Citrus Sinensis ID: 017874
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 364 | ||||||
| 359494997 | 423 | PREDICTED: uncharacterized protein LOC10 | 0.895 | 0.770 | 0.732 | 1e-137 | |
| 296090330 | 423 | unnamed protein product [Vitis vinifera] | 0.895 | 0.770 | 0.732 | 1e-137 | |
| 357456475 | 422 | hypothetical protein MTR_3g014680 [Medic | 0.942 | 0.812 | 0.650 | 1e-132 | |
| 356510483 | 485 | PREDICTED: uncharacterized protein LOC10 | 0.931 | 0.698 | 0.664 | 1e-128 | |
| 255641242 | 422 | unknown [Glycine max] | 0.931 | 0.803 | 0.649 | 1e-125 | |
| 255543955 | 470 | conserved hypothetical protein [Ricinus | 0.868 | 0.672 | 0.694 | 1e-120 | |
| 224057294 | 426 | predicted protein [Populus trichocarpa] | 0.859 | 0.734 | 0.609 | 1e-113 | |
| 224072891 | 423 | predicted protein [Populus trichocarpa] | 0.901 | 0.775 | 0.602 | 1e-108 | |
| 255543985 | 355 | conserved hypothetical protein [Ricinus | 0.744 | 0.763 | 0.617 | 1e-95 | |
| 224028949 | 420 | unknown [Zea mays] gi|414876983|tpg|DAA5 | 0.887 | 0.769 | 0.565 | 1e-93 |
| >gi|359494997|ref|XP_002265457.2| PREDICTED: uncharacterized protein LOC100249731 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 494 bits (1273), Expect = e-137, Method: Compositional matrix adjust.
Identities = 244/333 (73%), Positives = 279/333 (83%), Gaps = 7/333 (2%)
Query: 24 RVTCCSGSQQKYVASDLKLALHDVLDSIGTDTTFAREAREGFYSQIKRLSNVERETSISI 83
RV C + +Y + DLK LH LD++GTD A+ AR+GF S+IKRLS++ERETSISI
Sbjct: 39 RVVC----RAQYASEDLKFVLHHALDALGTDIAHAKVARDGFCSEIKRLSDIERETSISI 94
Query: 84 NKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFRSSPESVL 143
N+ VDLGKTAL+IAAEDDSLISHSSVPLPVDA I +LDDLS+ YCSHYSS FR+SPE
Sbjct: 95 NRGVDLGKTALYIAAEDDSLISHSSVPLPVDAFIERLDDLSMDYCSHYSSAFRASPEIFF 154
Query: 144 ESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIWGL 203
E++ERYL+ KGFRRTNA L E R+LYLHSVLTHR+GSA MLSLIYSEILKMLR+WGL
Sbjct: 155 ETLERYLYINKGFRRTNA--NLSESRALYLHSVLTHRSGSAAMLSLIYSEILKMLRLWGL 212
Query: 204 IDFDVEISFPLDLYSLPRGYQKQKSKDSDQPHIITVQMLLEEILRNLKNAFWPFQHDRSR 263
+DFDVEI FP D +SLPRGY KQKSK+SDQPHI+T Q L E+LR+LK+AFWPFQHD +R
Sbjct: 213 LDFDVEIFFPHDSHSLPRGYHKQKSKESDQPHIMTSQSLFVEMLRSLKDAFWPFQHDNTR 272
Query: 264 SLFLRAARAANCIDQLN-SGDSGLQLASAKAARHRLERGVWNSVRFGDMRCALAACERLI 322
SLFLRAA AANCID+ N +SG +LASAKAA+HRLERGVW SVRFGDMR AL+ACERLI
Sbjct: 273 SLFLRAAHAANCIDRSNIVTESGFELASAKAAQHRLERGVWTSVRFGDMRRALSACERLI 332
Query: 323 LLESDAKELRDYSILLYHCGLYEQSLQYLKFYQ 355
LLE+D ELRDYSILLYHCG YEQSLQYLK YQ
Sbjct: 333 LLETDLTELRDYSILLYHCGFYEQSLQYLKLYQ 365
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296090330|emb|CBI40149.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357456475|ref|XP_003598518.1| hypothetical protein MTR_3g014680 [Medicago truncatula] gi|355487566|gb|AES68769.1| hypothetical protein MTR_3g014680 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356510483|ref|XP_003523967.1| PREDICTED: uncharacterized protein LOC100807902 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255641242|gb|ACU20898.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255543955|ref|XP_002513040.1| conserved hypothetical protein [Ricinus communis] gi|223548051|gb|EEF49543.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224057294|ref|XP_002299205.1| predicted protein [Populus trichocarpa] gi|222846463|gb|EEE84010.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224072891|ref|XP_002303930.1| predicted protein [Populus trichocarpa] gi|222841362|gb|EEE78909.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255543985|ref|XP_002513055.1| conserved hypothetical protein [Ricinus communis] gi|223548066|gb|EEF49558.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224028949|gb|ACN33550.1| unknown [Zea mays] gi|414876983|tpg|DAA54114.1| TPA: hypothetical protein ZEAMMB73_607929 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 364 | ||||||
| TAIR|locus:2134791 | 453 | AT4G19160 [Arabidopsis thalian | 0.153 | 0.123 | 0.423 | 5.4e-10 |
| TAIR|locus:2134791 AT4G19160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 123 (48.4 bits), Expect = 5.4e-10, Sum P(3) = 5.4e-10
Identities = 25/59 (42%), Positives = 39/59 (66%)
Query: 142 VLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRI 200
VLE++ LFD +GF+RT+ ++P + YLHSVL R +A ++S+IY E+ K L +
Sbjct: 200 VLEAVNTVLFDLRGFKRTSIT---LDPENSYLHSVLNCRCSTAFLISVIYIEVCKRLNV 255
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 364 | |||
| pfam13369 | 154 | pfam13369, Transglut_core2, Transglutaminase-like | 7e-07 | |
| COG2912 | 269 | COG2912, COG2912, Uncharacterized conserved protei | 1e-04 |
| >gnl|CDD|222080 pfam13369, Transglut_core2, Transglutaminase-like superfamily | Back alignment and domain information |
|---|
Score = 48.1 bits (115), Expect = 7e-07
Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 9/79 (11%)
Query: 136 RSSPESVLESIERYLFDKKGFRRTNARNQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEIL 195
+ P LE++ R L+ + GF +P + YL VL R G + L+++Y E+
Sbjct: 21 EADPLEKLEALNRLLYGELGFSG--NSEDYYDPDNSYLDKVLERRRGIPISLAILYLELA 78
Query: 196 KMLRIWGLIDFDVE-ISFP 213
+ L +E ++FP
Sbjct: 79 RRL------GLPLEGVNFP 91
|
Length = 154 |
| >gnl|CDD|225464 COG2912, COG2912, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 364 | |||
| PRK10941 | 269 | hypothetical protein; Provisional | 100.0 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 100.0 | |
| PF13369 | 152 | Transglut_core2: Transglutaminase-like superfamily | 99.91 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.55 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.53 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 96.75 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.28 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.87 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 95.81 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 95.35 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.3 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 95.17 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 94.35 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 94.34 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 94.25 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 94.04 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 93.88 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 93.72 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 93.3 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 93.2 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 92.94 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 92.84 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 92.84 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 92.69 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 92.48 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 92.36 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 92.18 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 91.66 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 91.63 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 91.41 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 91.37 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 91.3 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 91.29 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 91.28 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 91.2 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 90.9 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 90.66 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 90.63 | |
| PF01841 | 113 | Transglut_core: Transglutaminase-like superfamily; | 90.63 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 90.28 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 90.11 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 89.86 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 89.44 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 89.32 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 89.26 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 89.08 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 88.71 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 88.71 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 88.41 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 88.41 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 88.05 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 87.84 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 87.66 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 87.64 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 87.6 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 86.02 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 85.87 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 85.81 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 85.69 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 85.32 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 85.23 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 84.27 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 84.24 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 84.21 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 84.08 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 83.97 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 83.52 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 83.43 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 83.11 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 83.11 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 83.03 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 82.95 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 82.48 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 82.36 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 82.3 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 81.93 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 81.55 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 80.61 | |
| PLN02789 | 320 | farnesyltranstransferase | 80.36 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 80.15 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 80.03 |
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-52 Score=402.22 Aligned_cols=217 Identities=19% Similarity=0.180 Sum_probs=191.4
Q ss_pred cCCCCcHHHHHHHHHhhcCCCCCCCCCCCCHHHHHHHHHHHHHHHhchhcCCCCCCHHHHHHHHHHHhhhhcCCccCCCC
Q 017874 83 INKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQLDDLSVGYCSHYSSGFRSSPESVLESIERYLFDKKGFRRTNAR 162 (364)
Q Consensus 83 ~~~~~dL~~aAL~IA~~~~p~~~~~~v~ldv~~~~~~Ld~La~ev~~~l~~~~~~~p~~~l~~Ln~~Ly~~~GF~g~~~~ 162 (364)
++++++|.+|||+||++.+| ++|++++.++||+|+.+++.. ++...++.+++++||++||++|||+||++
T Consensus 8 ~~~~~~L~e~al~ia~~~~p-------dl~~~~~~~~L~~l~~~~~~~--l~~~~~~~~~l~~L~~~fy~~lgF~Gn~~- 77 (269)
T PRK10941 8 EFNKAPLCEGMILASQAIRR-------DFPSQDVYDELERLVSLAREE--ISQLLPQDEQLEKLIALFYGEWGFGGASG- 77 (269)
T ss_pred cccCccHHHHHHHHHHHhCC-------CCCHHHHHHHHHHHHHHHHHh--ccccCCHHHHHHHHHHHHHHHhCCCCCcc-
Confidence 48899999999999999999 999999999999999999988 78889999999999999999999999999
Q ss_pred CCcCCcccccHHHHHhhccCChHHHHHHHHHHHHHhCCc--cc--------------------cCCCCeeeccccccccc
Q 017874 163 NQLIEPRSLYLHSVLTHRTGSAVMLSLIYSEILKMLRIW--GL--------------------IDFDVEISFPLDLYSLP 220 (364)
Q Consensus 163 ~~Y~dp~Ns~L~~VLe~R~GiPIsL~iIylevArRLglp--Gv--------------------~~f~G~i~~p~d~~~l~ 220 (364)
+||+|+|||||+||++|+|+|||||+||++||+|+|+| || ++|+|+++.+++|....
T Consensus 78 -~Y~~p~ns~L~~VL~~R~G~PisL~il~l~iA~~lglp~~gV~fPghfllr~~~~d~~~~~IDPf~G~~L~~~~l~~~L 156 (269)
T PRK10941 78 -VYRLSDALWLDKVLKTRQGSAVSLGAILLWIANRLDLPLMPVIFPTQLILRADWLDGEMWLINPFNGETLDEHTLEVWL 156 (269)
T ss_pred -ccCCchhhHHHHHHHccCCCcHHHHHHHHHHHHHcCCCeeeeecCchheeeeecCCCceEEEeCCCCCCCCHHHHHHHH
Confidence 99999999999999999999999999999999999999 66 22334444444443322
Q ss_pred ccccCC-CCCCCCCCCCCChHHHHHHHHHHHHHhccccccccchhhHHHHHHHhhhhhhccCCCchhhhhhHHHhhhhhh
Q 017874 221 RGYQKQ-KSKDSDQPHIITVQMLLEEILRNLKNAFWPFQHDRSRSLFLRAARAANCIDQLNSGDSGLQLASAKAARHRLE 299 (364)
Q Consensus 221 ~~~~~~-~~~~~~~~~~~s~r~IL~RmL~NLK~~y~~~~~~~~~~l~l~a~~~a~~~~~~~~~~~~~~~~~~~~a~~rl~ 299 (364)
+++.++ ....++.+.+++|++|+.|||+|||.+|++++
T Consensus 157 ~~~~g~~~~l~~~~L~~a~~~~il~Rml~nLK~~~~~~~----------------------------------------- 195 (269)
T PRK10941 157 KGNISPSAELFNEDLDEADNIEVIRKLLDTLKAALMEEK----------------------------------------- 195 (269)
T ss_pred HhhcCCcccCCHHHcCCCCHHHHHHHHHHHHHHHHHHcC-----------------------------------------
Confidence 333333 22344567889999999999999999997765
Q ss_pred hccccccCcCCHHHHHHHHHHHhccCC-ChHHHHHHhHHHHHcCChHHHHHHHHHHHHHhcCc
Q 017874 300 RGVWNSVRFGDMRCALAACERLILLES-DAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNI 361 (364)
Q Consensus 300 ~~~~~~lr~~d~~~AL~a~ErLllL~P-dp~e~RDrGlLl~~lg~~~~A~~dL~~fl~~~~~~ 361 (364)
+|++||+|+||++.+.| ||+|+||||++|+|+||++.|+.||++|++++|+-
T Consensus 196 ----------~~~~AL~~~e~ll~l~P~dp~e~RDRGll~~qL~c~~~A~~DL~~fl~~~P~d 248 (269)
T PRK10941 196 ----------QMELALRASEALLQFDPEDPYEIRDRGLIYAQLDCEHVALSDLSYFVEQCPED 248 (269)
T ss_pred ----------cHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCcHHHHHHHHHHHHhCCCc
Confidence 99999999999999999 79999999999999999999999999999999974
|
|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13369 Transglut_core2: Transglutaminase-like superfamily | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF01841 Transglut_core: Transglutaminase-like superfamily; InterPro: IPR002931 This domain is found in many proteins known to have transglutaminase activity, i | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 364 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-09 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 58.7 bits (141), Expect = 2e-09
Identities = 55/355 (15%), Positives = 119/355 (33%), Gaps = 87/355 (24%)
Query: 62 REGFYSQIKR-LSNVERETSISINKCVDLGKTALHIAAEDDSLISHSSVPLPVDALISQL 120
R Y ++++ L + ++ I+ + GKT + + + ++
Sbjct: 133 RLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLS------------YKVQCKM 180
Query: 121 DD----LSVGYCSHYSSGFRSSPESVLESIER--YLFDKKGFRRTNARNQL---IEPRSL 171
D L++ C+ SPE+VLE +++ Y D R++ + + I
Sbjct: 181 DFKIFWLNLKNCN--------SPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQA 232
Query: 172 YLHSVLTHRTGSAVMLSL--IYS-EIL-------KML---RIWGLIDF-DVEISFPLDLY 217
L +L + +L L + + + K+L R + DF + + L
Sbjct: 233 ELRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLD 292
Query: 218 SLPRGYQKQKSKD----------SDQPHIITVQM---------LLEEILRNLKNAFWPFQ 258
+ K D P ++ ++ E +R+ + ++
Sbjct: 293 HHSMTLTPDEVKSLLLKYLDCRPQDLPR----EVLTTNPRRLSIIAESIRDGLATWDNWK 348
Query: 259 H---DRSRSLFLRAARAANCIDQLNSGDSG---LQLA----SAKAARHRLERGVWNSVRF 308
H D+ ++ + ++ L + +L+ SA L +W V
Sbjct: 349 HVNCDKLTTII------ESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSL-IWFDVIK 401
Query: 309 GDMRCALAACERLILLESDAKELRDYSILLYHCGLYEQSLQYLKFYQA--QWYNI 361
D+ + + L+E KE SI + L + +++ YNI
Sbjct: 402 SDVMVVVNKLHKYSLVEKQPKEST-ISIPSIYLELKVKLENEYALHRSIVDHYNI 455
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 364 | |||
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 96.9 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 96.85 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 96.85 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 96.8 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 96.77 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.75 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 96.72 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 96.71 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.7 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 96.69 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.62 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.62 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 96.56 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.54 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 96.52 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 96.52 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.49 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 96.44 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 96.41 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 96.36 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 96.35 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 96.35 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 96.35 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 96.23 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.17 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 96.13 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 96.08 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.08 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 96.07 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 96.01 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 96.0 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 95.97 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 95.97 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 95.91 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 95.77 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 95.76 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 95.74 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 95.71 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 95.66 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 95.66 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 95.61 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 95.47 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 95.46 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 95.44 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 95.39 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 95.38 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 95.35 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 95.35 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 95.34 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 95.32 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 95.26 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 95.07 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 95.07 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 95.05 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 95.01 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 95.01 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 94.97 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 94.95 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 94.93 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 94.9 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 94.89 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 94.86 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 94.8 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 94.43 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 94.36 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 94.33 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 94.24 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 94.21 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 94.12 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 94.07 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 94.05 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 93.98 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 93.92 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 93.84 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 93.83 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 93.81 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 93.78 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 93.61 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 93.61 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 93.55 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 93.54 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 93.52 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 93.43 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 93.41 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 93.35 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 93.23 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 93.1 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 93.0 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 92.94 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 92.94 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 92.92 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 92.9 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 92.86 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 92.83 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 92.75 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 92.75 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 92.67 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 92.6 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 92.52 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 92.46 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 92.4 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 92.26 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 92.2 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 92.13 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 92.13 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 91.93 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 91.91 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 91.84 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 91.8 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 91.75 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 91.64 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 91.6 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 91.59 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 91.59 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 91.58 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 91.56 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 91.49 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 91.39 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 91.36 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 91.17 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 91.04 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 90.84 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 90.82 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 90.8 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 90.37 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 90.33 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 89.98 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 89.93 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 89.88 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 89.81 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 89.67 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 89.05 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 88.4 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 87.87 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 86.89 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 86.76 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 86.4 | |
| 3isr_A | 293 | Transglutaminase-like enzymes, putative cysteine; | 86.37 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 86.15 | |
| 3kd4_A | 506 | Putative protease; structural genomics, joint cent | 85.91 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 85.73 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 84.68 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 84.41 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 84.24 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 83.78 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 83.48 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 83.44 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 83.09 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 83.07 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 82.42 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 81.89 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 81.55 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 81.38 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 81.24 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 81.11 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 81.01 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 80.88 |
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=96.90 E-value=0.0018 Score=49.25 Aligned_cols=55 Identities=18% Similarity=0.175 Sum_probs=51.4
Q ss_pred CcCCHHHHHHHHHHHhccCC-ChHHHHHHhHHHHHcCChHHHHHHHHHHHHHhcCc
Q 017874 307 RFGDMRCALAACERLILLES-DAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNI 361 (364)
Q Consensus 307 r~~d~~~AL~a~ErLllL~P-dp~e~RDrGlLl~~lg~~~~A~~dL~~fl~~~~~~ 361 (364)
..|+++.|+...++.+.++| ++..+..+|.+++++|+|++|+..++..++..|+.
T Consensus 16 ~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~ 71 (111)
T 2l6j_A 16 KQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTA 71 (111)
T ss_dssp TTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHTSCSST
T ss_pred HcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCc
Confidence 57899999999999999999 67889999999999999999999999999988875
|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3isr_A Transglutaminase-like enzymes, putative cysteine; protease, hutchinsoni MCSG, structural genomics; 1.90A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3kd4_A Putative protease; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 2.00A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 364 | |||
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 96.95 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 96.87 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 96.77 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.67 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 96.63 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 96.59 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.56 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.56 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 96.39 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.28 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 96.18 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 96.09 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 96.02 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 95.96 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 95.76 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 95.64 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 95.53 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 95.34 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.12 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 95.09 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.01 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 94.79 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 94.34 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 93.26 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 93.07 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 91.77 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 91.34 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 90.13 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 88.47 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 88.23 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 86.92 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 86.71 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 86.41 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 86.21 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 86.09 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 84.92 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 84.75 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 83.26 |
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: FKBP52 (FKBP4), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.95 E-value=0.0015 Score=54.23 Aligned_cols=54 Identities=15% Similarity=0.180 Sum_probs=50.3
Q ss_pred cCCHHHHHHHHHHHhccCC-ChHHHHHHhHHHHHcCChHHHHHHHHHHHHHhcCc
Q 017874 308 FGDMRCALAACERLILLES-DAKELRDYSILLYHCGLYEQSLQYLKFYQAQWYNI 361 (364)
Q Consensus 308 ~~d~~~AL~a~ErLllL~P-dp~e~RDrGlLl~~lg~~~~A~~dL~~fl~~~~~~ 361 (364)
.|+++.|+..+++.|.++| ++..+.-+|.+|+++|.|.+|+.+++..++.-|+.
T Consensus 75 ~~~~~~A~~~~~~al~~~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~P~n 129 (170)
T d1p5qa1 75 LQAFSAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNN 129 (170)
T ss_dssp TTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSSC
T ss_pred hhhcccccchhhhhhhccccchhhhHHHHHHHHHhhhHHHHHHHHHHHHHhCCCC
Confidence 4599999999999999999 67789999999999999999999999999998864
|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|