.73
PF13173128 AAA_14: AAA domain 93.68
PRK08727233 hypothetical protein; Validated 93.42
KOG2123 388 consensus Uncharacterized conserved protein [Funct 93.3
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.3
smart0037026 LRR Leucine-rich repeats, outliers. 93.3
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.17
KOG2982 418 consensus Uncharacterized conserved protein [Funct 93.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 92.95
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 92.86
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.84
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 92.59
PRK13342413 recombination factor protein RarA; Reviewed 92.46
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 92.42
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.32
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 92.16
PRK08084235 DNA replication initiation factor; Provisional 91.79
smart0037026 LRR Leucine-rich repeats, outliers. 91.79
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.79
PF14516331 AAA_35: AAA-like domain 91.26
PRK00440319 rfc replication factor C small subunit; Reviewed 91.21
PRK06620214 hypothetical protein; Validated 91.19
TIGR02928365 orc1/cdc6 family replication initiation protein. M 90.86
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 90.78
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.7
PRK09112351 DNA polymerase III subunit delta'; Validated 90.48
PRK12402337 replication factor C small subunit 2; Reviewed 89.94
PRK05642234 DNA replication initiation factor; Validated 89.72
PRK14087450 dnaA chromosomal replication initiation protein; P 89.54
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 89.5
PRK08903227 DnaA regulatory inactivator Hda; Validated 89.04
PLN03025319 replication factor C subunit; Provisional 87.29
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 86.88
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.79
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 86.57
PRK05707328 DNA polymerase III subunit delta'; Validated 86.36
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 86.25
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 85.69
COG2256436 MGS1 ATPase related to the helicase subunit of the 85.42
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 85.25
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 84.95
KOG0473 326 consensus Leucine-rich repeat protein [Function un 84.92
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 84.69
PRK07940394 DNA polymerase III subunit delta'; Validated 84.49
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 84.37
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 84.11
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 83.15
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 82.91
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 82.87
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 82.68
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 82.24
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 81.91
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 81.87
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 81.76
PRK06090319 DNA polymerase III subunit delta'; Validated 81.57
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 81.45
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 81.35
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 81.11
PRK04195482 replication factor C large subunit; Provisional 80.24
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=6.9e-53  Score=422.73  Aligned_cols=338  Identities=24%  Similarity=0.335  Sum_probs=240.6

Q ss_pred             CEEEEEEeCCCChHhHHHHHccCCCCCCCcEEEEEeCchhHHHh-cCccceEEeCCCCHHHHHHHHHHhhhcC-CCCCcc
Q 017858            1 MKVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRN-WGVRKIYEMKALEYHHAIRLFSRHAFKQ-NHPDVG   78 (365)
Q Consensus         1 kr~LlVlDdv~~~~~~~~l~~~~~~~~~gs~ilvTTR~~~v~~~-~~~~~~~~l~~L~~~e~~~L~~~~~~~~-~~~~~~   78 (365)
                      |||+|||||||+..+|+.+..++|....||+|++|||++.|+.. +++...++++.|+++|||+||.+.+|.. ....+.
T Consensus       261 krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~  340 (889)
T KOG4658|consen  261 KRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPD  340 (889)
T ss_pred             CceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhcccccccccc
Confidence            79999999999999999999999988899999999999999999 7888899999999999999999999877 345566


Q ss_pred             HHHHHHHHHHHcCCCchhHHHHhHhhccc-CHHHHHHHHHHHhhc-------CcccHHHHHHHHHhcCChhhhhhhhhhc
Q 017858           79 YEELSCKVMKYAQGVPLALKVLGCFLHKR-EKEVWESATDKLQRI-------LYPSILEVLKISYDSLDDKEKNIFLDVA  150 (365)
Q Consensus        79 ~~~~~~~i~~~c~glPlai~~~~~~l~~~-~~~~w~~~~~~l~~~-------~~~~~~~~l~~sy~~L~~~~~~~~~~ls  150 (365)
                      ++++|++|+++|+|+|||+.++|+.|+.+ +..+|+++.+.+...       ..+.+.+++.+||+.||++.|.||+|||
T Consensus       341 i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLyca  420 (889)
T KOG4658|consen  341 IEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCA  420 (889)
T ss_pred             HHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhc
Confidence            89999999999999999999999999987 788999999987654       1357889999999999999999999999


Q ss_pred             cccCCcCH--HHHHHHHHHcCCC------------cccchhHHhhcCceeEccC----CcEEecHHHHHHHHHHHhhcCC
Q 017858          151 CFFQGEDV--DLVMKFFNASGFY------------PEIGMSVLVDKSLIAIDSH----KKITMHDLLQELGREIVRQESI  212 (365)
Q Consensus       151 ~fp~~~~~--~~l~~~w~~~~~~------------~~~~l~~L~~~sLl~~~~~----~~~~~H~lv~~~a~~~~~~~~~  212 (365)
                      +||+++.+  +.++..|+++|++            ++.++++|++++|+.....    ..|+|||+||++|..++++...
T Consensus       421 lFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~  500 (889)
T KOG4658|consen  421 LFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGK  500 (889)
T ss_pred             cCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccc
Confidence            99999755  7999999999976            2456999999999998752    5899999999999999994332


Q ss_pred             CCCC--------------------cccCCCchhHHHHHhhcCCCceEEEEeeccccccccccCccccCCCCCCceEEEec
Q 017858          213 DPAN--------------------RSRLWHHEDIYEVLTYNTGTEKIEGICLDMSKIKEIRLNPSTFTKMPKLRFLKFYR  272 (365)
Q Consensus       213 ~~~~--------------------~~~l~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~  272 (365)
                      ...+                    .+++...............-++++++.+-.+......++...|..++.|++||+++
T Consensus       501 ~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~  580 (889)
T KOG4658|consen  501 QEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSG  580 (889)
T ss_pred             cccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCC
Confidence            1100                    01111111111111111111223333322221112223334455555555555544


Q ss_pred             CccCCCccccccccCC--CCCCcccEEEEeCCCCCCCCCCC-CCCCceEEeccCCc-ccccccccccCccCceeccc
Q 017858          273 SSVNGKNKCKISYLQD--PGFAEVKYLHWYGYPLKSLPSNL-SAKKLVLVEVPDSD-IERLWHCVKHYSKLNQIIHA  345 (365)
Q Consensus       273 ~~~~~~~~~~l~~lp~--~~l~~L~~L~l~~~~i~~lp~~~-~l~~L~~L~l~~~~-l~~lp~~i~~l~~L~~L~l~  345 (365)
                      |.       .+..+|.  +.|.+||||+++++.++.+|.++ +|..|.+|++..+. +..+|..+..|++|++|.+.
T Consensus       581 ~~-------~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~  650 (889)
T KOG4658|consen  581 NS-------SLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLP  650 (889)
T ss_pred             CC-------ccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEee
Confidence            33       3334555  55555555555555555555555 25555555555552 23333333335555555543

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 4e-27
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-26
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 3e-24
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-13
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  111 bits (279), Expect = 4e-27
 Identities = 36/237 (15%), Positives = 75/237 (31%), Gaps = 33/237 (13%)

Query: 2   KVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNW-GVRKIYEMKALEYHH 60
             L VFDDV    Q E++           R ++TTR+ ++        +  E+ +LE   
Sbjct: 244 NTLFVFDDV---VQEETI---RWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDE 297

Query: 61  AIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQ 120
                  +       +   E++  K ++ + G P  L +       +  E      +KL+
Sbjct: 298 CYDFLEAYGMPMPVGEK-EEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLE 356

Query: 121 RIL-----------YPSILEVLKISYDSLDDKEKNIFLDVACFFQGED--VDLVMKFFNA 167
                         Y S+   L+   + L D++++          G D  V L       
Sbjct: 357 SRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPV 416

Query: 168 SGFYPEIG---------MSVLVDKSLIAIDSHKKIT---MHDLLQELGREIVRQESI 212
                E           +  L  +  +       +    +  ++    + +V  ++I
Sbjct: 417 DICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTI 473
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.96
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.94
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.93
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.36
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.25
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.23
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.23
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.2
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.2
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.18
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.17
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.17
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.17
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.16
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.13
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.11
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.07
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.03
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.03
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.02
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.02
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.02
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.02
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.01
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.01
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.01
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.01
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.0
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.0
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.0
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.99
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.99
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.99
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.99
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.98
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.98
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.98
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.97
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.97
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.97
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.97
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.97
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.96
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.95
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.95
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.94
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.94
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.94
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.94
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.92
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.91
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.91
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.9
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.89
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.89
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.88
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.88
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.87
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.86
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.85
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.85
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.85
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 98.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.85
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.84
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.83
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.83
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.83
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.83
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.83
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.83
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.82
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.82
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.81
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.81
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.8
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.8
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 98.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.79
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.77
2fna_A357 Conserved hypothetical protein; structural genomic 98.75
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 98.72
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.72
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.72
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.72
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.68
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.68
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.67
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.67
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.65
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.64
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.6
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.57
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.57
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.56
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.53
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.52
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.49
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.48
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.4
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.3
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.21
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.19
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.99
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.89
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.7
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.56
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.54
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.49
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.47
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.45
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.41
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.38
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.12
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.02
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.0
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.95
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 96.94
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.88
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 96.85
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.8
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.73
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.51
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.47
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.44
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.44
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.29
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 96.25
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 96.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 95.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 95.39
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.06
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.05
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.9
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 94.2
2chq_A319 Replication factor C small subunit; DNA-binding pr 94.09
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.68
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.46
3bos_A242 Putative DNA replication factor; P-loop containing 92.15
4gt6_A394 Cell surface protein; leucine rich repeats, putati 91.7
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 90.98
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 90.68
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 90.59
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 90.39
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 90.0
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 87.25
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 85.99
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 85.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 84.48
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-33  Score=276.63  Aligned_cols=201  Identities=15%  Similarity=0.134  Sum_probs=159.9

Q ss_pred             CEEEEEEeCCCChHhHHHHHccCCCCCCCcEEEEEeCchhHHHhcC-ccceEEeCCCCHHHHHHHHHHhhhcCCCCCccH
Q 017858            1 MKVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWG-VRKIYEMKALEYHHAIRLFSRHAFKQNHPDVGY   79 (365)
Q Consensus         1 kr~LlVlDdv~~~~~~~~l~~~~~~~~~gs~ilvTTR~~~v~~~~~-~~~~~~l~~L~~~e~~~L~~~~~~~~~~~~~~~   79 (365)
                      |||||||||||+.+++ .+..     .+||+||||||++.++..++ ....|+|++|+.+|||+||.+.+|.... .+.+
T Consensus       243 kr~LlVLDdv~~~~~~-~~~~-----~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~-~~~~  315 (549)
T 2a5y_B          243 PNTLFVFDDVVQEETI-RWAQ-----ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV-GEKE  315 (549)
T ss_dssp             TTEEEEEEEECCHHHH-HHHH-----HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHH
T ss_pred             CcEEEEEECCCCchhh-cccc-----cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCC-chhH
Confidence            4999999999998876 2221     27999999999999998875 4468999999999999999999876543 4677


Q ss_pred             HHHHHHHHHHcCCCchhHHHHhHhhcccCHHHHHHHHH-HHhhcCcccHHHHHHHHHhcCChhhhhhhh-----------
Q 017858           80 EELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATD-KLQRILYPSILEVLKISYDSLDDKEKNIFL-----------  147 (365)
Q Consensus        80 ~~~~~~i~~~c~glPlai~~~~~~l~~~~~~~w~~~~~-~l~~~~~~~~~~~l~~sy~~L~~~~~~~~~-----------  147 (365)
                      .+++++|+++|+|+||||+++|+.++.+.. +|...+. .+......++..++.+||+.||++++.||.           
T Consensus       316 ~~~~~~I~~~c~GlPLAl~~~g~~l~~~~w-~~~~~l~~~l~~~~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~  394 (549)
T 2a5y_B          316 EDVLNKTIELSSGNPATLMMFFKSCEPKTF-EKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALA  394 (549)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHTTCCSSSH-HHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTT
T ss_pred             HHHHHHHHHHhCCChHHHHHHHHHhccchH-HHHHHhHHHhhcccHHHHHHHHhcccccccHHHHHHHhccchhhhhHhh
Confidence            889999999999999999999999987743 3323232 233334456777888888888888888888           


Q ss_pred             hhccccCCcCHHHHHHHHHHc--CCCcc-----------cchhHHhhcCceeEcc---CCcEEecHHHHHHHHHHHhhcC
Q 017858          148 DVACFFQGEDVDLVMKFFNAS--GFYPE-----------IGMSVLVDKSLIAIDS---HKKITMHDLLQELGREIVRQES  211 (365)
Q Consensus       148 ~ls~fp~~~~~~~l~~~w~~~--~~~~~-----------~~l~~L~~~sLl~~~~---~~~~~~H~lv~~~a~~~~~~~~  211 (365)
                      |||+||+++.++  +..|+++  |++..           .++++|+++||++...   ..+|+|||+||+||+.++.+++
T Consensus       395 ~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          395 FAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             GGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHH
T ss_pred             heeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHH
Confidence            999999998888  7899999  76632           2699999999999865   3479999999999998776653
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-22
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 93.7 bits (232), Expect = 1e-22
 Identities = 27/147 (18%), Positives = 50/147 (34%), Gaps = 10/147 (6%)

Query: 2   KVLIVFDDVTCFSQIESLIGSLDWLTPV-SRIIITTRNKQVLRN-WGVRKIYEMKALEYH 59
             L VFDDV     I        W   +  R ++TTR+ ++        +  E+ +LE  
Sbjct: 136 NTLFVFDDVVQEETIR-------WAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEID 188

Query: 60  HAIRLFSRHAFKQNHPDVGYEELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKL 119
                   +       +   E++  K ++ + G P  L +       +  E      +KL
Sbjct: 189 ECYDFLEAYGMPMPVGE-KEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKL 247

Query: 120 QRILYPSILEVLKISYDSLDDKEKNIF 146
           +      +  +   SY SL    +   
Sbjct: 248 ESRGLVGVECITPYSYKSLAMALQRCV 274

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.94
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.23
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.23
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.11
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.08
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.04
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.0
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.97
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.94
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 98.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.93
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.89
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.85
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.76
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.74
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.71
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.7
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.64
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.63
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.55
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.52
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.52
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.39
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.32
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.27
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.08
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.0
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.84
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.14
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.06
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.06
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 96.87
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.23
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.93
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 95.66
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.09
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.05
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 91.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 88.98
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 86.16
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 86.1
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 83.77
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 82.43
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 82.16
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.94  E-value=1.1e-27  Score=211.72  Aligned_cols=142  Identities=18%  Similarity=0.148  Sum_probs=125.8

Q ss_pred             CEEEEEEeCCCChHhHHHHHccCCCCCCCcEEEEEeCchhHHHhcCcc-ceEEeCCCCHHHHHHHHHHhhhcCCCCCccH
Q 017858            1 MKVLIVFDDVTCFSQIESLIGSLDWLTPVSRIIITTRNKQVLRNWGVR-KIYEMKALEYHHAIRLFSRHAFKQNHPDVGY   79 (365)
Q Consensus         1 kr~LlVlDdv~~~~~~~~l~~~~~~~~~gs~ilvTTR~~~v~~~~~~~-~~~~l~~L~~~e~~~L~~~~~~~~~~~~~~~   79 (365)
                      ||+|+||||||+.++|+.+..      .||+||||||++.++..+... +.|+|++|+.+|||+||.+++|.... .+..
T Consensus       135 kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~-~~~~  207 (277)
T d2a5yb3         135 PNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV-GEKE  207 (277)
T ss_dssp             TTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHH
T ss_pred             CCeeEecchhhHHhhhhhhcc------cCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccC-chhh
Confidence            689999999999999987754      489999999999999886554 67999999999999999999876544 4456


Q ss_pred             HHHHHHHHHHcCCCchhHHHHhHhhcccCHHHHHHHHHHHhhcCcccHHHHHHHHHhcCChhhhhhhhhh
Q 017858           80 EELSCKVMKYAQGVPLALKVLGCFLHKREKEVWESATDKLQRILYPSILEVLKISYDSLDDKEKNIFLDV  149 (365)
Q Consensus        80 ~~~~~~i~~~c~glPlai~~~~~~l~~~~~~~w~~~~~~l~~~~~~~~~~~l~~sy~~L~~~~~~~~~~l  149 (365)
                      ++++++|+++|||+||||+++|+.++.++.+.|.+..+++......++..++.+||++||+++|+||.++
T Consensus       208 ~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         208 EDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence            7889999999999999999999999999999999999999887778889999999999999999999764
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure