Citrus Sinensis ID: 018106


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MNILTELKIMDETVVAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFPGASRLDYGSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLAVENGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPFDSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKIMEIRSFSEEIEIVEISVPSLQQLTLLFYGARRPRVVEVARSPHLKKLDLVSVYFADNEFNHLISKFPSLEDLFVTRCCLPGKIKISSNQLKNLLFRSCKYLKSALCVKVFSTLIGTSN
ccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccccccccEEEEEcEEEcccccccccccccEEEEEEEEEcHHHHHHHHHccccccEEEEEEcccccEEEEEccccEEEEEEEEEEcccEEEEEEcccEEEEEEEEEccccccEEEEccccccEEEEEEEcccccHHHHHHHccccccEEEEEccEEcccEEEEccccccEEEEEccccccEEEcccEEEEcccccc
cccccccEEccccccccccHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHcccccccEEEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEEccccccEEccccEEEcccEEEEEEEEEEccccccccccHHHEEEEEEEEEccHHHHHHHHHcccHHHHEEEEEcccccEEEEEEcccEEEEEEEEccccccEEEEEcccEEEEEEEccccccccEEEEEcccccEEEEEEEEcccccccccccHcHHHHHHHHHHHccccEEEEEccccEEEEEEcccccccccccccHHHHHHHccc
MNILTELKIMDETVVAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVsfpildfdqnyffpgasrldygsfcvrkqnysFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFldvkgsapiVDRWIRLAVENGvreldfenitdentvytlpqaifSANSVTNLRLVWCRleqpfdsimlcsLKKLTLERVCLDEQMVQKLAsecplledlcfsncwglkhlCVSKASKLKIMEIRSFSEEIEIVEISVPSLQQLTLLfygarrprvvevarsphlkkldlVSVYFADNEfnhliskfpsledlfvtrcclpgkikisSNQLKNLLFRSCKYLKSALCVKVFSTLIGTSN
mniltelkimdETVVAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFPGASRLDYGSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLAVENGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPFDSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKIMEIRSFSEEIEIVEISVPSLQQLTLLFYGARRPRVVEvarsphlkklDLVSVYFADNEFNHLISKFPSLEDLFVTRCCLPGKIKISSNQLKNLLFRSCKYLKSALCVKVFSTLIGTSN
MNILTELKIMDETVVAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFPGASRLDYGSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLAVENGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPFDSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKimeirsfseeieiveisVPSLQQLTLLFYGARRPRVVEVARSPHLKKLDLVSVYFADNEFNHLISKFPSLEDLFVTRCCLPGKIKISSNQLKNLLFRSCKYLKSALCVKVFSTLIGTSN
***LTELKIMDETVVAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFPGASRLDYGSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLAVENGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPFDSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKIMEIRSFSEEIEIVEISVPSLQQLTLLFYGARRPRVVEVARSPHLKKLDLVSVYFADNEFNHLISKFPSLEDLFVTRCCLPGKIKISSNQLKNLLFRSCKYLKSALCVKVFSTLI****
*********************ELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFPGASRLDYGSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLAVENGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPFDSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKIMEIRSFSEEIEIVEISVPSLQQLTLLFYGARRPRVVEVARSPHLKKLDLVSVYFADNEFNHLISKFPSLEDLFVTRCCLPGKIKISSNQLKNLLFRSCKYLKSALCVKVFSTLIG***
MNILTELKIMDETVVAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFPGASRLDYGSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLAVENGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPFDSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKIMEIRSFSEEIEIVEISVPSLQQLTLLFYGARRPRVVEVARSPHLKKLDLVSVYFADNEFNHLISKFPSLEDLFVTRCCLPGKIKISSNQLKNLLFRSCKYLKSALCVKVFSTLIGTSN
***************AMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFP*******GSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLAVENGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPFDSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKIMEIRSFSEEIEIVEISVPSLQQLTLLFYGARRPRVVEVARSPHLKKLDLVSVYFADNEFNHLISKFPSLEDLFVTRCCLPGKIKISSNQLKNLLFRSCKYLKSALCVKVFSTLIGTSN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNILTELKIMDETVVAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFPGASRLDYGSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLAVENGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPFDSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKIMEIRSFSEEIEIVEISVPSLQQLTLLFYGARRPRVVEVARSPHLKKLDLVSVYFADNEFNHLISKFPSLEDLFVTRCCLPGKIKISSNQLKNLLFRSCKYLKSALCVKVFSTLIGTSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query360 2.2.26 [Sep-21-2011]
Q9FJ30 540 Putative F-box/LRR-repeat yes no 0.605 0.403 0.296 1e-18
Q9LX48 491 Putative F-box/LRR-repeat no no 0.594 0.435 0.337 2e-16
Q8H1M0 442 F-box/FBD/LRR-repeat prot no no 0.691 0.563 0.280 8e-16
Q9LXR6 457 Putative F-box protein At no no 0.661 0.520 0.318 1e-15
Q9LX47 504 Putative F-box/FBD/LRR-re no no 0.547 0.390 0.318 2e-15
Q9LX51 520 F-box/LRR-repeat protein no no 0.569 0.394 0.321 2e-15
Q9LXJ6 456 F-box/FBD/LRR-repeat prot no no 0.566 0.447 0.307 5e-15
Q9FNI8 466 FBD-associated F-box prot no no 0.505 0.390 0.290 6e-15
Q6DR13 443 F-box/LRR-repeat protein no no 0.625 0.507 0.334 9e-15
Q8LF09 453 F-box/FBD/LRR-repeat prot no no 0.577 0.459 0.298 1e-14
>sp|Q9FJ30|FBL88_ARATH Putative F-box/LRR-repeat protein At5g41840 OS=Arabidopsis thaliana GN=At5g41840 PE=4 SV=1 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 128/263 (48%), Gaps = 45/263 (17%)

Query: 15  VAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQN-YFFPGASR 73
           V+ DRIS LP  +I H++S+L  KE A T+VL+K+W  L    P L+FD + YF P A R
Sbjct: 11  VSGDRISGLPDALICHILSFLPTKEAASTTVLAKRWKPLLAFVPNLNFDDSIYFHPRARR 70

Query: 74  LDYGSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVD 133
             Y            S++ + FM FVD+ L    K K  +++F +     DV   + +++
Sbjct: 71  NKY------------SKSYESFMSFVDSVLALQAKTKTPLKRFHVKCE--DVVDQSWVLE 116

Query: 134 RWIRLAVENGVRELDFE-----NITDENTVYTLPQAIFSANSVTNLRL-----VWCRLEQ 183
            WI   ++ GV ++D       N  + ++ Y+LP  IF + ++  L++     V   +E 
Sbjct: 117 -WIPKVLKRGVLDIDLHITSSRNYCENSSFYSLPSKIFVSKTLVRLKIQFQDGVHIDVE- 174

Query: 184 PFDSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKIM 243
               + L  LK L L+   ++  M+ KL S C  LE+L  +N                +M
Sbjct: 175 --GGVSLPKLKTLHLDYFKIETSMLNKLLSGCHALEELVLAN----------------LM 216

Query: 244 EIRSFSEEIEIVEISVPSLQQLT 266
              S  +E   V +S+P+L++L 
Sbjct: 217 WADSSEDEACHVSVSIPTLKRLN 239





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LX48|FBL66_ARATH Putative F-box/LRR-repeat protein At3g59230 OS=Arabidopsis thaliana GN=At3g59230 PE=4 SV=1 Back     alignment and function description
>sp|Q8H1M0|FDL16_ARATH F-box/FBD/LRR-repeat protein At2g26030 OS=Arabidopsis thaliana GN=At2g26030 PE=2 SV=2 Back     alignment and function description
>sp|Q9LXR6|FB207_ARATH Putative F-box protein At3g58860 OS=Arabidopsis thaliana GN=At3g58860 PE=4 SV=1 Back     alignment and function description
>sp|Q9LX47|FDL46_ARATH Putative F-box/FBD/LRR-repeat protein At3g59240 OS=Arabidopsis thaliana GN=At3g59240 PE=4 SV=1 Back     alignment and function description
>sp|Q9LX51|FBL64_ARATH F-box/LRR-repeat protein At3g59200 OS=Arabidopsis thaliana GN=At3g59200 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXJ6|FDL21_ARATH F-box/FBD/LRR-repeat protein At3g52680 OS=Arabidopsis thaliana GN=At3g52680 PE=2 SV=2 Back     alignment and function description
>sp|Q9FNI8|FBD32_ARATH FBD-associated F-box protein At5g22730 OS=Arabidopsis thaliana GN=At5g22730 PE=2 SV=2 Back     alignment and function description
>sp|Q6DR13|FBL38_ARATH F-box/LRR-repeat protein At2g42720 OS=Arabidopsis thaliana GN=At2g42720 PE=2 SV=1 Back     alignment and function description
>sp|Q8LF09|FDL23_ARATH F-box/FBD/LRR-repeat protein At4g00160 OS=Arabidopsis thaliana GN=At4g00160 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
224121624 528 predicted protein [Populus trichocarpa] 0.886 0.604 0.380 2e-49
449476923 469 PREDICTED: putative F-box/FBD/LRR-repeat 0.838 0.643 0.326 9e-38
449458247 469 PREDICTED: putative F-box/FBD/LRR-repeat 0.838 0.643 0.326 1e-37
255590973337 conserved hypothetical protein [Ricinus 0.736 0.786 0.366 2e-36
356557323 833 PREDICTED: uncharacterized protein LOC10 0.855 0.369 0.337 5e-33
449458245 575 PREDICTED: uncharacterized protein LOC10 0.863 0.540 0.336 4e-32
449476919 575 PREDICTED: uncharacterized protein LOC10 0.863 0.540 0.333 6e-32
224119688 563 f-box family protein [Populus trichocarp 0.85 0.543 0.335 2e-30
357454743 761 Agglutinin alpha chain [Medicago truncat 0.880 0.416 0.339 5e-30
357503353 557 F-box/LRR-repeat protein [Medicago trunc 0.869 0.561 0.328 1e-29
>gi|224121624|ref|XP_002330747.1| predicted protein [Populus trichocarpa] gi|222872523|gb|EEF09654.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  202 bits (514), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/331 (38%), Positives = 188/331 (56%), Gaps = 12/331 (3%)

Query: 17  MDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFPGASRLDY 76
           MD IS  P  ++HH++S+L  K+V RTS+LSK+W  +  ++PILDF        +S   Y
Sbjct: 1   MDHISRFPDGVLHHILSFLPTKDVLRTSILSKRWKLVLDTYPILDFSWGDCAGQSSDAMY 60

Query: 77  GSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWI 136
                   +  + + + KFM++VD S+ RFCK KF +QKF+LFL   D++ S+ + D+W+
Sbjct: 61  S----ENASDEYRQMLTKFMNYVDTSIFRFCKYKFSMQKFKLFLVLPDLELSSHL-DKWV 115

Query: 137 RLAVENGVRELDF----ENITDENTVYTLPQAIFSANSVTNLRLVWC--RLEQPFDSIML 190
           +  +ENG +E+DF             Y++P AIF+A SVT L+L  C  +LE+ F  I L
Sbjct: 116 QKVIENGAKEVDFGIDLPGYLHFKKPYSMPDAIFAAKSVTVLKLFGCNVKLEESF-CIKL 174

Query: 191 CSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNCWGLKHLCVSKASKLKIMEIRSFSE 250
            SL+KL L+ V +D+ +++++ + CPLLED+    CWGLK + V +  +LK  EI S   
Sbjct: 175 HSLQKLALKEVQMDDHLLRRIVTCCPLLEDISLRFCWGLKKIQVFELLRLKKFEIYSHLS 234

Query: 251 EIEIVEISVPSLQQLTLLFYGARRPRVVEVARSPHLKKLDLVSVYFADNEFNHLISKFPS 310
           + E VEI  PSL+     F       +V V     LK L L   +  +     L+ KF  
Sbjct: 235 KPESVEIKSPSLESFHCSFTVRSVKPIVSVDACQGLKSLILSGSFVTELLLQDLVPKFHV 294

Query: 311 LEDLFVTRCCLPGKIKISSNQLKNLLFRSCK 341
           LE L V  C +  K+KISS +LK+L   SC+
Sbjct: 295 LESLRVGDCPVLKKVKISSWRLKSLEIHSCE 325




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449476923|ref|XP_004154877.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449458247|ref|XP_004146859.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g78840-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255590973|ref|XP_002535407.1| conserved hypothetical protein [Ricinus communis] gi|223523200|gb|EEF26976.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356557323|ref|XP_003546966.1| PREDICTED: uncharacterized protein LOC100794867 [Glycine max] Back     alignment and taxonomy information
>gi|449458245|ref|XP_004146858.1| PREDICTED: uncharacterized protein LOC101214024 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449476919|ref|XP_004154876.1| PREDICTED: uncharacterized protein LOC101224445 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224119688|ref|XP_002318135.1| f-box family protein [Populus trichocarpa] gi|222858808|gb|EEE96355.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357454743|ref|XP_003597652.1| Agglutinin alpha chain [Medicago truncatula] gi|355486700|gb|AES67903.1| Agglutinin alpha chain [Medicago truncatula] Back     alignment and taxonomy information
>gi|357503353|ref|XP_003621965.1| F-box/LRR-repeat protein [Medicago truncatula] gi|357503387|ref|XP_003621982.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355496980|gb|AES78183.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355496997|gb|AES78200.1| F-box/LRR-repeat protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
TAIR|locus:2152950 540 AT5G41840 [Arabidopsis thalian 0.547 0.364 0.309 2.7e-17
TAIR|locus:2085013 532 AT3G42770 "AT3G42770" [Arabido 0.505 0.342 0.325 5.6e-14
TAIR|locus:2055993 448 AT2G04230 "AT2G04230" [Arabido 0.241 0.194 0.370 6.9e-14
TAIR|locus:2160205 472 AT5G54820 [Arabidopsis thalian 0.575 0.438 0.258 1.7e-13
TAIR|locus:2015681449 AT1G16930 "AT1G16930" [Arabido 0.138 0.111 0.5 2.4e-13
TAIR|locus:2126096 507 AT4G00320 "AT4G00320" [Arabido 0.538 0.382 0.301 2.4e-13
TAIR|locus:2081247 464 AT3G59160 "AT3G59160" [Arabido 0.597 0.463 0.317 4.3e-13
TAIR|locus:2092737 456 AT3G18150 "AT3G18150" [Arabido 0.375 0.296 0.270 1.1e-12
TAIR|locus:2052362 443 AT2G42720 "AT2G42720" [Arabido 0.55 0.446 0.326 1.5e-12
TAIR|locus:2016630 505 AT1G58310 [Arabidopsis thalian 0.527 0.376 0.319 1.5e-12
TAIR|locus:2152950 AT5G41840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 233 (87.1 bits), Expect = 2.7e-17, P = 2.7e-17
 Identities = 69/223 (30%), Positives = 114/223 (51%)

Query:    15 VAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQN-YFFPGASR 73
             V+ DRIS LP  +I H++S+L  KE A T+VL+K+W  L    P L+FD + YF P A R
Sbjct:    11 VSGDRISGLPDALICHILSFLPTKEAASTTVLAKRWKPLLAFVPNLNFDDSIYFHPRARR 70

Query:    74 LDYGSFCVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVD 133
               Y            S++ + FM FVD+ L    K K  +++F +     DV   + +++
Sbjct:    71 NKY------------SKSYESFMSFVDSVLALQAKTKTPLKRFHVKCE--DVVDQSWVLE 116

Query:   134 RWIRLAVENGVRELDFE-----NITDENTVYTLPQAIFSANSVTNLRLVW---CRLEQPF 185
              WI   ++ GV ++D       N  + ++ Y+LP  IF + ++  L++ +     ++   
Sbjct:   117 -WIPKVLKRGVLDIDLHITSSRNYCENSSFYSLPSKIFVSKTLVRLKIQFQDGVHIDVE- 174

Query:   186 DSIMLCSLKKLTLERVCLDEQMVQKLASECPLLEDLCFSNC-W 227
               + L  LK L L+   ++  M+ KL S C  LE+L  +N  W
Sbjct:   175 GGVSLPKLKTLHLDYFKIETSMLNKLLSGCHALEELVLANLMW 217




GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2085013 AT3G42770 "AT3G42770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055993 AT2G04230 "AT2G04230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160205 AT5G54820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126096 AT4G00320 "AT4G00320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081247 AT3G59160 "AT3G59160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092737 AT3G18150 "AT3G18150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052362 AT2G42720 "AT2G42720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016630 AT1G58310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 360
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.81
KOG4341483 consensus F-box protein containing LRR [General fu 99.63
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.09
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.01
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.93
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.88
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.87
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.77
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.67
KOG4341483 consensus F-box protein containing LRR [General fu 98.67
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.67
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.62
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.58
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.58
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.49
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.47
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.44
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.36
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.33
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.3
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.3
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.05
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.86
KOG1947 482 consensus Leucine rich repeat proteins, some prote 97.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.6
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.57
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.43
KOG0617264 consensus Ras suppressor protein (contains leucine 97.35
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.32
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.23
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.16
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.11
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.05
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.03
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.0
KOG4237 498 consensus Extracellular matrix protein slit, conta 96.89
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 96.7
PRK15386 426 type III secretion protein GogB; Provisional 96.62
KOG0617264 consensus Ras suppressor protein (contains leucine 96.61
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.38
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 96.26
PRK15386 426 type III secretion protein GogB; Provisional 96.06
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 96.02
KOG0281499 consensus Beta-TrCP (transducin repeats containing 95.88
PLN03150623 hypothetical protein; Provisional 95.78
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 95.71
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.61
KOG0472 565 consensus Leucine-rich repeat protein [Function un 95.49
PLN03150623 hypothetical protein; Provisional 95.46
KOG2997366 consensus F-box protein FBX9 [General function pre 95.46
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.34
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.33
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 95.16
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 94.74
KOG0472 565 consensus Leucine-rich repeat protein [Function un 94.54
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 94.36
KOG4237 498 consensus Extracellular matrix protein slit, conta 94.02
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 93.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 93.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 92.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 91.23
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.94
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 90.11
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 89.9
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.6
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 88.28
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.71
PF13013109 F-box-like_2: F-box-like domain 84.58
KOG3926332 consensus F-box proteins [Amino acid transport and 81.39
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 80.49
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.81  E-value=3.6e-21  Score=163.97  Aligned_cols=274  Identities=23%  Similarity=0.251  Sum_probs=185.3

Q ss_pred             cccccCCchHHHHHHhcCCChhhhhhhcccccchhhhhccc---ceEEeeCCCcCCCCCCCcccccccccccchhhHhHH
Q 018106           17 MDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSF---PILDFDQNYFFPGASRLDYGSFCVRKQNYSFSETVK   93 (360)
Q Consensus        17 ~d~i~~LPd~iL~~I~s~L~~~~~~~~~~vskrW~~l~~~~---~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   93 (360)
                      +--+..|||||+..||+.|+.+|+.+++.|||||.++...-   ..+++..+...+                        
T Consensus        95 gv~~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p------------------------  150 (419)
T KOG2120|consen   95 GVSWDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIHP------------------------  150 (419)
T ss_pred             CCCcccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccCh------------------------
Confidence            33478899999999999999999999999999999764321   123444444322                        


Q ss_pred             HHHHHHHHHHhhhhcCCcccceEEEEeecCCCCCChhhHHHHHHHH--HHcCceEEEeecccCCCccccCcccccccCCc
Q 018106           94 KFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLA--VENGVRELDFENITDENTVYTLPQAIFSANSV  171 (360)
Q Consensus        94 ~~~~~i~~~l~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~l~~~--~~~~l~~L~~~l~~~~~~~~~l~~~l~~~~~L  171 (360)
                         +...+.+      ...+..|++-  ... .    +-++..+.+  ...++++++  +.........+...+..|..|
T Consensus       151 ---~~l~~l~------~rgV~v~Rla--r~~-~----~~prlae~~~~frsRlq~lD--LS~s~it~stl~~iLs~C~kL  212 (419)
T KOG2120|consen  151 ---DVLGRLL------SRGVIVFRLA--RSF-M----DQPRLAEHFSPFRSRLQHLD--LSNSVITVSTLHGILSQCSKL  212 (419)
T ss_pred             ---hHHHHHH------hCCeEEEEcc--hhh-h----cCchhhhhhhhhhhhhHHhh--cchhheeHHHHHHHHHHHHhh
Confidence               2223333      2344444433  110 1    112233322  335688888  655555556666677779999


Q ss_pred             cEEEEeeeeccCCC--CccCCCCCCEEEeeeEEe-ChHHHHHHHhcCCcccEEEeecCCCCCcc---cccc-CCCccEEE
Q 018106          172 TNLRLVWCRLEQPF--DSIMLCSLKKLTLERVCL-DEQMVQKLASECPLLEDLCFSNCWGLKHL---CVSK-ASKLKIME  244 (360)
Q Consensus       172 ~~L~L~~~~~~~~~--~~~~~~~L~~L~L~~~~~-~~~~l~~l~~~cp~Le~L~l~~c~~~~~~---~i~~-l~~L~~L~  244 (360)
                      +.|+|.+..+.++-  ....=.+|+.|+++++.- +..+++-++..|..|.+|+|..|......   .+.+ -++|+.|+
T Consensus       213 k~lSlEg~~LdD~I~~~iAkN~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LN  292 (419)
T KOG2120|consen  213 KNLSLEGLRLDDPIVNTIAKNSNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLN  292 (419)
T ss_pred             hhccccccccCcHHHHHHhccccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhh
Confidence            99999999887654  333447899999999985 88889999999999999999999765432   1111 27999999


Q ss_pred             ecccc-----chhhhHhhcCCCccEEEEEeecC-CCcceeeccCCCCccEEEeeccc-cCcHHHHHHhcCCCCCCEEEec
Q 018106          245 IRSFS-----EEIEIVEISVPSLQQLTLLFYGA-RRPRVVEVARSPHLKKLDLVSVY-FADNEFNHLISKFPSLEDLFVT  317 (360)
Q Consensus       245 l~~~~-----~~~~~~~~~~p~L~~L~l~~~~~-~~~~~~~~~~~~~L~~L~l~~~~-~~~~~~~~~~~~~~~L~~L~L~  317 (360)
                      +++|.     ..+..+...||+|..|+++++.. .......+.+++.|++|+++.+. +....+.+ +...|.|.+|++.
T Consensus       293 lsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~v~l~~~~~~~~~kf~~L~~lSlsRCY~i~p~~~~~-l~s~psl~yLdv~  371 (419)
T KOG2120|consen  293 LSGYRRNLQKSHLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFKFNYLQHLSLSRCYDIIPETLLE-LNSKPSLVYLDVF  371 (419)
T ss_pred             hhhhHhhhhhhHHHHHHHhCCceeeeccccccccCchHHHHHHhcchheeeehhhhcCCChHHeee-eccCcceEEEEec
Confidence            99987     33444456899999999996543 22333456788999999997665 33343443 5678999999999


Q ss_pred             CcCChhh---hhhcCCccc
Q 018106          318 RCCLPGK---IKISSNQLK  333 (360)
Q Consensus       318 ~c~~~~~---i~~~~~~L~  333 (360)
                      +|.....   +...+++|+
T Consensus       372 g~vsdt~mel~~e~~~~lk  390 (419)
T KOG2120|consen  372 GCVSDTTMELLKEMLSHLK  390 (419)
T ss_pred             cccCchHHHHHHHhCcccc
Confidence            9844433   334444433



>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG3926 consensus F-box proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 9e-04
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
 Score = 48.7 bits (116), Expect = 1e-06
 Identities = 58/346 (16%), Positives = 113/346 (32%), Gaps = 71/346 (20%)

Query: 20  ISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVSFPILDFDQNYFFPGASRLDYGSF 79
              LP  ++  + S L   E+ + S + K+W +L  S   L                   
Sbjct: 9   WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRL-ASDESL-----------------WQ 50

Query: 80  CVRKQNYSFSETVKKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLA 139
            +     +    V   +            L   +  FR   +F+D   +       ++  
Sbjct: 51  TLDLTGKNLHPDVTGRL------------LSQGVIAFRCPRSFMDQPLAEHFSPFRVQH- 97

Query: 140 VENGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPFDSIM-----LCSLK 194
                 +L    I       TL   +   + + NL L   RL    D I+       +L 
Sbjct: 98  -----MDLSNSVIEVS----TLHGILSQCSKLQNLSLEGLRL---SDPIVNTLAKNSNLV 145

Query: 195 KLTLERVC-LDEQMVQKLASECPLLEDLCFSNCW-----GLKHLCVSKASKLKIMEIRSF 248
           +L L       E  +Q L S C  L++L  S C+      ++      +  +  + +  +
Sbjct: 146 RLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGY 205

Query: 249 SEEIE---IVEISV--PSLQQLTLLFYGARRPRV-----VEVARSPHLKKLDLVSVY-FA 297
            + ++   +  +    P+L  L L    +    +      E  +  +L+ L L   Y   
Sbjct: 206 RKNLQKSDLSTLVRRCPNLVHLDL----SDSVMLKNDCFQEFFQLNYLQHLSLSRCYDII 261

Query: 298 DNEFNHLISKFPSLEDLFVTRCCLPGKIKISSNQLKNLLFRSCKYL 343
                 L  + P+L+ L V      G +++    L +L   +C + 
Sbjct: 262 PETLLEL-GEIPTLKTLQVFGIVPDGTLQLLKEALPHLQ-INCSHF 305


>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.54
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.5
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.39
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.33
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.29
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.26
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.26
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.25
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.24
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.23
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.22
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.2
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.2
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.19
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.17
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.17
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.15
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.1
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.03
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.02
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.02
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.01
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.01
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.0
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.99
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.99
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.99
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.99
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.98
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.98
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.97
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.95
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.95
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.94
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.92
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.92
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.91
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.88
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.88
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.87
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.84
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.78
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.76
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.75
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.74
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.73
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.71
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.69
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.66
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.64
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.62
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.59
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.58
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.52
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.49
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.49
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.47
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.46
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.45
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.4
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.4
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.4
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.39
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.36
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.35
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.29
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.1
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.02
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.96
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 97.95
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.89
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.89
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.86
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.85
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.83
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.78
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.76
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.71
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.67
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.37
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.22
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.93
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.89
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.33
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.29
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 96.03
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 95.71
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.12
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.34
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.21
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 92.84
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.75
4gt6_A394 Cell surface protein; leucine rich repeats, putati 90.72
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 86.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 83.18
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.90  E-value=4e-24  Score=195.34  Aligned_cols=280  Identities=20%  Similarity=0.260  Sum_probs=179.5

Q ss_pred             ccccccCCchHHHHHHhcCCChhhhhhhcccccchhhhhcc---cceEEeeCCCcCCCCCCCcccccccccccchhhHhH
Q 018106           16 AMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQLYVS---FPILDFDQNYFFPGASRLDYGSFCVRKQNYSFSETV   92 (360)
Q Consensus        16 ~~d~i~~LPd~iL~~I~s~L~~~~~~~~~~vskrW~~l~~~---~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (360)
                      +...++.||||++.+||+||+.+|+++++.|||+|+++...   +..+++....+.                        
T Consensus         5 ~~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~~~~~~~~~l~l~~~~~~------------------------   60 (336)
T 2ast_B            5 PGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLH------------------------   60 (336)
T ss_dssp             --CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHHTCSTTSSEEECTTCBCC------------------------
T ss_pred             ccCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCchhheeeccccccCC------------------------
Confidence            35678999999999999999999999999999999998531   223444433321                        


Q ss_pred             HHHHHHHHHHHhhhhcCCcccceEEEEeecCCCCCChhhHHHHHHHHHHcCceEEEeecccCCCccccCcccccccCCcc
Q 018106           93 KKFMDFVDASLVRFCKLKFCIQKFRLFLTFLDVKGSAPIVDRWIRLAVENGVRELDFENITDENTVYTLPQAIFSANSVT  172 (360)
Q Consensus        93 ~~~~~~i~~~l~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~l~~~~~~~l~~L~~~l~~~~~~~~~l~~~l~~~~~L~  172 (360)
                         ...+...+      ...++.+.+.....  ......      ....+++++|+  +..+......++..+..+++|+
T Consensus        61 ---~~~~~~~~------~~~l~~L~l~~n~l--~~~~~~------~~~~~~L~~L~--L~~~~l~~~~~~~~~~~~~~L~  121 (336)
T 2ast_B           61 ---PDVTGRLL------SQGVIAFRCPRSFM--DQPLAE------HFSPFRVQHMD--LSNSVIEVSTLHGILSQCSKLQ  121 (336)
T ss_dssp             ---HHHHHHHH------HTTCSEEECTTCEE--CSCCCS------CCCCBCCCEEE--CTTCEECHHHHHHHHTTBCCCS
T ss_pred             ---HHHHHhhh------hccceEEEcCCccc--cccchh------hccCCCCCEEE--ccCCCcCHHHHHHHHhhCCCCC
Confidence               11122221      12344444321110  000000      01126888888  6544332233555666789999


Q ss_pred             EEEEeeeeccCCC--CccCCCCCCEEEeeeE-EeChHHHHHHHhcCCcccEEEeecCCCCCccc----cccCC-CccEEE
Q 018106          173 NLRLVWCRLEQPF--DSIMLCSLKKLTLERV-CLDEQMVQKLASECPLLEDLCFSNCWGLKHLC----VSKAS-KLKIME  244 (360)
Q Consensus       173 ~L~L~~~~~~~~~--~~~~~~~L~~L~L~~~-~~~~~~l~~l~~~cp~Le~L~l~~c~~~~~~~----i~~l~-~L~~L~  244 (360)
                      +|++.+|.+....  ....+++|++|.++++ .+++..+..++..||+|++|++.+|..+....    +..++ +|++|+
T Consensus       122 ~L~L~~~~l~~~~~~~l~~~~~L~~L~L~~~~~l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~  201 (336)
T 2ast_B          122 NLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLN  201 (336)
T ss_dssp             EEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEE
T ss_pred             EEeCcCcccCHHHHHHHhcCCCCCEEECCCCCCCCHHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEE
Confidence            9999988765322  3345889999999998 56777788888889999999999884454321    34578 999999


Q ss_pred             ecccc-----chhhhHhhcCCCccEEEEEeec-CCCcceeeccCCCCccEEEeecc-ccCcHHHHHHhcCCCCCCEEEec
Q 018106          245 IRSFS-----EEIEIVEISVPSLQQLTLLFYG-ARRPRVVEVARSPHLKKLDLVSV-YFADNEFNHLISKFPSLEDLFVT  317 (360)
Q Consensus       245 l~~~~-----~~~~~~~~~~p~L~~L~l~~~~-~~~~~~~~~~~~~~L~~L~l~~~-~~~~~~~~~~~~~~~~L~~L~L~  317 (360)
                      +.+|.     ..+......+|+|++|+++.+. ........+..+++|+.|++.++ .+.+..+ ..+..+++|++|+++
T Consensus       202 l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~-~~l~~~~~L~~L~l~  280 (336)
T 2ast_B          202 LSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETL-LELGEIPTLKTLQVF  280 (336)
T ss_dssp             CCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCCGGGG-GGGGGCTTCCEEECT
T ss_pred             eCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHHHHHHHhCCCCCCEeeCCCCCCCCHHHH-HHHhcCCCCCEEecc
Confidence            98883     1233344578899999998665 33334445677899999999877 4555544 235678999999999


Q ss_pred             CcCChhhhhhcCCccceEeccc
Q 018106          318 RCCLPGKIKISSNQLKNLLFRS  339 (360)
Q Consensus       318 ~c~~~~~i~~~~~~L~~L~l~~  339 (360)
                      +|...+.+.....+|+.|++.+
T Consensus       281 ~~i~~~~~~~l~~~l~~L~l~~  302 (336)
T 2ast_B          281 GIVPDGTLQLLKEALPHLQINC  302 (336)
T ss_dssp             TSSCTTCHHHHHHHSTTSEESC
T ss_pred             CccCHHHHHHHHhhCcceEEec
Confidence            8822222222223466666643



>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 360
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 1e-05
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 7e-05
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 7e-04
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 0.003
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.6 bits (97), Expect = 1e-05
 Identities = 11/42 (26%), Positives = 21/42 (50%)

Query: 12 ETVVAMDRISELPTFIIHHLMSYLSAKEVARTSVLSKKWNQL 53
          E     D IS LP  +  +++S+L  K++ + +   + W  L
Sbjct: 11 EPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRIL 52


>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.2
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.19
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.19
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.18
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.15
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.07
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.05
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.96
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.91
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.89
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.86
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.76
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.68
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.66
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.57
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.55
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.53
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.52
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.43
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.42
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.07
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.02
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.82
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.73
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.69
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.87
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.35
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.08
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.62  E-value=3.2e-16  Score=137.43  Aligned_cols=198  Identities=20%  Similarity=0.261  Sum_probs=144.1

Q ss_pred             cCceEEEeecccCCCccccCcccccccCCccEEEEeeeeccCCC--CccCCCCCCEEEeeeEE-eChHHHHHHHhcCCcc
Q 018106          142 NGVRELDFENITDENTVYTLPQAIFSANSVTNLRLVWCRLEQPF--DSIMLCSLKKLTLERVC-LDEQMVQKLASECPLL  218 (360)
Q Consensus       142 ~~l~~L~~~l~~~~~~~~~l~~~l~~~~~L~~L~L~~~~~~~~~--~~~~~~~L~~L~L~~~~-~~~~~l~~l~~~cp~L  218 (360)
                      .++++|+  +..+......+...+..|++|++|++.+|.+....  ....+++|++|+++++. +++.++..++.+||+|
T Consensus        46 ~~L~~Ld--Ls~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L  123 (284)
T d2astb2          46 FRVQHMD--LSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRL  123 (284)
T ss_dssp             BCCCEEE--CTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTC
T ss_pred             CCCCEEE--CCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhc
Confidence            4788888  65544444445555566999999999999765432  34568999999999975 5889999999999999


Q ss_pred             cEEEeecCCCCCcccc-----ccCCCccEEEecccc-----chhhhHhhcCCCccEEEEEeecC-CCcceeeccCCCCcc
Q 018106          219 EDLCFSNCWGLKHLCV-----SKASKLKIMEIRSFS-----EEIEIVEISVPSLQQLTLLFYGA-RRPRVVEVARSPHLK  287 (360)
Q Consensus       219 e~L~l~~c~~~~~~~i-----~~l~~L~~L~l~~~~-----~~~~~~~~~~p~L~~L~l~~~~~-~~~~~~~~~~~~~L~  287 (360)
                      ++|++.+|..+....+     ..+++|++|.+.+|.     ..+..+.-.+|+|++|++..+.. .+.....+..+++|+
T Consensus       124 ~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~  203 (284)
T d2astb2         124 DELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQ  203 (284)
T ss_dssp             CEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCC
T ss_pred             cccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcccCcCC
Confidence            9999999987654222     124799999999874     23445556899999999986543 334445577899999


Q ss_pred             EEEeecc-ccCcHHHHHHhcCCCCCCEEEecCcCC---hhhhhhcCCccceEecccccccccc
Q 018106          288 KLDLVSV-YFADNEFNHLISKFPSLEDLFVTRCCL---PGKIKISSNQLKNLLFRSCKYLKSA  346 (360)
Q Consensus       288 ~L~l~~~-~~~~~~~~~~~~~~~~L~~L~L~~c~~---~~~i~~~~~~L~~L~l~~c~~l~~~  346 (360)
                      +|++.++ .+++..+.. +..+|+|++|++.+|..   +..+...+|+|+   + +|.+++..
T Consensus       204 ~L~L~~C~~i~~~~l~~-L~~~~~L~~L~l~~~~~d~~l~~l~~~lp~L~---i-~~~~ls~~  261 (284)
T d2astb2         204 HLSLSRCYDIIPETLLE-LGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQ---I-NCSHFTTI  261 (284)
T ss_dssp             EEECTTCTTCCGGGGGG-GGGCTTCCEEECTTSSCTTCHHHHHHHSTTSE---E-SCCCSCCT
T ss_pred             EEECCCCCCCChHHHHH-HhcCCCCCEEeeeCCCCHHHHHHHHHhCcccc---c-cCccCCCC
Confidence            9999874 578776665 56799999999999833   344445566655   3 45555543



>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure