Citrus Sinensis ID: 017874


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MSSPLYAAFCLPSSPYLSKFSRYRVTCCSGSQQKYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERETSISINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFRSSPESVLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGLIDFDVEISFPLDLYSLPRGYQKQKSKDSDQPHIITVQMLLEEILRNLKNAFWPFQHDRSRSLFLRAARAANCIDQLNSGDSGLQLASAKAARHRLERGVWNSVRFGDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNISVT
cccccHHHccccccccccccccccccccccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccc
cccccHHcccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccEccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccEEccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccc
mssplyaafclpsspylskfsryrvtccsgsqqkYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERETSISINKCVDLGKTALHIAaeddslishssvplpvdalisqlddlsvgycshyssgfrsspeSVLESIERYLFdkkgfrrtnarnqlieprsLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGlidfdveisfpldlyslprgyqkqkskdsdqphIITVQMLLEEILRNLKNafwpfqhdrsRSLFLRAARAANCidqlnsgdsgLQLASAKAARHRLErgvwnsvrfGDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNISVT
mssplyaaFCLPSSPYLSKFSRYRVTCCSGSQQKYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIkrlsnveretsiSINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYssgfrsspesvLESIERYLFdkkgfrrtnarnqlieprsLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGLIDFDVEISFPLDLYSLPRGYQkqkskdsdqphIITVQMLLEEILRNLKNAFWPFQHDRSRSLFLRAARAANCIDQLNSGDSGLQLASAKAARHRlergvwnsvrfGDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNISVT
MSSPLYAAFCLPSSPYLSKFSRYRVTCCSGSQQKYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERETSISINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFRSSPESVLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGLIDFDVEISFPLDLYSLPRGYQKQKSKDSDQPHIITVQMLLEEILRNLKNAFWPFQHDrsrslflraaraaNCIDQLNSGDSGLQLASAKAARHRLERGVWNSVRFGDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNISVT
****LYAAFCLPSSPYLSKFSRYRVTCCSGSQQKYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERETSISINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFR****SVLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGLIDFDVEISFPLDLYSLPRG************HIITVQMLLEEILRNLKNAFWPFQHDRSRSLFLRAARAANCIDQLNSGDSGLQLASAKAARHRLERGVWNSVRFGDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNI***
***PL***FCLPSSPYLSKFSRYRV************SDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERE**ISINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFRSSPESVLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGLIDFDVEISFPLDLYSLPRGYQKQKSKDSDQPHIITVQMLLEEILRNLKNAFWPFQHDRSRSLFLRAARAANCIDQLNSGDSGLQLASAKAARHRLERGVWNSVRFGDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYN****
MSSPLYAAFCLPSSPYLSKFSRYRVTCCSGSQQKYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERETSISINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYS*********VLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGLIDFDVEISFPLDLYSLPR***********QPHIITVQMLLEEILRNLKNAFWPFQHDRSRSLFLRAARAANCIDQLNSGDSGLQ**********LERGVWNSVRFGDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNISVT
**SPLYAAFCLPSSPYLSKFSRYRVTCCSGSQQKYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERETSISINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFRSSPESVLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGLIDFDVEISFPLDLYSLPRGYQKQKSKDSDQPHIITVQMLLEEILRNLKNAFWPFQHDRSRSLFLRAARAANCIDQLNSGDSGLQLASAKAARHRLERGVWNSVRFGDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNIS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSPLYAAFCLPSSPYLSKFSRYRVTCCSGSQQKYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERETSISINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFRSSPESVLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGLIDFDVEISFPLDLYSLPRGYQKQKSKDSDQPHIITVQMLLEEILRNLKNAFWPFQHDRSRSLFLRAARAANCIDQLNSGDSGLQLASAKAARHRLERGVWNSVRFGDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNISVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query364
359494997423 PREDICTED: uncharacterized protein LOC10 0.895 0.770 0.732 1e-137
296090330423 unnamed protein product [Vitis vinifera] 0.895 0.770 0.732 1e-137
357456475422 hypothetical protein MTR_3g014680 [Medic 0.942 0.812 0.650 1e-132
356510483 485 PREDICTED: uncharacterized protein LOC10 0.931 0.698 0.664 1e-128
255641242422 unknown [Glycine max] 0.931 0.803 0.649 1e-125
255543955 470 conserved hypothetical protein [Ricinus 0.868 0.672 0.694 1e-120
224057294426 predicted protein [Populus trichocarpa] 0.859 0.734 0.609 1e-113
224072891423 predicted protein [Populus trichocarpa] 0.901 0.775 0.602 1e-108
255543985355 conserved hypothetical protein [Ricinus 0.744 0.763 0.617 1e-95
224028949420 unknown [Zea mays] gi|414876983|tpg|DAA5 0.887 0.769 0.565 1e-93
>gi|359494997|ref|XP_002265457.2| PREDICTED: uncharacterized protein LOC100249731 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  494 bits (1273), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/333 (73%), Positives = 279/333 (83%), Gaps = 7/333 (2%)

Query: 24  RVTCCSGSQQKYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERETSISI 83
           RV C    + +Y + DLK  LH  LD++GTD   A+ AR+GF S+IKRLS++ERETSISI
Sbjct: 39  RVVC----RAQYASEDLKFVLHHALDALGTDIAHAKVARDGFCSEIKRLSDIERETSISI 94

Query: 84  NKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFRSSPESVL 143
           N+ VDLGKTAL+IAAEDDSLISHSSVPLPVDA I +LDDLS+ YCSHYSS FR+SPE   
Sbjct: 95  NRGVDLGKTALYIAAEDDSLISHSSVPLPVDAFIERLDDLSMDYCSHYSSAFRASPEIFF 154

Query: 144 ESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGL 203
           E++ERYL+  KGFRRTNA   L E R+LYLHSVLTHR+GSA MLSLIYSEILKMLR+WGL
Sbjct: 155 ETLERYLYINKGFRRTNA--NLSESRALYLHSVLTHRSGSAAMLSLIYSEILKMLRLWGL 212

Query: 204 IDFDVEISFPLDLYSLPRGYQKQKSKDSDQPHIITVQMLLEEILRNLKNAFWPFQHDRSR 263
           +DFDVEI FP D +SLPRGY KQKSK+SDQPHI+T Q L  E+LR+LK+AFWPFQHD +R
Sbjct: 213 LDFDVEIFFPHDSHSLPRGYHKQKSKESDQPHIMTSQSLFVEMLRSLKDAFWPFQHDNTR 272

Query: 264 SLFLRAARAANCIDQLN-SGDSGLQLASAKAARHRLERGVWNSVRFGDMRCALAACERLI 322
           SLFLRAA AANCID+ N   +SG +LASAKAA+HRLERGVW SVRFGDMR AL+ACERLI
Sbjct: 273 SLFLRAAHAANCIDRSNIVTESGFELASAKAAQHRLERGVWTSVRFGDMRRALSACERLI 332

Query: 323 LLESDAKELRDYSILLYHCGLYEQSLQYLKFYQ 355
           LLE+D  ELRDYSILLYHCG YEQSLQYLK YQ
Sbjct: 333 LLETDLTELRDYSILLYHCGFYEQSLQYLKLYQ 365




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296090330|emb|CBI40149.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357456475|ref|XP_003598518.1| hypothetical protein MTR_3g014680 [Medicago truncatula] gi|355487566|gb|AES68769.1| hypothetical protein MTR_3g014680 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356510483|ref|XP_003523967.1| PREDICTED: uncharacterized protein LOC100807902 [Glycine max] Back     alignment and taxonomy information
>gi|255641242|gb|ACU20898.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255543955|ref|XP_002513040.1| conserved hypothetical protein [Ricinus communis] gi|223548051|gb|EEF49543.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224057294|ref|XP_002299205.1| predicted protein [Populus trichocarpa] gi|222846463|gb|EEE84010.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224072891|ref|XP_002303930.1| predicted protein [Populus trichocarpa] gi|222841362|gb|EEE78909.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255543985|ref|XP_002513055.1| conserved hypothetical protein [Ricinus communis] gi|223548066|gb|EEF49558.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224028949|gb|ACN33550.1| unknown [Zea mays] gi|414876983|tpg|DAA54114.1| TPA: hypothetical protein ZEAMMB73_607929 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query364
TAIR|locus:2134791453 AT4G19160 [Arabidopsis thalian 0.153 0.123 0.423 5.4e-10
TAIR|locus:2134791 AT4G19160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 123 (48.4 bits), Expect = 5.4e-10, Sum P(3) = 5.4e-10
 Identities = 25/59 (42%), Positives = 39/59 (66%)

Query:   142 VLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRI 200
             VLE++   LFD +GF+RT+     ++P + YLHSVL  R  +A ++S+IY E+ K L +
Sbjct:   200 VLEAVNTVLFDLRGFKRTSIT---LDPENSYLHSVLNCRCSTAFLISVIYIEVCKRLNV 255


GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query364
pfam13369154 pfam13369, Transglut_core2, Transglutaminase-like 7e-07
COG2912269 COG2912, COG2912, Uncharacterized conserved protei 1e-04
>gnl|CDD|222080 pfam13369, Transglut_core2, Transglutaminase-like superfamily Back     alignment and domain information
 Score = 48.1 bits (115), Expect = 7e-07
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 136 RSSPESVLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEIL 195
            + P   LE++ R L+ + GF          +P + YL  VL  R G  + L+++Y E+ 
Sbjct: 21  EADPLEKLEALNRLLYGELGFSG--NSEDYYDPDNSYLDKVLERRRGIPISLAILYLELA 78

Query: 196 KMLRIWGLIDFDVE-ISFP 213
           + L         +E ++FP
Sbjct: 79  RRL------GLPLEGVNFP 91


Length = 154

>gnl|CDD|225464 COG2912, COG2912, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 364
PRK10941269 hypothetical protein; Provisional 100.0
COG2912269 Uncharacterized conserved protein [Function unknow 100.0
PF13369152 Transglut_core2: Transglutaminase-like superfamily 99.91
PF1337173 TPR_9: Tetratricopeptide repeat 98.55
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.53
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.75
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.28
PRK15359144 type III secretion system chaperone protein SscB; 95.87
PF13512142 TPR_18: Tetratricopeptide repeat 95.81
PRK11189 296 lipoprotein NlpI; Provisional 95.35
PRK15359144 type III secretion system chaperone protein SscB; 95.3
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.17
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.35
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.34
cd00189100 TPR Tetratricopeptide repeat domain; typically con 94.25
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.04
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 93.88
PF1343134 TPR_17: Tetratricopeptide repeat 93.72
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 93.3
cd00189100 TPR Tetratricopeptide repeat domain; typically con 93.2
PF13512142 TPR_18: Tetratricopeptide repeat 92.94
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 92.84
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.84
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 92.69
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 92.48
TIGR02552135 LcrH_SycD type III secretion low calcium response 92.36
PRK11189 296 lipoprotein NlpI; Provisional 92.18
PRK12370 553 invasion protein regulator; Provisional 91.66
TIGR03302 235 OM_YfiO outer membrane assembly lipoprotein YfiO. 91.63
PRK12370 553 invasion protein regulator; Provisional 91.41
PRK10370198 formate-dependent nitrite reductase complex subuni 91.37
KOG0553 304 consensus TPR repeat-containing protein [General f 91.3
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 91.29
PF03704146 BTAD: Bacterial transcriptional activator domain; 91.28
PRK10803263 tol-pal system protein YbgF; Provisional 91.2
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.9
COG4105 254 ComL DNA uptake lipoprotein [General function pred 90.66
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 90.63
PF01841113 Transglut_core: Transglutaminase-like superfamily; 90.63
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 90.28
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 90.11
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.86
KOG1126638 consensus DNA-binding cell division cycle control 89.44
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 89.32
PRK10370198 formate-dependent nitrite reductase complex subuni 89.26
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 89.08
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 88.71
CHL00033168 ycf3 photosystem I assembly protein Ycf3 88.71
PF1342844 TPR_14: Tetratricopeptide repeat 88.41
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 88.41
PRK02603172 photosystem I assembly protein Ycf3; Provisional 88.05
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 87.84
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 87.66
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 87.64
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 87.6
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 86.02
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 85.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 85.81
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 85.69
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 85.32
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 85.23
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 84.27
PRK11906458 transcriptional regulator; Provisional 84.24
PRK10803263 tol-pal system protein YbgF; Provisional 84.21
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 84.08
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 83.97
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 83.52
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 83.43
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 83.11
PF1342844 TPR_14: Tetratricopeptide repeat 83.11
PRK10747398 putative protoheme IX biogenesis protein; Provisio 83.03
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 82.95
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 82.48
PRK02603172 photosystem I assembly protein Ycf3; Provisional 82.36
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 82.3
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 81.93
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 81.55
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 80.61
PLN02789 320 farnesyltranstransferase 80.36
PRK11788389 tetratricopeptide repeat protein; Provisional 80.15
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 80.03
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-52  Score=402.22  Aligned_cols=217  Identities=19%  Similarity=0.180  Sum_probs=191.4

Q ss_pred             cCCCCcHHHHHHHHHhhcCCCCCCCCCCCCHHHHHHHHHHHHHHHhchhcCCCCCCHHHHHHHHHHHhhhhcCCccCCCC
Q 017874           83 INKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFRSSPESVLESIERYLFDKKGFRRTNAR  162 (364)
Q Consensus        83 ~~~~~dL~~aAL~IA~~~~p~~~~~~v~ldv~~~~~~Ld~La~ev~~~l~~~~~~~p~~~l~~Ln~~Ly~~~GF~g~~~~  162 (364)
                      ++++++|.+|||+||++.+|       ++|++++.++||+|+.+++..  ++...++.+++++||++||++|||+||++ 
T Consensus         8 ~~~~~~L~e~al~ia~~~~p-------dl~~~~~~~~L~~l~~~~~~~--l~~~~~~~~~l~~L~~~fy~~lgF~Gn~~-   77 (269)
T PRK10941          8 EFNKAPLCEGMILASQAIRR-------DFPSQDVYDELERLVSLAREE--ISQLLPQDEQLEKLIALFYGEWGFGGASG-   77 (269)
T ss_pred             cccCccHHHHHHHHHHHhCC-------CCCHHHHHHHHHHHHHHHHHh--ccccCCHHHHHHHHHHHHHHHhCCCCCcc-
Confidence            48899999999999999999       999999999999999999988  78889999999999999999999999999 


Q ss_pred             CCcCCcccccHHHHHhhccCChHHHHHHHHHHHHHhCCc--cc--------------------cCCCCeeeccccccccc
Q 017874          163 NQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIW--GL--------------------IDFDVEISFPLDLYSLP  220 (364)
Q Consensus       163 ~~Y~dp~Ns~L~~VLe~R~GiPIsL~iIylevArRLglp--Gv--------------------~~f~G~i~~p~d~~~l~  220 (364)
                       +||+|+|||||+||++|+|+|||||+||++||+|+|+|  ||                    ++|+|+++.+++|....
T Consensus        78 -~Y~~p~ns~L~~VL~~R~G~PisL~il~l~iA~~lglp~~gV~fPghfllr~~~~d~~~~~IDPf~G~~L~~~~l~~~L  156 (269)
T PRK10941         78 -VYRLSDALWLDKVLKTRQGSAVSLGAILLWIANRLDLPLMPVIFPTQLILRADWLDGEMWLINPFNGETLDEHTLEVWL  156 (269)
T ss_pred             -ccCCchhhHHHHHHHccCCCcHHHHHHHHHHHHHcCCCeeeeecCchheeeeecCCCceEEEeCCCCCCCCHHHHHHHH
Confidence             99999999999999999999999999999999999999  66                    22334444444443322


Q ss_pred             ccccCC-CCCCCCCCCCCChHHHHHHHHHHHHHhccccccccchhhHHHHHHHhhhhhhccCCCchhhhhhHHHhhhhhh
Q 017874          221 RGYQKQ-KSKDSDQPHIITVQMLLEEILRNLKNAFWPFQHDRSRSLFLRAARAANCIDQLNSGDSGLQLASAKAARHRLE  299 (364)
Q Consensus       221 ~~~~~~-~~~~~~~~~~~s~r~IL~RmL~NLK~~y~~~~~~~~~~l~l~a~~~a~~~~~~~~~~~~~~~~~~~~a~~rl~  299 (364)
                      +++.++ ....++.+.+++|++|+.|||+|||.+|++++                                         
T Consensus       157 ~~~~g~~~~l~~~~L~~a~~~~il~Rml~nLK~~~~~~~-----------------------------------------  195 (269)
T PRK10941        157 KGNISPSAELFNEDLDEADNIEVIRKLLDTLKAALMEEK-----------------------------------------  195 (269)
T ss_pred             HhhcCCcccCCHHHcCCCCHHHHHHHHHHHHHHHHHHcC-----------------------------------------
Confidence            333333 22344567889999999999999999997765                                         


Q ss_pred             hccccccCcCCHHHHHHHHHHHhccCC-ChHHHHHHhHHHHHcCChHHHHHHHHHHHHHhcCc
Q 017874          300 RGVWNSVRFGDMRCALAACERLILLES-DAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNI  361 (364)
Q Consensus       300 ~~~~~~lr~~d~~~AL~a~ErLllL~P-dp~e~RDrGlLl~~lg~~~~A~~dL~~fl~~~~~~  361 (364)
                                +|++||+|+||++.+.| ||+|+||||++|+|+||++.|+.||++|++++|+-
T Consensus       196 ----------~~~~AL~~~e~ll~l~P~dp~e~RDRGll~~qL~c~~~A~~DL~~fl~~~P~d  248 (269)
T PRK10941        196 ----------QMELALRASEALLQFDPEDPYEIRDRGLIYAQLDCEHVALSDLSYFVEQCPED  248 (269)
T ss_pred             ----------cHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCcHHHHHHHHHHHHhCCCc
Confidence                      99999999999999999 79999999999999999999999999999999974



>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13369 Transglut_core2: Transglutaminase-like superfamily Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF01841 Transglut_core: Transglutaminase-like superfamily; InterPro: IPR002931 This domain is found in many proteins known to have transglutaminase activity, i Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query364
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 58.7 bits (141), Expect = 2e-09
 Identities = 55/355 (15%), Positives = 119/355 (33%), Gaps = 87/355 (24%)

Query: 62  REGFYSQIKR-LSNVERETSISINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQL 120
           R   Y ++++ L  +    ++ I+  +  GKT + +                   +  ++
Sbjct: 133 RLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLS------------YKVQCKM 180

Query: 121 DD----LSVGYCSHYSSGFRSSPESVLESIER--YLFDKKGFRRTNARNQL---IEPRSL 171
           D     L++  C+        SPE+VLE +++  Y  D     R++  + +   I     
Sbjct: 181 DFKIFWLNLKNCN--------SPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQA 232

Query: 172 YLHSVLTHRTGSAVMLSL--IYS-EIL-------KML---RIWGLIDF-DVEISFPLDLY 217
            L  +L  +     +L L  + + +         K+L   R   + DF     +  + L 
Sbjct: 233 ELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLD 292

Query: 218 SLPRGYQKQKSKD----------SDQPHIITVQM---------LLEEILRNLKNAFWPFQ 258
                    + K            D P     ++         ++ E +R+    +  ++
Sbjct: 293 HHSMTLTPDEVKSLLLKYLDCRPQDLPR----EVLTTNPRRLSIIAESIRDGLATWDNWK 348

Query: 259 H---DRSRSLFLRAARAANCIDQLNSGDSG---LQLA----SAKAARHRLERGVWNSVRF 308
           H   D+  ++        + ++ L   +      +L+    SA      L   +W  V  
Sbjct: 349 HVNCDKLTTII------ESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSL-IWFDVIK 401

Query: 309 GDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQA--QWYNI 361
            D+   +    +  L+E   KE    SI   +  L  +       +++    YNI
Sbjct: 402 SDVMVVVNKLHKYSLVEKQPKEST-ISIPSIYLELKVKLENEYALHRSIVDHYNI 455


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query364
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.9
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 96.85
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.85
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.8
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.77
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.75
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.72
3k9i_A117 BH0479 protein; putative protein binding protein, 96.71
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.7
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.69
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.62
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.56
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.54
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.52
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.52
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.49
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.44
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.41
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.36
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.35
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.35
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.23
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.17
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.13
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.08
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.08
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.01
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.0
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 95.97
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.97
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.91
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.77
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.76
3vtx_A 184 MAMA; tetratricopeptide repeats (TPR) containing p 95.74
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.71
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 95.66
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 95.66
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.61
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.47
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.46
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.44
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.39
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.38
3k9i_A117 BH0479 protein; putative protein binding protein, 95.35
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 95.35
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.34
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 95.32
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.26
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.07
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.07
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.05
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.01
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.01
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 94.97
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 94.95
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 94.93
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.9
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 94.89
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.86
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 94.8
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 94.43
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 94.36
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 94.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 94.24
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 94.21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 94.12
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 94.07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.05
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 93.98
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 93.92
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 93.84
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 93.83
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 93.81
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 93.78
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.61
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 93.61
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 93.55
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.54
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 93.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 93.43
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 93.41
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 93.35
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 93.23
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 93.1
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 93.0
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 92.94
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 92.94
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 92.92
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 92.9
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 92.86
4eqf_A365 PEX5-related protein; accessory protein, tetratric 92.83
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 92.75
2gw1_A 514 Mitochondrial precursor proteins import receptor; 92.75
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 92.67
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 92.6
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 92.52
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 92.46
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 92.4
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 92.26
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 92.2
3u4t_A 272 TPR repeat-containing protein; structural genomics 92.13
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 92.13
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 91.93
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 91.91
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 91.84
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 91.8
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 91.75
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 91.64
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 91.6
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 91.59
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 91.59
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 91.58
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 91.56
3u4t_A272 TPR repeat-containing protein; structural genomics 91.49
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 91.39
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 91.36
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 91.17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 91.04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 90.84
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 90.82
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 90.8
2gw1_A 514 Mitochondrial precursor proteins import receptor; 90.37
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 90.33
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 89.98
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 89.93
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 89.88
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 89.81
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 89.67
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 89.05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 88.4
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 87.87
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 86.89
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 86.76
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 86.4
3isr_A293 Transglutaminase-like enzymes, putative cysteine; 86.37
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 86.15
3kd4_A506 Putative protease; structural genomics, joint cent 85.91
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 85.73
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 84.68
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 84.41
1pc2_A152 Mitochondria fission protein; unknown function; NM 84.24
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 83.78
4g1t_A 472 Interferon-induced protein with tetratricopeptide 83.48
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 83.44
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 83.09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 83.07
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 82.42
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 81.89
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 81.55
2l6j_A111 TPR repeat-containing protein associated with HSP; 81.38
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 81.24
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 81.11
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 81.01
3qww_A433 SET and MYND domain-containing protein 2; methyltr 80.88
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
Probab=96.90  E-value=0.0018  Score=49.25  Aligned_cols=55  Identities=18%  Similarity=0.175  Sum_probs=51.4

Q ss_pred             CcCCHHHHHHHHHHHhccCC-ChHHHHHHhHHHHHcCChHHHHHHHHHHHHHhcCc
Q 017874          307 RFGDMRCALAACERLILLES-DAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNI  361 (364)
Q Consensus       307 r~~d~~~AL~a~ErLllL~P-dp~e~RDrGlLl~~lg~~~~A~~dL~~fl~~~~~~  361 (364)
                      ..|+++.|+...++.+.++| ++..+..+|.+++++|+|++|+..++..++..|+.
T Consensus        16 ~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~   71 (111)
T 2l6j_A           16 KQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTA   71 (111)
T ss_dssp             TTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHTSCSST
T ss_pred             HcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCc
Confidence            57899999999999999999 67889999999999999999999999999988875



>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3isr_A Transglutaminase-like enzymes, putative cysteine; protease, hutchinsoni MCSG, structural genomics; 1.90A {Cytophaga hutchinsonii} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3kd4_A Putative protease; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 2.00A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query364
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.95
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.87
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.77
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.67
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.63
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.59
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.56
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.56
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.39
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.28
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 96.18
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.09
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.02
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 95.96
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.76
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 95.64
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 95.53
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 95.34
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.12
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 95.09
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.01
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.79
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 94.34
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 93.26
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 93.07
d1hh8a_ 192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 91.77
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 91.34
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.13
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 88.47
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 88.23
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 86.92
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 86.71
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 86.41
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 86.21
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 86.09
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 84.92
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 84.75
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 83.26
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP52 (FKBP4), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.95  E-value=0.0015  Score=54.23  Aligned_cols=54  Identities=15%  Similarity=0.180  Sum_probs=50.3

Q ss_pred             cCCHHHHHHHHHHHhccCC-ChHHHHHHhHHHHHcCChHHHHHHHHHHHHHhcCc
Q 017874          308 FGDMRCALAACERLILLES-DAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNI  361 (364)
Q Consensus       308 ~~d~~~AL~a~ErLllL~P-dp~e~RDrGlLl~~lg~~~~A~~dL~~fl~~~~~~  361 (364)
                      .|+++.|+..+++.|.++| ++..+.-+|.+|+++|.|.+|+.+++..++.-|+.
T Consensus        75 ~~~~~~A~~~~~~al~~~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~P~n  129 (170)
T d1p5qa1          75 LQAFSAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNN  129 (170)
T ss_dssp             TTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSSC
T ss_pred             hhhcccccchhhhhhhccccchhhhHHHHHHHHHhhhHHHHHHHHHHHHHhCCCC
Confidence            4599999999999999999 67789999999999999999999999999998864



>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure