Citrus Sinensis ID: 018037

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--

MALSKLSSPSSLSTNILKPLTNSFLLHRPISTDTTPLTIETSVPFTSHQCEAPSRSVETTPKELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKEGRQ

cccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccHHHHHHHHHHccccccEEEEcccccHHHHcccccHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHccHHHHHHcccccccEEccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccc

ccHHHHHcccccHHHHHHHHHHHHEEccccccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHEEHHHHHHcccccEEEEEccHccHEEHccccHHHHHHHHHcccccccccccccEEEEcccccccccccEEcccccHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHccccEEEEEEcccccccccHHHHcccccHHHccccccccEEcHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccccccccccHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccc

malsklsspsslstnilkpltnsfllhrpistdttpltietsvpftshqceapsrsvettpKELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELmgrkdgcshgkggsmhfykkdsgfygghgivgaqiplgcglafaqkyskdetvtfalygdgaanqgQLFEALNIAalwdlpailvcennhygmgtaewraakspsyykrgdyvpglkvdgMDALAVKQACKFAKEHalkngpmilemdtyryhghsmsdpgstyrtrdeisgvrqerdpIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKEGRQ

malsklsspsslstniLKPLTNSFLLHRPISTDTTPLTIETSVPftshqceapsrsvettpkELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAewraakspsyYKRGDYVPGLKVDGMDALAVKQACKFAKehalkngpmILEMDTYRYHGHsmsdpgstyrtrdeisgvrqerdpieRIRKLilahdlatekelkdiekeVRKEVDDAIAKAKEGRQ

MAlsklsspsslsTNILKPLTNSFLLHRPISTDTTPLTIETSVPFTSHQCEAPSRSVETTPKELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKEGRQ

****************LKPLTNSFLLHRPISTDTTPLTIE***********************LLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYH****************************RIRKLILAHDL*****************************

**************************************************************ELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKE***

************STNILKPLTNSFLLHRPISTDTTPLTIETSVPFTS************TPKELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDA*********

***********LST***KPLTNSFLLHRPISTDTTPLTIETSVPFTSHQCEAPSRSVETTPKELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHS******TYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKE***

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		362	2.2.26 [Sep-21-2011]
Q8H1Y0		393	Pyruvate dehydrogenase E1	yes	no	0.983	0.905	0.822	0.0
P52901		389	Pyruvate dehydrogenase E1	no	no	0.977	0.910	0.838	0.0
P52902		397	Pyruvate dehydrogenase E1	N/A	no	0.941	0.858	0.865	0.0
Q6Z5N4		390	Pyruvate dehydrogenase E1	yes	no	0.933	0.866	0.837	1e-175
P52903		391	Pyruvate dehydrogenase E1	N/A	no	0.972	0.900	0.807	1e-174
Q654V6		398	Pyruvate dehydrogenase E1	no	no	0.917	0.834	0.786	1e-163
Q54C70		377	Pyruvate dehydrogenase E1	yes	no	0.853	0.819	0.605	1e-109
P52899		397	Probable pyruvate dehydro	yes	no	0.950	0.866	0.544	1e-103
Q10489		409	Pyruvate dehydrogenase E1	yes	no	0.886	0.784	0.553	1e-101
P16387		420	Pyruvate dehydrogenase E1	yes	no	0.878	0.757	0.546	1e-101

>sp\|Q8H1Y0\|ODPA2_ARATH Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial OS=Arabidopsis thaliana GN=IAR4 PE=1 SV=2	Back alignment and function desciption

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/361 (82%), Positives = 333/361 (92%), Gaps = 5/361 (1%)

Query: 1   MALSKLSSPSSLSTNILKPLTNSF--LLHRPISTDTTPLTIETSVPFTSHQCEAPSRSVE 58
           MALS+LSS S+     LKP   +    + R +STD++P+TIET+VPFTSH CE+PSRSVE
Sbjct: 1   MALSRLSSRSN---TFLKPAITALPSSIRRHVSTDSSPITIETAVPFTSHLCESPSRSVE 57

Query: 59  TTPKELLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSII 118
           T+ +E+L+FFR MA MRRMEIAADSLYKAKL+RGFCHLYDGQEA+A+GMEA ITKKD+II
Sbjct: 58  TSSEEILAFFRDMARMRRMEIAADSLYKAKLIRGFCHLYDGQEALAVGMEAAITKKDAII 117

Query: 119 TAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPL 178
           T+YRDHCTF+GRGG L++ FSELMGRK GCSHGKGGSMHFYKKD+ FYGGHGIVGAQIPL
Sbjct: 118 TSYRDHCTFIGRGGKLVDAFSELMGRKTGCSHGKGGSMHFYKKDASFYGGHGIVGAQIPL 177

Query: 179 GCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAE 238
           GCGLAFAQKY+KDE VTFALYGDGAANQGQLFEALNI+ALWDLPAILVCENNHYGMGTA 
Sbjct: 178 GCGLAFAQKYNKDEAVTFALYGDGAANQGQLFEALNISALWDLPAILVCENNHYGMGTAT 237

Query: 239 WRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSM 298
           WR+AKSP+Y+KRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGP+ILEMDTYRYHGHSM
Sbjct: 238 WRSAKSPAYFKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPIILEMDTYRYHGHSM 297

Query: 299 SDPGSTYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAK 358
           SDPGSTYRTRDEISGVRQ RDPIER+RKL+L HD+ATEKELKD+EKE+RKEVDDA+A+AK
Sbjct: 298 SDPGSTYRTRDEISGVRQVRDPIERVRKLLLTHDIATEKELKDMEKEIRKEVDDAVAQAK 357

Query: 359 E 359
           E
Sbjct: 358 E 358

The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 4EC: .EC: 1

>sp\|P52901\|ODPA1_ARATH Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial OS=Arabidopsis thaliana GN=E1 ALPHA PE=1 SV=2	Back alignment and function description

>sp\|P52902\|ODPA_PEA Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Pisum sativum PE=2 SV=1	Back alignment and function description

>sp\|Q6Z5N4\|ODPA1_ORYSJ Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0739600 PE=2 SV=1	Back alignment and function description

>sp\|P52903\|ODPA_SOLTU Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Solanum tuberosum PE=1 SV=1	Back alignment and function description

>sp\|Q654V6\|ODPA2_ORYSJ Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0246500 PE=2 SV=1	Back alignment and function description

>sp\|Q54C70\|ODPA_DICDI Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=pdhA PE=1 SV=1	Back alignment and function description

>sp\|P52899\|ODPA_CAEEL Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=T05H10.6 PE=2 SV=1	Back alignment and function description

>sp\|Q10489\|ODPA_SCHPO Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pda1 PE=1 SV=1	Back alignment and function description

>sp\|P16387\|ODPA_YEAST Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDA1 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		362
68138987		395	pyruvate dehydrogenase, partial [Citrus	0.983	0.901	0.985	0.0
211906500		394	pyruvate dehydrogenase alpha subunit [Go	0.917	0.842	0.921	0.0
255558342		399	pyruvate dehydrogenase, putative [Ricinu	0.986	0.894	0.849	0.0
157849684		389	pyruvate dehydrogenase complex E1 alpha	0.977	0.910	0.852	0.0
356567586		395	PREDICTED: pyruvate dehydrogenase E1 com	0.997	0.913	0.823	0.0
356526868		394	PREDICTED: pyruvate dehydrogenase E1 com	0.994	0.913	0.823	0.0
15221692		393	pyruvate dehydrogenase E1 component subu	0.983	0.905	0.822	1e-180
297850898		393	IAA-conjugate-resistant 4 [Arabidopsis l	0.983	0.905	0.819	1e-180
15218940		389	pyruvate dehydrogenase complex E1 alpha	0.977	0.910	0.838	1e-180
13430788		389	putative pyruvate dehydrogenase e1 alpha	0.977	0.910	0.838	1e-180

>gi\|68138987\|gb\|AAY86036.1\| pyruvate dehydrogenase, partial [Citrus x paradisi]	Back alignment and taxonomy information

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/356 (98%), Positives = 352/356 (98%)

Query: 4   SKLSSPSSLSTNILKPLTNSFLLHRPISTDTTPLTIETSVPFTSHQCEAPSRSVETTPKE 63
           SKLSS SSLSTNILKPLTNSF LHRPISTDTTPLTIETSVPFTSHQCEAPSRSVETTPKE
Sbjct: 5   SKLSSSSSLSTNILKPLTNSFFLHRPISTDTTPLTIETSVPFTSHQCEAPSRSVETTPKE 64

Query: 64  LLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRD 123
           LLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRD
Sbjct: 65  LLSFFRQMATMRRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRD 124

Query: 124 HCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLA 183
           HCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDS  YGGHGIVGAQIPLGCGLA
Sbjct: 125 HCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSRLYGGHGIVGAQIPLGCGLA 184

Query: 184 FAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAK 243
           FAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAK
Sbjct: 185 FAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAK 244

Query: 244 SPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGS 303
           SPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGS
Sbjct: 245 SPSYYKRGDYVPGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGS 304

Query: 304 TYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKE 359
           TYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVD+AIAKAKE
Sbjct: 305 TYRTRDEISGVRQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDEAIAKAKE 360

Source: Citrus x paradisi

Species: Citrus x paradisi

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|211906500\|gb\|ACJ11743.1\| pyruvate dehydrogenase alpha subunit [Gossypium hirsutum]	Back alignment and taxonomy information

>gi\|255558342\|ref\|XP_002520198.1\| pyruvate dehydrogenase, putative [Ricinus communis] gi\|223540690\|gb\|EEF42253.1\| pyruvate dehydrogenase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|157849684\|gb\|ABV89625.1\| pyruvate dehydrogenase complex E1 alpha subunit dehydrogenase [Brassica rapa]	Back alignment and taxonomy information

>gi\|356567586\|ref\|XP_003551999.1\| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|356526868\|ref\|XP_003532038.1\| PREDICTED: pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi|15221692|ref|NP_173828.1| pyruvate dehydrogenase E1 component subunit alpha-2 [Arabidopsis thaliana] gi|118573089|sp|Q8H1Y0.2|ODPA2_ARATH RecName: Full=Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial; Short=PDHE1-A; Flags: Precursor gi|13430606|gb|AAK25925.1|AF360215_1 putative pyruvate dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gi|2829869|gb|AAC00577.1| pyruvate dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gi|15293169|gb|AAK93695.1| putative pyruvate dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gi|21593680|gb|AAM65647.1| pyruvate dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gi|332192371|gb|AEE30492.1| pyruvate dehydrogenase E1 component subunit alpha-2 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297850898\|ref\|XP_002893330.1\| IAA-conjugate-resistant 4 [Arabidopsis lyrata subsp. lyrata] gi\|297339172\|gb\|EFH69589.1\| IAA-conjugate-resistant 4 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|15218940|ref|NP_176198.1| pyruvate dehydrogenase complex E1 alpha subunit [Arabidopsis thaliana] gi|27735220|sp|P52901.2|ODPA1_ARATH RecName: Full=Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial; Short=PDHE1-A; Flags: Precursor gi|5080822|gb|AAD39331.1|AC007258_20 pyruvate dehydrogenase E1 alpha subunit [Arabidopsis thaliana] gi|21593256|gb|AAM65205.1| pyruvate dehydrogenase e1 alpha subunit, putative [Arabidopsis thaliana] gi|24030439|gb|AAN41374.1| putative pyruvate dehydrogenase e1 alpha subunit [Arabidopsis thaliana] gi|332195517|gb|AEE33638.1| pyruvate dehydrogenase complex E1 alpha subunit [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|13430788\|gb\|AAK26016.1\|AF360306_1 putative pyruvate dehydrogenase e1 alpha subunit [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		362
TAIR\|locus:2032367		393	IAR4 "IAA-CONJUGATE-RESISTANT	0.947	0.872	0.837	5.7e-162
TAIR\|locus:2025966		389	E1 ALPHA "pyruvate dehydrogena	0.950	0.884	0.847	1.9e-161
DICTYBASE\|DDB_G0292994		377	pdhA "pyruvate dehydrogenase E	0.853	0.819	0.605	6.4e-99
ZFIN\|ZDB-GENE-040426-2719		393	pdha1a "pyruvate dehydrogenase	0.831	0.765	0.582	2.6e-95
WB\|WBGene00011510		414	pdha-1 [Caenorhabditis elegans	0.922	0.806	0.554	2.3e-94
CGD\|CAL0001531		401	PDA1 [Candida albicans (taxid:	0.883	0.798	0.537	1.6e-93
POMBASE\|SPAC26F1.03		409	pda1 "pyruvate dehydrogenase e	0.911	0.806	0.546	2.1e-93
SGD\|S000000980		420	PDA1 "E1 alpha subunit of the	0.889	0.766	0.548	5.5e-93
UNIPROTKB\|P52900		363	PDHA "Pyruvate dehydrogenase E	0.831	0.829	0.565	9e-93
UNIPROTKB\|A7MB35		390	PDHA1 "Pyruvate dehydrogenase	0.831	0.771	0.565	3.9e-92

TAIR\|locus:2032367 IAR4 "IAA-CONJUGATE-RESISTANT 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1577 (560.2 bits), Expect = 5.7e-162, P = 5.7e-162
 Identities = 289/345 (83%), Positives = 323/345 (93%)

Query:    17 LKPLTNSF--LLHRPISTDTTPLTIETSVPFTSHQCEAPSRSVETTPKELLSFFRQMATM 74
             LKP   +    + R +STD++P+TIET+VPFTSH CE+PSRSVET+ +E+L+FFR MA M
Sbjct:    14 LKPAITALPSSIRRHVSTDSSPITIETAVPFTSHLCESPSRSVETSSEEILAFFRDMARM 73

Query:    75 RRMEIAADSLYKAKLVRGFCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTL 134
             RRMEIAADSLYKAKL+RGFCHLYDGQEA+A+GMEA ITKKD+IIT+YRDHCTF+GRGG L
Sbjct:    74 RRMEIAADSLYKAKLIRGFCHLYDGQEALAVGMEAAITKKDAIITSYRDHCTFIGRGGKL 133

Query:   135 LEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETV 194
             ++ FSELMGRK GCSHGKGGSMHFYKKD+ FYGGHGIVGAQIPLGCGLAFAQKY+KDE V
Sbjct:   134 VDAFSELMGRKTGCSHGKGGSMHFYKKDASFYGGHGIVGAQIPLGCGLAFAQKYNKDEAV 193

Query:   195 TFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYV 254
             TFALYGDGAANQGQLFEALNI+ALWDLPAILVCENNHYGMGTA WR+AKSP+Y+KRGDYV
Sbjct:   194 TFALYGDGAANQGQLFEALNISALWDLPAILVCENNHYGMGTATWRSAKSPAYFKRGDYV 253

Query:   255 PGLKVDGMDALAVKQACKFAKEHALKNGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGV 314
             PGLKVDGMDALAVKQACKFAKEHALKNGP+ILEMDTYRYHGHSMSDPGSTYRTRDEISGV
Sbjct:   254 PGLKVDGMDALAVKQACKFAKEHALKNGPIILEMDTYRYHGHSMSDPGSTYRTRDEISGV 313

Query:   315 RQERDPIERIRKLILAHDLATEKELKDIEKEVRKEVDDAIAKAKE 359
             RQ RDPIER+RKL+L HD+ATEKELKD+EKE+RKEVDDA+A+AKE
Sbjct:   314 RQVRDPIERVRKLLLTHDIATEKELKDMEKEIRKEVDDAVAQAKE 358

GO:0004739 "pyruvate dehydrogenase (acetyl-transferring) activity" evidence=IEA;ISS

GO:0005739 "mitochondrion" evidence=ISM;IDA

GO:0006096 "glycolysis" evidence=IEA

GO:0008152 "metabolic process" evidence=IEA;ISS

GO:0016624 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor" evidence=IEA

GO:0043231 "intracellular membrane-bounded organelle" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009651 "response to salt stress" evidence=IEP;RCA

GO:0005634 "nucleus" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0008270 "zinc ion binding" evidence=IDA

GO:0050897 "cobalt ion binding" evidence=IDA

GO:0006007 "glucose catabolic process" evidence=RCA

GO:0006098 "pentose-phosphate shunt" evidence=RCA

GO:0009744 "response to sucrose stimulus" evidence=RCA

GO:0009749 "response to glucose stimulus" evidence=RCA

GO:0009750 "response to fructose stimulus" evidence=RCA

GO:0046686 "response to cadmium ion" evidence=RCA

TAIR\|locus:2025966 E1 ALPHA "pyruvate dehydrogenase complex E1 alpha subunit" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0292994 pdhA "pyruvate dehydrogenase E1 alpha subunit" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-2719 pdha1a "pyruvate dehydrogenase (lipoamide) alpha 1a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

WB\|WBGene00011510 pdha-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

CGD\|CAL0001531 PDA1 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

POMBASE\|SPAC26F1.03 pda1 "pyruvate dehydrogenase e1 component alpha subunit Pda1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

SGD\|S000000980 PDA1 "E1 alpha subunit of the pyruvate dehydrogenase (PDH) complex" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

UNIPROTKB\|P52900 PDHA "Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial" [Sminthopsis macroura (taxid:9302)]	Back alignment and assigned GO terms

UNIPROTKB\|A7MB35 PDHA1 "Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P26267	ODPA_ASCSU	1, ., 2, ., 4, ., 1	0.5144	0.9392	0.8585	N/A	no
Q6Z5N4	ODPA1_ORYSJ	1, ., 2, ., 4, ., 1	0.8372	0.9337	0.8666	yes	no
P52899	ODPA_CAEEL	1, ., 2, ., 4, ., 1	0.5444	0.9502	0.8664	yes	no
Q8HXW9	ODPA_MACFA	1, ., 2, ., 4, ., 1	0.5100	0.9143	0.8487	N/A	no
Q654V6	ODPA2_ORYSJ	1, ., 2, ., 4, ., 1	0.7861	0.9171	0.8341	no	no
P29803	ODPAT_HUMAN	1, ., 2, ., 4, ., 1	0.5657	0.8314	0.7757	yes	no
P26268	ODPT_ASCSU	1, ., 2, ., 4, ., 1	0.5158	0.9419	0.8721	N/A	no
P29804	ODPA_PIG	1, ., 2, ., 4, ., 1	0.5128	0.9143	0.8508	yes	no
P35486	ODPA_MOUSE	1, ., 2, ., 4, ., 1	0.5128	0.9143	0.8487	yes	no
Q54C70	ODPA_DICDI	1, ., 2, ., 4, ., 1	0.6057	0.8535	0.8196	yes	no
O13366	ODPA_KLULA	1, ., 2, ., 4, ., 1	0.5537	0.8591	0.7548	yes	no
Q8H1Y0	ODPA2_ARATH	1, ., 2, ., 4, ., 1	0.8227	0.9834	0.9058	yes	no
P52900	ODPA_SMIMA	1, ., 2, ., 4, ., 1	0.5657	0.8314	0.8292	N/A	no
P52901	ODPA1_ARATH	1, ., 2, ., 4, ., 1	0.8384	0.9779	0.9100	no	no
P52902	ODPA_PEA	1, ., 2, ., 4, ., 1	0.8654	0.9419	0.8589	N/A	no
P52903	ODPA_SOLTU	1, ., 2, ., 4, ., 1	0.8073	0.9723	0.9002	N/A	no
O31404	ACOA_BACSU	1, ., 1, ., 1, ., -	0.3779	0.8093	0.8798	yes	no
Q4UKQ6	ODPA_RICFE	1, ., 2, ., 4, ., 1	0.4653	0.8232	0.9141	yes	no
O66112	ODPA_ZYMMO	1, ., 2, ., 4, ., 1	0.4831	0.8011	0.8192	yes	no
P16387	ODPA_YEAST	1, ., 2, ., 4, ., 1	0.5462	0.8784	0.7571	yes	no
Q10489	ODPA_SCHPO	1, ., 2, ., 4, ., 1	0.5538	0.8867	0.7848	yes	no
A7MB35	ODPA_BOVIN	1, ., 2, ., 4, ., 1	0.5186	0.9143	0.8487	yes	no
Q68XA9	ODPA_RICTY	1, ., 2, ., 4, ., 1	0.4628	0.8038	0.8926	yes	no
Q9R9N5	ODPA_RHIME	1, ., 2, ., 4, ., 1	0.5050	0.8149	0.8477	yes	no
P26284	ODPA_RAT	1, ., 2, ., 4, ., 1	0.5189	0.8977	0.8333	yes	no
Q92IS3	ODPA_RICCN	1, ., 2, ., 4, ., 1	0.4664	0.8093	0.8987	yes	no
Q9ZDR4	ODPA_RICPR	1, ., 2, ., 4, ., 1	0.4747	0.8011	0.8895	yes	no
P27745	ACOA_CUPNH	1, ., 1, ., 1, ., -	0.3476	0.8232	0.8948	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.2.4	0.983
4th Layer	1.2.4.1	0.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		362
PLN02269		362	PLN02269, PLN02269, Pyruvate dehydrogenase E1 comp	0.0
TIGR03182		315	TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E	1e-155
pfam00676		303	pfam00676, E1_dh, Dehydrogenase E1 component	1e-149
cd02000		293	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosph	1e-145
COG1071		358	COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogena	1e-127
PLN02374		433	PLN02374, PLN02374, pyruvate dehydrogenase (acetyl	5e-79
CHL00149		341	CHL00149, odpA, pyruvate dehydrogenase E1 componen	2e-77
TIGR03181		341	TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E	3e-60
TIGR00239		929	TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenas	6e-08
cd02007		195	cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) fam	4e-04
cd02012		255	cd02012, TPP_TK, Thiamine pyrophosphate (TPP) fami	5e-04
COG0567		906	COG0567, SucA, 2-oxoglutarate dehydrogenase comple	6e-04
COG3959		243	COG3959, COG3959, Transketolase, N-terminal subuni	0.002

>gnl\|CDD\|215152 PLN02269, PLN02269, Pyruvate dehydrogenase E1 component subunit alpha	Back alignment and domain information

 Score =  728 bits (1880), Expect = 0.0
 Identities = 279/328 (85%), Positives = 303/328 (92%)

Query: 33  DTTPLTIETSVPFTSHQCEAPSRSVETTPKELLSFFRQMATMRRMEIAADSLYKAKLVRG 92
            T P+TIET VPF  H C+ PSR+VET+ +EL+ FFR M  MRRMEIAADSLYKAKL+RG
Sbjct: 1   STDPITIETPVPFKGHLCDPPSRTVETSKQELVDFFRDMYLMRRMEIAADSLYKAKLIRG 60

Query: 93  FCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGK 152
           FCHLYDGQEAVA+GMEA ITK+D+IITAYRDHCT LGRGGT+LEVF+ELMGRKDGCS GK
Sbjct: 61  FCHLYDGQEAVAVGMEAAITKEDAIITAYRDHCTHLGRGGTVLEVFAELMGRKDGCSRGK 120

Query: 153 GGSMHFYKKDSGFYGGHGIVGAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEA 212
           GGSMHFYKKD+ FYGGHGIVGAQ+PLG GLAFAQKY+K+E V FALYGDGAANQGQLFEA
Sbjct: 121 GGSMHFYKKDANFYGGHGIVGAQVPLGAGLAFAQKYNKEENVAFALYGDGAANQGQLFEA 180

Query: 213 LNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGDYVPGLKVDGMDALAVKQACK 272
           LNIAALWDLP I VCENNHYGMGTAEWRAAKSP+YYKRGDYVPGLKVDGMD LAVKQACK
Sbjct: 181 LNIAALWDLPVIFVCENNHYGMGTAEWRAAKSPAYYKRGDYVPGLKVDGMDVLAVKQACK 240

Query: 273 FAKEHALKNGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIRKLILAHD 332
           FAKEHAL NGP++LEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIER+RKL+LAH+
Sbjct: 241 FAKEHALSNGPIVLEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERVRKLLLAHE 300

Query: 333 LATEKELKDIEKEVRKEVDDAIAKAKEG 360
           LATE ELKDIEKE+RKEVDDA+AKAKE 
Sbjct: 301 LATEAELKDIEKEIRKEVDDAVAKAKES 328

Length = 362

>gnl\|CDD\|234139 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit	Back alignment and domain information

>gnl\|CDD\|201386 pfam00676, E1_dh, Dehydrogenase E1 component	Back alignment and domain information

>gnl\|CDD\|238958 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC)	Back alignment and domain information

>gnl\|CDD\|223997 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|215213 PLN02374, PLN02374, pyruvate dehydrogenase (acetyl-transferring)	Back alignment and domain information

>gnl\|CDD\|177069 CHL00149, odpA, pyruvate dehydrogenase E1 component alpha subunit; Reviewed	Back alignment and domain information

>gnl\|CDD\|213783 TIGR03181, PDH_E1_alph_x, pyruvate dehydrogenase E1 component, alpha subunit	Back alignment and domain information

>gnl\|CDD\|161785 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenase, E1 component	Back alignment and domain information

>gnl\|CDD\|238965 cd02007, TPP_DXS, Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis	Back alignment and domain information

>gnl\|CDD\|238970 cd02012, TPP_TK, Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates	Back alignment and domain information

>gnl\|CDD\|223641 COG0567, SucA, 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|226468 COG3959, COG3959, Transketolase, N-terminal subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		362
KOG0225		394	consensus Pyruvate dehydrogenase E1, alpha subunit	100.0
COG1071		358	AcoA Pyruvate/2-oxoglutarate dehydrogenase complex	100.0
PLN02269		362	Pyruvate dehydrogenase E1 component subunit alpha	100.0
CHL00149		341	odpA pyruvate dehydrogenase E1 component alpha sub	100.0
PLN02374		433	pyruvate dehydrogenase (acetyl-transferring)	100.0
TIGR03182		315	PDH_E1_alph_y pyruvate dehydrogenase E1 component,	100.0
cd02000		293	TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP)	100.0
PF00676		300	E1_dh: Dehydrogenase E1 component; InterPro: IPR00	100.0
TIGR03181		341	PDH_E1_alph_x pyruvate dehydrogenase E1 component,	100.0
KOG1182		432	consensus Branched chain alpha-keto acid dehydroge	100.0
PRK09404		924	sucA 2-oxoglutarate dehydrogenase E1 component; Re	100.0
TIGR00239		929	2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 compon	100.0
cd02016		265	TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) fami	100.0
PRK12270		1228	kgd alpha-ketoglutarate decarboxylase; Reviewed	100.0
PRK12315		581	1-deoxy-D-xylulose-5-phosphate synthase; Provision	100.0
KOG0450		1017	consensus 2-oxoglutarate dehydrogenase, E1 subunit	99.97
COG0567		906	SucA 2-oxoglutarate dehydrogenase complex, dehydro	99.96
KOG0451		913	consensus Predicted 2-oxoglutarate dehydrogenase,	99.96
TIGR00232		653	tktlase_bact transketolase, bacterial and yeast. T	99.91
PRK12754		663	transketolase; Reviewed	99.91
cd02007		195	TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s	99.91
TIGR00204		617	dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s	99.9
cd02012		255	TPP_TK Thiamine pyrophosphate (TPP) family, Transk	99.9
PTZ00089		661	transketolase; Provisional	99.9
PRK05899		624	transketolase; Reviewed	99.89
COG3959		243	Transketolase, N-terminal subunit [Carbohydrate tr	99.88
PRK05444		580	1-deoxy-D-xylulose-5-phosphate synthase; Provision	99.88
PRK12753		663	transketolase; Reviewed	99.88
PLN02790		654	transketolase	99.88
PRK12571		641	1-deoxy-D-xylulose-5-phosphate synthase; Provision	99.85
PLN02582		677	1-deoxy-D-xylulose-5-phosphate synthase	99.85
cd02017		386	TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) fam	99.84
cd02011		227	TPP_PK Thiamine pyrophosphate (TPP) family, Phosph	99.84
PF00456		332	Transketolase_N: Transketolase, thiamine diphospha	99.84
PLN02234		641	1-deoxy-D-xylulose-5-phosphate synthase	99.84
PRK11864		300	2-ketoisovalerate ferredoxin oxidoreductase subuni	99.81
TIGR00759		885	aceE pyruvate dehydrogenase E1 component, homodime	99.78
PF13292		270	DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate syn	99.78
TIGR03186		889	AKGDH_not_PDH alpha-ketoglutarate dehydrogenase. S	99.77
COG1154		627	Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme m	99.76
cd02013		196	TPP_Xsc_like Thiamine pyrophosphate (TPP) family,	99.75
PRK13012		896	2-oxoacid dehydrogenase subunit E1; Provisional	99.74
cd02004		172	TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam	99.73
PLN02225		701	1-deoxy-D-xylulose-5-phosphate synthase	99.73
cd02006		202	TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s	99.71
cd02002		178	TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC	99.71
COG0021		663	TktA Transketolase [Carbohydrate transport and met	99.7
cd00568		168	TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa	99.7
PRK09405		891	aceE pyruvate dehydrogenase subunit E1; Reviewed	99.68
cd02014		178	TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv	99.68
cd02008		178	TPP_IOR_alpha Thiamine pyrophosphate (TPP) family,	99.67
KOG0523		632	consensus Transketolase [Carbohydrate transport an	99.67
cd02010		177	TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto	99.67
cd02003		205	TPP_IolD Thiamine pyrophosphate (TPP) family, IolD	99.66
PRK06163		202	hypothetical protein; Provisional	99.66
cd03371		188	TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp	99.65
cd03372		179	TPP_ComE Thiamine pyrophosphate (TPP) family, ComE	99.64
PF02775		153	TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter	99.64
cd02015		186	TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet	99.64
PRK05261		785	putative phosphoketolase; Provisional	99.63
cd02001		157	TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil	99.62
cd02005		183	TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family,	99.62
PRK07524		535	hypothetical protein; Provisional	99.62
TIGR03846		181	sulfopy_beta sulfopyruvate decarboxylase, beta sub	99.61
COG0028		550	IlvB Thiamine pyrophosphate-requiring enzymes [ace	99.6
PRK12474		518	hypothetical protein; Provisional	99.58
TIGR01504		588	glyox_carbo_lig glyoxylate carboligase. Glyoxylate	99.58
PRK06154		565	hypothetical protein; Provisional	99.58
cd02009		175	TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa	99.58
cd03375		193	TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o	99.57
PRK06725		570	acetolactate synthase 3 catalytic subunit; Validat	99.56
PRK08327		569	acetolactate synthase catalytic subunit; Validated	99.56
PRK06546		578	pyruvate dehydrogenase; Provisional	99.55
cd03376		235	TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam	99.55
PRK07525		588	sulfoacetaldehyde acetyltransferase; Validated	99.55
PRK07979		574	acetolactate synthase 3 catalytic subunit; Validat	99.55
PRK08266		542	hypothetical protein; Provisional	99.55
PRK09107		595	acetolactate synthase 3 catalytic subunit; Validat	99.55
PRK07586		514	hypothetical protein; Validated	99.54
PRK07092		530	benzoylformate decarboxylase; Reviewed	99.54
PRK05778		301	2-oxoglutarate ferredoxin oxidoreductase subunit b	99.54
PRK07064		544	hypothetical protein; Provisional	99.53
TIGR02418		539	acolac_catab acetolactate synthase, catabolic. Ace	99.53
PRK05858		542	hypothetical protein; Provisional	99.53
PRK11269		591	glyoxylate carboligase; Provisional	99.52
PRK07418		616	acetolactate synthase 3 catalytic subunit; Reviewe	99.52
PRK09124		574	pyruvate dehydrogenase; Provisional	99.52
PRK06965		587	acetolactate synthase 3 catalytic subunit; Validat	99.52
TIGR03457		579	sulphoacet_xsc sulfoacetaldehyde acetyltransferase	99.52
PRK08155		564	acetolactate synthase catalytic subunit; Validated	99.52
CHL00099		585	ilvB acetohydroxyacid synthase large subunit	99.51
PRK06112		578	acetolactate synthase catalytic subunit; Validated	99.51
TIGR00118		558	acolac_lg acetolactate synthase, large subunit, bi	99.5
TIGR02720		575	pyruv_oxi_spxB pyruvate oxidase. Members of this f	99.5
PRK08979		572	acetolactate synthase 3 catalytic subunit; Validat	99.5
TIGR03393		539	indolpyr_decarb indolepyruvate decarboxylase, Erwi	99.5
PRK08527		563	acetolactate synthase 3 catalytic subunit; Validat	99.5
PRK06466		574	acetolactate synthase 3 catalytic subunit; Validat	99.5
PRK08273		597	thiamine pyrophosphate protein; Provisional	99.5
PRK06457		549	pyruvate dehydrogenase; Provisional	99.5
PRK09628		277	oorB 2-oxoglutarate-acceptor oxidoreductase subuni	99.49
PRK08199		557	thiamine pyrophosphate protein; Validated	99.49
PRK06456		572	acetolactate synthase catalytic subunit; Reviewed	99.49
PRK06048		561	acetolactate synthase 3 catalytic subunit; Reviewe	99.49
cd02018		237	TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru	99.49
PRK08617		552	acetolactate synthase; Reviewed	99.48
PLN02573		578	pyruvate decarboxylase	99.48
PRK08322		547	acetolactate synthase; Reviewed	99.48
PRK08611		576	pyruvate oxidase; Provisional	99.48
PLN02470		585	acetolactate synthase	99.48
PRK07710		571	acetolactate synthase catalytic subunit; Reviewed	99.47
PRK06882		574	acetolactate synthase 3 catalytic subunit; Validat	99.46
PRK11866		279	2-oxoacid ferredoxin oxidoreductase subunit beta;	99.46
PRK08978		548	acetolactate synthase 2 catalytic subunit; Reviewe	99.45
TIGR03297		361	Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi	99.45
TIGR03254		554	oxalate_oxc oxalyl-CoA decarboxylase. In a number	99.45
PRK11867		286	2-oxoglutarate ferredoxin oxidoreductase subunit b	99.43
PRK11869		280	2-oxoacid ferredoxin oxidoreductase subunit beta;	99.43
PRK06276		586	acetolactate synthase catalytic subunit; Reviewed	99.42
PRK09259		569	putative oxalyl-CoA decarboxylase; Validated	99.42
TIGR02177		287	PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta	99.42
PRK07789		612	acetolactate synthase 1 catalytic subunit; Validat	99.42
PRK07282		566	acetolactate synthase catalytic subunit; Reviewed	99.42
TIGR03394		535	indol_phenyl_DC indolepyruvate/phenylpyruvate deca	99.41
PRK07449		568	2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1	99.38
TIGR03336		595	IOR_alpha indolepyruvate ferredoxin oxidoreductase	99.35
PRK11865		299	pyruvate ferredoxin oxidoreductase subunit beta; P	99.24
COG3960		592	Glyoxylate carboligase [General function predictio	99.24
COG3961		557	Pyruvate decarboxylase and related thiamine pyroph	99.16
KOG4166		675	consensus Thiamine pyrophosphate-requiring enzyme	99.16
PLN02980		1655	2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi	99.12
KOG1185		571	consensus Thiamine pyrophosphate-requiring enzyme	99.08
COG2609		887	AceE Pyruvate dehydrogenase complex, dehydrogenase	98.83
COG3962		617	Acetolactate synthase [Amino acid transport and me	98.68
COG1013		294	PorB Pyruvate:ferredoxin oxidoreductase and relate	98.56
KOG1184		561	consensus Thiamine pyrophosphate-requiring enzyme	98.55
PF09364		379	XFP_N: XFP N-terminal domain; InterPro: IPR018970	98.25
cd03377		365	TPP_PFOR_PNO Thiamine pyrophosphate (TPP family),	97.97
COG4231		640	Indolepyruvate ferredoxin oxidoreductase, alpha an	97.57
COG1165		566	MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-car	97.52
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	97.16
COG3957		793	Phosphoketolase [Carbohydrate transport and metabo	97.1
cd06586		154	TPP_enzyme_PYR Pyrimidine (PYR) binding domain of	96.14
PRK09193		1165	indolepyruvate ferredoxin oxidoreductase; Validate	96.12
PRK13030		1159	2-oxoacid ferredoxin oxidoreductase; Provisional	96.08
cd07039		164	TPP_PYR_POX Pyrimidine (PYR) binding domain of POX	96.03
cd07034		160	TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) bindi	95.69
cd07035		155	TPP_PYR_POX_like Pyrimidine (PYR) binding domain o	95.68
PRK13029		1186	2-oxoacid ferredoxin oxidoreductase; Provisional	95.17
TIGR03845		157	sulfopyru_alph sulfopyruvate decarboxylase, alpha	94.93
PF02776		172	TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-ter	94.83
cd07033		156	TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domai	94.65
PRK08659		376	2-oxoglutarate ferredoxin oxidoreductase subunit a	94.5
PRK07119		352	2-ketoisovalerate ferredoxin reductase; Validated	94.09
cd07038		162	TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding dom	93.94
cd07037		162	TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-	93.41
PF01855		230	POR_N: Pyruvate flavodoxin/ferredoxin oxidoreducta	92.22
PRK09627		375	oorA 2-oxoglutarate-acceptor oxidoreductase subuni	92.21
PRK08611		576	pyruvate oxidase; Provisional	92.18
cd07036		167	TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding	91.92
PRK06457		549	pyruvate dehydrogenase; Provisional	91.6
PRK08366		390	vorA 2-ketoisovalerate ferredoxin oxidoreductase s	91.33
PRK08978		548	acetolactate synthase 2 catalytic subunit; Reviewe	90.63
TIGR03254		554	oxalate_oxc oxalyl-CoA decarboxylase. In a number	90.57
PRK07979		574	acetolactate synthase 3 catalytic subunit; Validat	90.53
TIGR03710		562	OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha s	90.47
PRK08367		394	porA pyruvate ferredoxin oxidoreductase subunit al	90.46
PRK07525		588	sulfoacetaldehyde acetyltransferase; Validated	90.25
PRK07524		535	hypothetical protein; Provisional	90.17
PRK08322		547	acetolactate synthase; Reviewed	89.9
PRK07789		612	acetolactate synthase 1 catalytic subunit; Validat	89.89
TIGR03297		361	Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi	89.84
PRK07586		514	hypothetical protein; Validated	89.72
PRK06725		570	acetolactate synthase 3 catalytic subunit; Validat	89.65
PRK08266		542	hypothetical protein; Provisional	89.64
PRK09259		569	putative oxalyl-CoA decarboxylase; Validated	89.58
PRK06466		574	acetolactate synthase 3 catalytic subunit; Validat	89.54
PRK06112		578	acetolactate synthase catalytic subunit; Validated	89.53
PRK07418		616	acetolactate synthase 3 catalytic subunit; Reviewe	89.48
PRK06456		572	acetolactate synthase catalytic subunit; Reviewed	89.4
PRK11269		591	glyoxylate carboligase; Provisional	89.37
TIGR00204		617	dxs 1-deoxy-D-xylulose-5-phosphate synthase. DXP s	89.32
PRK08155		564	acetolactate synthase catalytic subunit; Validated	89.21
PLN02470		585	acetolactate synthase	89.07
PRK11892		464	pyruvate dehydrogenase subunit beta; Provisional	89.05
TIGR03457		579	sulphoacet_xsc sulfoacetaldehyde acetyltransferase	88.94
PRK07710		571	acetolactate synthase catalytic subunit; Reviewed	88.88
TIGR02720		575	pyruv_oxi_spxB pyruvate oxidase. Members of this f	88.75
PRK12474		518	hypothetical protein; Provisional	88.71
PRK07064		544	hypothetical protein; Provisional	88.7
PRK08617		552	acetolactate synthase; Reviewed	88.51
PRK08199		557	thiamine pyrophosphate protein; Validated	88.47
TIGR00118		558	acolac_lg acetolactate synthase, large subunit, bi	88.47
COG0028		550	IlvB Thiamine pyrophosphate-requiring enzymes [ace	88.18
PRK06882		574	acetolactate synthase 3 catalytic subunit; Validat	88.14
PRK09107		595	acetolactate synthase 3 catalytic subunit; Validat	88.12
TIGR02418		539	acolac_catab acetolactate synthase, catabolic. Ace	88.07
PRK05858		542	hypothetical protein; Provisional	88.04
TIGR01504		588	glyox_carbo_lig glyoxylate carboligase. Glyoxylate	87.71
PF02779		178	Transket_pyr: Transketolase, pyrimidine binding do	87.19
PRK09622		407	porA pyruvate flavodoxin oxidoreductase subunit al	87.14
PRK07282		566	acetolactate synthase catalytic subunit; Reviewed	87.03
PRK06276		586	acetolactate synthase catalytic subunit; Reviewed	86.91
TIGR03394		535	indol_phenyl_DC indolepyruvate/phenylpyruvate deca	86.61
PRK08979		572	acetolactate synthase 3 catalytic subunit; Validat	86.59
PLN02683		356	pyruvate dehydrogenase E1 component subunit beta	86.51
PLN02234		641	1-deoxy-D-xylulose-5-phosphate synthase	86.36
PRK08273		597	thiamine pyrophosphate protein; Provisional	86.15
CHL00099		585	ilvB acetohydroxyacid synthase large subunit	86.01
PRK06048		561	acetolactate synthase 3 catalytic subunit; Reviewe	85.56
PRK08527		563	acetolactate synthase 3 catalytic subunit; Validat	85.48
TIGR00232		653	tktlase_bact transketolase, bacterial and yeast. T	85.23
PRK08327		569	acetolactate synthase catalytic subunit; Validated	85.22
KOG4166		675	consensus Thiamine pyrophosphate-requiring enzyme	84.93
PLN02582		677	1-deoxy-D-xylulose-5-phosphate synthase	84.92
PRK06965		587	acetolactate synthase 3 catalytic subunit; Validat	84.91
PLN02225		701	1-deoxy-D-xylulose-5-phosphate synthase	84.49
PRK12571		641	1-deoxy-D-xylulose-5-phosphate synthase; Provision	83.77
PRK09124		574	pyruvate dehydrogenase; Provisional	83.69
PLN02573		578	pyruvate decarboxylase	83.53
PRK06546		578	pyruvate dehydrogenase; Provisional	83.37
PRK05444		580	1-deoxy-D-xylulose-5-phosphate synthase; Provision	83.0
COG0674		365	PorA Pyruvate:ferredoxin oxidoreductase and relate	82.92
PRK12315		581	1-deoxy-D-xylulose-5-phosphate synthase; Provision	82.13
PTZ00089		661	transketolase; Provisional	81.53
PRK07092		530	benzoylformate decarboxylase; Reviewed	81.52
PRK09212		327	pyruvate dehydrogenase subunit beta; Validated	81.25
PRK12753		663	transketolase; Reviewed	80.32
PRK06154		565	hypothetical protein; Provisional	80.29

>KOG0225 consensus Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion]	Back alignment and domain information

Probab=100.00  E-value=3.5e-103  Score=739.59  Aligned_cols=344  Identities=64%  Similarity=1.059  Sum_probs=326.1

Q ss_pred             cccccccccccCCCCCC--CCcceeeeCCCCcccccccC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcccccc
Q 018037           16 ILKPLTNSFLLHRPIST--DTTPLTIETSVPFTSHQCEA-PSRSVETTPKELLSFFRQMATMRRMEIAADSLYKAKLVRG   92 (362)
Q Consensus        16 ~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~-~~~~~~~s~e~l~~~y~~M~~~R~~e~~~~~l~~~g~i~g   92 (362)
                      ++.|+..+..+++...+  ..++++++++ ||+.|++|+ |++...+|+|+++++|++|+++|+||.++++||++++|+|
T Consensus        11 ~l~~~~~~~~s~~~~~~r~~~~~~~~~~~-~~~~~~l~~~p~~s~~~t~ee~L~~Y~~M~~~RrmE~aad~lYK~k~IRG   89 (394)
T KOG0225|consen   11 LLRPLAQAPPSRTLVNTRLVPSDVTFESS-PFELHKLEEGPSTSVELTKEEALKYYRDMQTIRRMELAADQLYKAKKIRG   89 (394)
T ss_pred             hhchhhhcCccchhhccccCccccccccc-ceeEEEccCCCCceEEecHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhce
Confidence            55555544322222222  4566777766 999999998 9999999999999999999999999999999999999999


Q ss_pred             ccccCcchHHHHHHHHhcCCCCCEEEcCchhHHHHHHcCCCHHHHHHHHhCCCCCCCCCCCCccCCccCCCCcccCCccc
Q 018037           93 FCHLYDGQEAVAIGMEAGITKKDSIITAYRDHCTFLGRGGTLLEVFSELMGRKDGCSHGKGGSMHFYKKDSGFYGGHGIV  172 (362)
Q Consensus        93 f~h~~~GqEa~~vg~~~~l~~~D~v~~~yR~h~~~l~rG~~~~~~lael~g~~~g~~~Grggs~H~~~~~~~~~~~~g~l  172 (362)
                      |||+|+||||++||+.++|++.|.||++||||++.+.+|.++.++|+||+|+.+|+++|+|||||++.+  +|||++|||
T Consensus        90 FCHLy~GQEAvavGme~ait~~D~iItsYR~Hg~~~~~G~S~~~v~aEL~Gr~~Gc~kGKGGSMHmy~k--~FyGGnGIV  167 (394)
T KOG0225|consen   90 FCHLYDGQEAVAVGMEAAITKSDSIITSYRCHGWTYLRGVSVREVLAELMGRQAGCSKGKGGSMHMYAK--NFYGGNGIV  167 (394)
T ss_pred             eeeecccHHHHHHHHHHhccCCCceEEEeeeeeEEeecCccHHHHHHHHhccccccccCCCcceeeecc--cccCcccee
Confidence            999999999999999999999999999999999999999999999999999999999999999999987  599999999


Q ss_pred             cchhHHHHHHHHHHhhCCCCCeEEEEeCCcccccchHHHHHHHHHhCCCCeEEEEEcCCcccccccccccCCchHhhhcC
Q 018037          173 GAQIPLGCGLAFAQKYSKDETVTFALYGDGAANQGQLFEALNIAALWDLPAILVCENNHYGMGTAEWRAAKSPSYYKRGD  252 (362)
Q Consensus       173 G~~~p~A~G~A~A~k~~~~~~vvv~~~GDGa~~~G~~~Ealn~A~~~~LPvIfVv~NN~~gi~t~~~~~~~~~~~~~~g~  252 (362)
                      |+|+|+++|+|||.||++.+.++++++|||++||||++|++|||++|+||+||||+||+|||+|+.++.+..|+|++||.
T Consensus       168 GAQiPLGaGia~A~kY~~~~~v~~alYGDGAaNQGQ~fEa~NMA~LW~LP~IFvCENN~yGMGTs~~Rasa~teyykRG~  247 (394)
T KOG0225|consen  168 GAQIPLGAGIAFAQKYNREDAVCFALYGDGAANQGQVFEAFNMAALWKLPVIFVCENNHYGMGTSAERASASTEYYKRGD  247 (394)
T ss_pred             ccCCCccccHHHHHHhccCCceEEEEeccccccchhHHHHhhHHHHhCCCEEEEEccCCCccCcchhhhhcChHHHhccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999997


Q ss_pred             CcceEEEeCCCHHHHHHHHHHHHHHhcc-CCCEEEEEEEecCCCCCCCCCCCCCCChhhHHhHhhcCCHHHHHHHHHHHc
Q 018037          253 YVPGLKVDGMDALAVKQACKFAKEHALK-NGPMILEMDTYRYHGHSMSDPGSTYRTRDEISGVRQERDPIERIRKLILAH  331 (362)
Q Consensus       253 gi~g~~VdG~D~~av~~a~~~A~~~ar~-~gP~lIe~~tyR~~GHs~~D~~~~YR~~~e~~~~~~~~DPi~~~~~~L~~~  331 (362)
                      .|||++|||+|+++|++|.++|++|+++ +||+++|+.|||++|||++||+++||++||+++.|++||||..++++|++.
T Consensus       248 yiPGl~VdGmdvlaVr~a~KfA~~~~~~g~GPilmE~~TYRy~GHSmSDPg~sYRtReEiq~vR~kRDPI~~lk~~li~~  327 (394)
T KOG0225|consen  248 YIPGLKVDGMDVLAVREATKFAKKYALEGKGPILMEMDTYRYHGHSMSDPGTSYRTREEIQEVRQKRDPIEGLKKRLIEL  327 (394)
T ss_pred             CCCceEECCcchhhHHHHHHHHHHHHhcCCCCEEEEEeeeeecccccCCCCcccchHHHHHHHHhccChHHHHHHHHHHh
Confidence            7999999999999999999999999999 999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHhCCC
Q 018037          332 DLATEKELKDIEKEVRKEVDDAIAKAKEGRQ  362 (362)
Q Consensus       332 g~~t~~el~~i~~e~~~~v~~a~~~A~~~p~  362 (362)
                      +++|++||++|+++++++||+++++|+++|+
T Consensus       328 ~late~ELKai~k~irkeVdeav~~A~~~p~  358 (394)
T KOG0225|consen  328 GLATEEELKAIDKEIRKEVDEAVAFATASPE  358 (394)
T ss_pred             cccCHHHHHHHHHHHHHHHHHHHHHhhcCCC
Confidence            9999999999999999999999999999986

>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion]	Back alignment and domain information

>PLN02269 Pyruvate dehydrogenase E1 component subunit alpha	Back alignment and domain information

>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed	Back alignment and domain information

>PLN02374 pyruvate dehydrogenase (acetyl-transferring)	Back alignment and domain information

>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit	Back alignment and domain information

>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC)	Back alignment and domain information

>PF00676 E1_dh: Dehydrogenase E1 component; InterPro: IPR001017 This entry includes a number of dehydrogenases all of which use thiamine pyrophosphate as a cofactor and are members of a multienzyme complex	Back alignment and domain information

>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit	Back alignment and domain information

>KOG1182 consensus Branched chain alpha-keto acid dehydrogenase complex, alpha subunit [Energy production and conversion]	Back alignment and domain information

>PRK09404 sucA 2-oxoglutarate dehydrogenase E1 component; Reviewed	Back alignment and domain information

>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component	Back alignment and domain information

>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC)	Back alignment and domain information

>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>KOG0450 consensus 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>KOG0451 consensus Predicted 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00232 tktlase_bact transketolase, bacterial and yeast	Back alignment and domain information

>PRK12754 transketolase; Reviewed	Back alignment and domain information

>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis	Back alignment and domain information

>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates	Back alignment and domain information

>PTZ00089 transketolase; Provisional	Back alignment and domain information

>PRK05899 transketolase; Reviewed	Back alignment and domain information

>COG3959 Transketolase, N-terminal subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>PRK12753 transketolase; Reviewed	Back alignment and domain information

>PLN02790 transketolase	Back alignment and domain information

>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>cd02017 TPP_E1_EcPDC_like Thiamine pyrophosphate (TPP) family, E1 of E	Back alignment and domain information

>cd02011 TPP_PK Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O	Back alignment and domain information

>PF00456 Transketolase_N: Transketolase, thiamine diphosphate binding domain; InterPro: IPR005474 Transketolase 2	Back alignment and domain information

>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional	Back alignment and domain information

>TIGR00759 aceE pyruvate dehydrogenase E1 component, homodimeric type	Back alignment and domain information

>PF13292 DXP_synthase_N: 1-deoxy-D-xylulose-5-phosphate synthase; PDB: 2O1X_C 2O1S_B	Back alignment and domain information

>TIGR03186 AKGDH_not_PDH alpha-ketoglutarate dehydrogenase	Back alignment and domain information

>COG1154 Dxs Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism]	Back alignment and domain information

>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc)	Back alignment and domain information

>PRK13012 2-oxoacid dehydrogenase subunit E1; Provisional	Back alignment and domain information

>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL)	Back alignment and domain information

>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl)	Back alignment and domain information

>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC)	Back alignment and domain information

>COG0021 TktA Transketolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor	Back alignment and domain information

>PRK09405 aceE pyruvate dehydrogenase subunit E1; Reviewed	Back alignment and domain information

>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions	Back alignment and domain information

>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit	Back alignment and domain information

>KOG0523 consensus Transketolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation	Back alignment and domain information

>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv	Back alignment and domain information

>PRK06163 hypothetical protein; Provisional	Back alignment and domain information

>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins	Back alignment and domain information

>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE)	Back alignment and domain information

>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor	Back alignment and domain information

>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS	Back alignment and domain information

>PRK05261 putative phosphoketolase; Provisional	Back alignment and domain information

>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase)	Back alignment and domain information

>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC)	Back alignment and domain information

>PRK07524 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit	Back alignment and domain information

>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK12474 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01504 glyox_carbo_lig glyoxylate carboligase	Back alignment and domain information

>PRK06154 hypothetical protein; Provisional	Back alignment and domain information

>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD)	Back alignment and domain information

>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor	Back alignment and domain information

>PRK06725 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK08327 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>PRK06546 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria	Back alignment and domain information

>PRK07525 sulfoacetaldehyde acetyltransferase; Validated	Back alignment and domain information

>PRK07979 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK08266 hypothetical protein; Provisional	Back alignment and domain information

>PRK09107 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK07586 hypothetical protein; Validated	Back alignment and domain information

>PRK07092 benzoylformate decarboxylase; Reviewed	Back alignment and domain information

>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated	Back alignment and domain information

>PRK07064 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02418 acolac_catab acetolactate synthase, catabolic	Back alignment and domain information

>PRK05858 hypothetical protein; Provisional	Back alignment and domain information

>PRK11269 glyoxylate carboligase; Provisional	Back alignment and domain information

>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed	Back alignment and domain information

>PRK09124 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PRK06965 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase	Back alignment and domain information

>PRK08155 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>CHL00099 ilvB acetohydroxyacid synthase large subunit	Back alignment and domain information

>PRK06112 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type	Back alignment and domain information

>TIGR02720 pyruv_oxi_spxB pyruvate oxidase	Back alignment and domain information

>PRK08979 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family	Back alignment and domain information

>PRK08527 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK06466 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK08273 thiamine pyrophosphate protein; Provisional	Back alignment and domain information

>PRK06457 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed	Back alignment and domain information

>PRK08199 thiamine pyrophosphate protein; Validated	Back alignment and domain information

>PRK06456 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed	Back alignment and domain information

>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways	Back alignment and domain information

>PRK08617 acetolactate synthase; Reviewed	Back alignment and domain information

>PLN02573 pyruvate decarboxylase	Back alignment and domain information

>PRK08322 acetolactate synthase; Reviewed	Back alignment and domain information

>PRK08611 pyruvate oxidase; Provisional	Back alignment and domain information

>PLN02470 acetolactate synthase	Back alignment and domain information

>PRK07710 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK06882 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional	Back alignment and domain information

>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed	Back alignment and domain information

>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase	Back alignment and domain information

>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase	Back alignment and domain information

>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed	Back alignment and domain information

>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional	Back alignment and domain information

>PRK06276 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK09259 putative oxalyl-CoA decarboxylase; Validated	Back alignment and domain information

>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>PRK07789 acetolactate synthase 1 catalytic subunit; Validated	Back alignment and domain information

>PRK07282 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family	Back alignment and domain information

>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated	Back alignment and domain information

>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional	Back alignment and domain information

>COG3960 Glyoxylate carboligase [General function prediction only]	Back alignment and domain information

>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding	Back alignment and domain information

>KOG1185 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>COG2609 AceE Pyruvate dehydrogenase complex, dehydrogenase (E1) component [Energy production and conversion]	Back alignment and domain information

>COG3962 Acetolactate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion]	Back alignment and domain information

>KOG1184 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>PF09364 XFP_N: XFP N-terminal domain; InterPro: IPR018970 Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria	Back alignment and domain information

>cd03377 TPP_PFOR_PNO Thiamine pyrophosphate (TPP family), PFOR_PNO subfamily, TPP-binding module; composed of proteins similar to the single subunit pyruvate ferredoxin oxidoreductase (PFOR) of Desulfovibrio Africanus, present in bacteria and amitochondriate eukaryotes	Back alignment and domain information

>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>COG1165 MenD 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [Coenzyme metabolism]	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>COG3957 Phosphoketolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd06586 TPP_enzyme_PYR Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes	Back alignment and domain information

>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated	Back alignment and domain information

>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>cd07039 TPP_PYR_POX Pyrimidine (PYR) binding domain of POX	Back alignment and domain information

>cd07034 TPP_PYR_PFOR_IOR-alpha_like Pyrimidine (PYR) binding domain of pyruvate ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin oxidoreductase alpha subunit (IOR-alpha), and related proteins	Back alignment and domain information

>cd07035 TPP_PYR_POX_like Pyrimidine (PYR) binding domain of POX and related proteins	Back alignment and domain information

>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>TIGR03845 sulfopyru_alph sulfopyruvate decarboxylase, alpha subunit	Back alignment and domain information

>PF02776 TPP_enzyme_N: Thiamine pyrophosphate enzyme, N-terminal TPP binding domain; InterPro: IPR012001 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor	Back alignment and domain information

>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins	Back alignment and domain information

>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated	Back alignment and domain information

>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated	Back alignment and domain information

>cd07038 TPP_PYR_PDC_IPDC_like Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins	Back alignment and domain information

>cd07037 TPP_PYR_MenD Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1-carboxylate synthase (MenD) and related proteins	Back alignment and domain information

>PF01855 POR_N: Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg; InterPro: IPR002880 This family includes the N-terminal region of the pyruvate ferredoxin oxidoreductase, corresponding to the first two structural domains	Back alignment and domain information

>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed	Back alignment and domain information

>PRK08611 pyruvate oxidase; Provisional	Back alignment and domain information

>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins	Back alignment and domain information

>PRK06457 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed	Back alignment and domain information

>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed	Back alignment and domain information

>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase	Back alignment and domain information

>PRK07979 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>TIGR03710 OAFO_sf 2-oxoacid:acceptor oxidoreductase, alpha subunit	Back alignment and domain information

>PRK08367 porA pyruvate ferredoxin oxidoreductase subunit alpha; Reviewed	Back alignment and domain information

>PRK07525 sulfoacetaldehyde acetyltransferase; Validated	Back alignment and domain information

>PRK07524 hypothetical protein; Provisional	Back alignment and domain information

>PRK08322 acetolactate synthase; Reviewed	Back alignment and domain information

>PRK07789 acetolactate synthase 1 catalytic subunit; Validated	Back alignment and domain information

>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase	Back alignment and domain information

>PRK07586 hypothetical protein; Validated	Back alignment and domain information

>PRK06725 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK08266 hypothetical protein; Provisional	Back alignment and domain information

>PRK09259 putative oxalyl-CoA decarboxylase; Validated	Back alignment and domain information

>PRK06466 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK06112 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed	Back alignment and domain information

>PRK06456 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK11269 glyoxylate carboligase; Provisional	Back alignment and domain information

>TIGR00204 dxs 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>PRK08155 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>PLN02470 acetolactate synthase	Back alignment and domain information

>PRK11892 pyruvate dehydrogenase subunit beta; Provisional	Back alignment and domain information

>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase	Back alignment and domain information

>PRK07710 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>TIGR02720 pyruv_oxi_spxB pyruvate oxidase	Back alignment and domain information

>PRK12474 hypothetical protein; Provisional	Back alignment and domain information

>PRK07064 hypothetical protein; Provisional	Back alignment and domain information

>PRK08617 acetolactate synthase; Reviewed	Back alignment and domain information

>PRK08199 thiamine pyrophosphate protein; Validated	Back alignment and domain information

>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type	Back alignment and domain information

>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK06882 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PRK09107 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>TIGR02418 acolac_catab acetolactate synthase, catabolic	Back alignment and domain information

>PRK05858 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01504 glyox_carbo_lig glyoxylate carboligase	Back alignment and domain information

>PF02779 Transket_pyr: Transketolase, pyrimidine binding domain; InterPro: IPR005475 Transketolase 2	Back alignment and domain information

>PRK09622 porA pyruvate flavodoxin oxidoreductase subunit alpha; Reviewed	Back alignment and domain information

>PRK07282 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>PRK06276 acetolactate synthase catalytic subunit; Reviewed	Back alignment and domain information

>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family	Back alignment and domain information

>PRK08979 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PLN02683 pyruvate dehydrogenase E1 component subunit beta	Back alignment and domain information

>PLN02234 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>PRK08273 thiamine pyrophosphate protein; Provisional	Back alignment and domain information

>CHL00099 ilvB acetohydroxyacid synthase large subunit	Back alignment and domain information

>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed	Back alignment and domain information

>PRK08527 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>TIGR00232 tktlase_bact transketolase, bacterial and yeast	Back alignment and domain information

>PRK08327 acetolactate synthase catalytic subunit; Validated	Back alignment and domain information

>KOG4166 consensus Thiamine pyrophosphate-requiring enzyme [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>PLN02582 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>PRK06965 acetolactate synthase 3 catalytic subunit; Validated	Back alignment and domain information

>PLN02225 1-deoxy-D-xylulose-5-phosphate synthase	Back alignment and domain information

>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>PRK09124 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PLN02573 pyruvate decarboxylase	Back alignment and domain information

>PRK06546 pyruvate dehydrogenase; Provisional	Back alignment and domain information

>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion]	Back alignment and domain information

>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional	Back alignment and domain information

>PTZ00089 transketolase; Provisional	Back alignment and domain information

>PRK07092 benzoylformate decarboxylase; Reviewed	Back alignment and domain information

>PRK09212 pyruvate dehydrogenase subunit beta; Validated	Back alignment and domain information

>PRK12753 transketolase; Reviewed	Back alignment and domain information

>PRK06154 hypothetical protein; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		362
3exf_A		382	Crystal Structure Of The Pyruvate Dehydrogenase (E1		1e-93
3exe_A		382	Crystal Structure Of The Pyruvate Dehydrogenase (E1		2e-93
3exh_C		382	Crystal Structure Of The Pyruvate Dehydrogenase (E1		5e-93
2ozl_A		365	Human Pyruvate Dehydrogenase S264e Variant Length =		5e-93
3exi_A		382	Crystal Structure Of The Pyruvate Dehydrogenase (E1		5e-93
1ni4_A		365	Human Pyruvate Dehydrogenase Length = 365		7e-88
1w85_A		368	The Crystal Structure Of Pyruvate Dehydrogenase E1		1e-30
3duf_A		369	Snapshots Of Catalysis In The E1 Subunit Of The Pyr		1e-30
1w88_A		368	The Crystal Structure Of Pyruvate Dehydrogenase E1(		2e-30
3dva_A		369	Snapshots Of Catalysis In The E1 Subunit Of The Pyr		3e-30
1um9_A		367	Branched-chain 2-oxo Acid Dehydrogenase (e1) From T		3e-28
1dtw_A		400	Human Branched-Chain Alpha-Keto Acid Dehydrogenase		7e-27
2j9f_A		400	Human Branched-Chain Alpha-Ketoacid Dehydrogenase-		1e-26
2bff_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		1e-26
1x7y_A		400	Crystal Structure Of The Human Mitochondrial Branch		1e-26
1x7x_A		400	Crystal Structure Of The Human Mitochondrial Branch		2e-26
1x7z_A		400	Crystal Structure Of The Human Mitochondrial Branch		2e-26
1x7w_A		400	Crystal Structure Of The Human Mitochondrial Branch		2e-26
1x80_A		400	Crystal Structure Of The Human Mitochondrial Branch		2e-26
2bfe_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		6e-26
2bfb_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		7e-26
1olu_A		400	Roles Of His291-Alpha And His146-Beta' In The Reduc		9e-26
1v16_A		400	Crosstalk Between Cofactor Binding And The Phosphor		2e-25
2bfc_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		7e-25
1v11_A		400	Crosstalk Between Cofactor Binding And The Phosphor		7e-25
1v1m_A		400	Crosstalk Between Cofactor Binding And The Phosphor		2e-24
2bfd_A		400	Reactivity Modulation Of Human Branched-Chain Alpha		3e-24
2bp7_A		410	New Crystal Form Of The Pseudomonas Putida Branched		1e-22
1qs0_A		407	Crystal Structure Of Pseudomonas Putida 2-Oxoisoval		6e-22

>pdb|3EXF|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382