Citrus Sinensis ID: 018110


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MELQLQRHRKFIKYSINEAATADICPSYCDLSDTSSFCSPPCLTSCPSYCHNFLQSLIPTPSPVTFKYHVHHKSRKFLIITASALATTIVAVLCYVVFVKFYLRRRSSSEPRILNETHDDFLDEDHGPVVDHPIWYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIVKINHAARAPPSSSTWESNNEDSGTRESTQVGILTENGGRNDMESEIGAVERRNINERNDQDSDDEIQPIRRSVSLDSLSASKMIHALGNFDPEETTRNSDTQLAKERYLSVKTVPKKVGRSESLMRPLENAPVSLKRSLSCSGKFLL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHccEEEEEccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHcccccccccHHHHHHccEEEEEccccccccccEEEEEccccccccEEEcccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEccccEcccccccccccccccccccccccccccccccccccccccccEEEEEccccccEEEccccccccccccccccEEEc
MELQLQRHRKFIKYSIneaatadicpsycdlsdtssfcsppcltscpsychnflqsliptpspvtfkyhvhhksRKFLIITASALATTIVAVLCYVVFVKFYLRrrssseprilnethddfldedhgpvvdhpiwYINTVGLQSSVIREIAVLKYkksdglvegtecsvclsefqedetlrllpkcnhafHISCIDTWlrshtncplcrspivkinhaarappssstwesnnedsgtrestqvgiltenggrndmeseiGAVErrninerndqdsddeiqpirrsvsldsLSASKMIHalgnfdpeettrnsdtqLAKERYLSvktvpkkvgrseslmrplenapvslkrslscsgkfll
MELQLQRHRKFIKYSINEAATADICPSYCDLSDTSSFCSPPCLTSCPSYCHNFLQSLIPTPSPVTFKYHVHHKSRKFLIITASALATTIVAVLCYVVFVKFYLrrrssseprilNETHDDFLDEDHGPVVDHPIWYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIVKINHaarappssstwesnnedsgtrestqvgiltenggrndmeseigaverrninerndqdsddeiqpiRRSVSLDSLSASKMIHalgnfdpeettrnsdtqlakerylsvktvpkkvgrseslmrplenapvslkrslscsgkfll
MELQLQRHRKFIKYSINEAATADICPSYCDLSDTSSFCSPPCLTSCPSYCHNFLQSLIPTPSPVTFKYHVHHKSRKFLIITASALATTIVAVLCYVVFVKFYLRRRSSSEPRILNETHDDFLDEDHGPVVDHPIWYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIVKINHAARAPPSSSTWESNNEDSGTRESTQVGILTENGGRNDMESEIGAVERRNINERNDQDSDDEIQPIRRSVSLDSLSASKMIHALGNFDPEETTRNSDTQLAKERYLSVKTVPKKVGRSESLMRPLENAPVSLKRSLSCSGKFLL
********RKFIKYSINEAATADICPSYCDLSDTSSFCSPPCLTSCPSYCHNFLQSLIPTPSPVTFKYHVHHKSRKFLIITASALATTIVAVLCYVVFVKFYLRR********L**THDDFLDEDHGPVVDHPIWYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIVKINH***********************************************************************************************************************************************
**********FIKYSINEAATADICPSYCDLSDTSSFCSPPCLTSCPSYCHNFL*********************KFLIITASALATTIVAVLCYVVFVKFYLRRR***********************************L**SVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIV********************************************************************************************************************************************CSGKFLL
MELQLQRHRKFIKYSINEAATADICPSYCDLSDTSSFCSPPCLTSCPSYCHNFLQSLIPTPSPVTFKYHVHHKSRKFLIITASALATTIVAVLCYVVFVKFYLRRRSSSEPRILNETHDDFLDEDHGPVVDHPIWYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIVKINHA**********************TQVGILTENGGRNDMESEIGAVERRNINERNDQDSDDEIQPIRRSVSLDSLSASKMIHALGNFDPE*********LAKERYLSVKTVPKKVGRSESLMRPLENA****************
*ELQLQRHRKFIKYSINEAATADICPSYCDLSDTSSFCSPPCLTSCPSYCHNFLQSLIPTPSPVTFKYHVHHKSRKFLIITASALATTIVAVLCYVVFVKFYLRRR**************************PIWYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIV************************************************************************************************************LSVKTVPKKVGRSESLMRPLEN*****************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELQLQRHRKFIKYSINEAATADICPSYCDLSDTSSFCSPPCLTSCPSYCHNFLQSLIPTPSPVTFKYHVHHKSRKFLIITASALATTIVAVLCYVVFVKFYLRRRSSSEPRILNETHDDFLDEDHGPVVDHPIWYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIVKINHAARAPPSSSTWESNNEDSGTRESTQVGILTENGGRNDMESEIGAVERRNINERNDQDSDDEIQPIRRSVSLDSLSASKMIHALGNFDPEETTRNSDTQLAKERYLSVKTVPKKVGRSESLMRPLENAPVSLKRSLSCSGKFLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query360 2.2.26 [Sep-21-2011]
Q8LFY8413 RING-H2 finger protein AT no no 0.386 0.336 0.503 4e-36
Q9LF64362 RING-H2 finger protein AT no no 0.711 0.707 0.340 3e-32
Q9LX93301 E3 ubiquitin-protein liga no no 0.277 0.332 0.567 2e-30
Q9SRQ8356 RING-H2 finger protein AT no no 0.461 0.466 0.401 8e-29
P0C041310 Putative RING-H2 finger p no no 0.461 0.535 0.358 1e-24
Q7XLY8383 E3 ubiquitin-protein liga no no 0.386 0.362 0.402 4e-24
Q8GW38369 RING-H2 finger protein AT no no 0.452 0.441 0.329 6e-23
Q84W40404 RING-H2 finger protein AT no no 0.344 0.306 0.373 1e-20
P93823381 RING-H2 finger protein AT no no 0.322 0.304 0.394 7e-20
Q9SL78390 Putative RING-H2 finger p no no 0.344 0.317 0.384 9e-19
>sp|Q8LFY8|ATL54_ARATH RING-H2 finger protein ATL54 OS=Arabidopsis thaliana GN=ATL54 PE=2 SV=2 Back     alignment and function desciption
 Score =  152 bits (384), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 90/141 (63%), Gaps = 2/141 (1%)

Query: 77  FLIITASALATTIVAVLCYVVFVKFYLRRRSSSEPRILNETHDDFLDEDHG--PVVDHPI 134
            + IT + LA  +        F    + R +    +  NE +D  ++E+      VDHPI
Sbjct: 85  IITITGAVLAILLTGFFLVAKFFSDSVNRVNQGTYQSDNEDNDTVMEEEFQDREQVDHPI 144

Query: 135 WYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISC 194
           W I T GLQ S+I  I +  YK+ DGL+E T+C VCL+EF+EDE+LRLLPKCNHAFHISC
Sbjct: 145 WLIRTTGLQQSIINSITICNYKRGDGLIERTDCPVCLNEFEEDESLRLLPKCNHAFHISC 204

Query: 195 IDTWLRSHTNCPLCRSPIVKI 215
           IDTWL SHTNCPLCR+ I  I
Sbjct: 205 IDTWLSSHTNCPLCRAGIAMI 225





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LF64|ATL52_ARATH RING-H2 finger protein ATL52 OS=Arabidopsis thaliana GN=ATL52 PE=2 SV=1 Back     alignment and function description
>sp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana GN=ATL55 PE=1 SV=1 Back     alignment and function description
>sp|Q9SRQ8|ATL51_ARATH RING-H2 finger protein ATL51 OS=Arabidopsis thaliana GN=ATL51 PE=2 SV=2 Back     alignment and function description
>sp|P0C041|ATL53_ARATH Putative RING-H2 finger protein ATL53 OS=Arabidopsis thaliana GN=ATL53 PE=3 SV=2 Back     alignment and function description
>sp|Q7XLY8|ATL41_ORYSJ E3 ubiquitin-protein ligase Os04g0590900 OS=Oryza sativa subsp. japonica GN=Os04g0590900 PE=2 SV=2 Back     alignment and function description
>sp|Q8GW38|ATL47_ARATH RING-H2 finger protein ATL47 OS=Arabidopsis thaliana GN=ATL47 PE=2 SV=1 Back     alignment and function description
>sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 Back     alignment and function description
>sp|P93823|ATL1_ARATH RING-H2 finger protein ATL1 OS=Arabidopsis thaliana GN=ATL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SL78|ATL12_ARATH Putative RING-H2 finger protein ATL12 OS=Arabidopsis thaliana GN=ATL12 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
255563198378 ring finger protein, putative [Ricinus c 0.938 0.894 0.470 2e-79
225465766379 PREDICTED: RING-H2 finger protein ATL54 0.927 0.881 0.454 3e-72
147769273404 hypothetical protein VITISV_008030 [Viti 0.941 0.839 0.377 3e-58
359492465404 PREDICTED: RING-H2 finger protein ATL54- 0.941 0.839 0.377 3e-58
359480496372 PREDICTED: uncharacterized protein LOC10 0.772 0.747 0.398 1e-56
255587015344 ring finger protein, putative [Ricinus c 0.758 0.793 0.415 1e-55
388491910360 unknown [Medicago truncatula] 0.85 0.85 0.397 1e-55
357476255360 RING-H2 finger protein ATL1O [Medicago t 0.85 0.85 0.397 2e-55
224063285389 predicted protein [Populus trichocarpa] 0.922 0.853 0.384 1e-54
449479061360 PREDICTED: RING-H2 finger protein ATL54- 0.847 0.847 0.414 1e-53
>gi|255563198|ref|XP_002522602.1| ring finger protein, putative [Ricinus communis] gi|223538078|gb|EEF39689.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  302 bits (773), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 182/387 (47%), Positives = 234/387 (60%), Gaps = 49/387 (12%)

Query: 1   MELQLQRHRKFIKYSINEAATADICPSYCDLSDTSSFCSPPCLTSCPSYCHNFLQSLIPT 60
           M LQ    RK +  S NE A + IC S C L + +  C   C     SYC+      +P 
Sbjct: 1   MGLQF---RKLLDDSYNETALSKICSSKCVLEEDTYSCDGVC-----SYCYVNCSYKLPP 52

Query: 61  PSPVTFKYHVHHKSRKFLIITASALATTIVAVLCYVVFVKFYL--RRRSSSEPR-ILNET 117
           PS        H       +I    L++    V CY ++ KFY   RR  SS+P+   NET
Sbjct: 53  PS-------THRSISGKFLIAGLVLSSVFFLVFCYAIYYKFYSGSRRGRSSQPQDQRNET 105

Query: 118 -HDDFLDEDHGPVVDHPIWYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQE 176
            H++FLDEDHGP++DHP+WYINT+GLQ SVI  I+V KYK+ DGLVEGT+CSVCL+EF+E
Sbjct: 106 THEEFLDEDHGPILDHPVWYINTIGLQPSVINSISVCKYKRGDGLVEGTDCSVCLNEFEE 165

Query: 177 DETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIVKINHAARAPPSSSTWESNNEDSG 236
           DETLRLLPKC+HAFHI CIDTWLRSHTNCPLCR+PIV   ++ARA  S  T ES +    
Sbjct: 166 DETLRLLPKCSHAFHIPCIDTWLRSHTNCPLCRAPIVA--NSARATSSEGTSESLS---- 219

Query: 237 TRESTQVGILTENGGRNDMESEIGAVERR------------NINERND--QDSDDEIQPI 282
           + E T++G+ +EN   ++ E E G  E R            N  +R++     ++ IQPI
Sbjct: 220 SGEETRIGV-SENDQESERELEGGDGELRVGIEEEREVEDENTRKRSEFLNGEEEGIQPI 278

Query: 283 RRSVSLDSLSASKMIHALGNFDPEETTRNSDTQLAKERYLSVKTVPKKVGRSESLM---- 338
           RRSVSLDSLSA K+  AL +  P E+ RNS T L  E   S++ VPK+VG ++SL+    
Sbjct: 279 RRSVSLDSLSAFKISQALVSVCPVESDRNSRTGLVNESESSMEIVPKRVGSNQSLLKFMA 338

Query: 339 -----RPLENAPVSLKRSLSCSGKFLL 360
                R L+  P S+KRSLSC GK  L
Sbjct: 339 SSSIGRSLQIGPSSIKRSLSCGGKLFL 365




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225465766|ref|XP_002266755.1| PREDICTED: RING-H2 finger protein ATL54 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147769273|emb|CAN61577.1| hypothetical protein VITISV_008030 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492465|ref|XP_003634417.1| PREDICTED: RING-H2 finger protein ATL54-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480496|ref|XP_003632477.1| PREDICTED: uncharacterized protein LOC100854068 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255587015|ref|XP_002534099.1| ring finger protein, putative [Ricinus communis] gi|223525847|gb|EEF28281.1| ring finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388491910|gb|AFK34021.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357476255|ref|XP_003608413.1| RING-H2 finger protein ATL1O [Medicago truncatula] gi|355509468|gb|AES90610.1| RING-H2 finger protein ATL1O [Medicago truncatula] Back     alignment and taxonomy information
>gi|224063285|ref|XP_002301077.1| predicted protein [Populus trichocarpa] gi|222842803|gb|EEE80350.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449479061|ref|XP_004155494.1| PREDICTED: RING-H2 finger protein ATL54-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
TAIR|locus:505006547367 AT4G33565 [Arabidopsis thalian 0.811 0.795 0.406 2.4e-51
TAIR|locus:2207066413 AT1G72220 [Arabidopsis thalian 0.736 0.641 0.363 2.4e-37
TAIR|locus:2151421362 AT5G17600 [Arabidopsis thalian 0.677 0.674 0.348 6.7e-33
TAIR|locus:2142449301 RING1 [Arabidopsis thaliana (t 0.572 0.684 0.384 8.5e-33
TAIR|locus:2096444356 AT3G03550 [Arabidopsis thalian 0.686 0.693 0.356 7.7e-32
UNIPROTKB|Q7XLY8383 LOC_Os04g50100 "E3 ubiquitin-p 0.691 0.650 0.298 1e-27
TAIR|locus:4515103413310 ATL4H [Arabidopsis thaliana (t 0.466 0.541 0.351 3.2e-26
TAIR|locus:2199902369 AT1G23980 [Arabidopsis thalian 0.594 0.579 0.3 1.6e-24
TAIR|locus:2018334381 AT1G04360 [Arabidopsis thalian 0.380 0.359 0.388 2.1e-21
TAIR|locus:2081740257 ATL5 "AtL5" [Arabidopsis thali 0.411 0.575 0.318 2e-19
TAIR|locus:505006547 AT4G33565 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 533 (192.7 bits), Expect = 2.4e-51, P = 2.4e-51
 Identities = 131/322 (40%), Positives = 183/322 (56%)

Query:     1 MELQLQR--HRKFIKYSINEAATADICPSYC--DLSDTSSFCSPPCLTSCPSYCHNFLQS 56
             +E ++ R  HR  ++    E  +  +C + C  +L  T  +CS  CL  CPS C   + S
Sbjct:    49 LEARIMRFLHRFLLEDMPKETFSDSLCKNNCIQELK-TLGYCSSYCLDECPSICEIVVIS 107

Query:    57 LIPTPSPVTFKYHVHHKSRKFLIITASALATTIVAVLCYVVFVKFYLRRRSS---SEPRI 113
              +  P+ +    H     ++ LII+AS++ TT+  +   V+  KFY RRR S   S    
Sbjct:   108 GLSPPAEI----HHDDNLKRILIISASSIITTLFLLTLLVLCFKFYYRRRRSITTSRRWS 163

Query:   114 LNETHD-DFLDEDHGPVVDHPIWYINTVGLQSSVIREIAVLKYKKSDGLVEGTECSVCLS 172
             + E  + DF D     +VDHPIW+I T+GL  +VI  I V +Y K DG+VEGT+CSVCLS
Sbjct:   164 MEEARNWDF-DGPAPVIVDHPIWHIRTIGLNPTVISSIKVCQYSKKDGVVEGTDCSVCLS 222

Query:   173 EFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIVKINHAARAPPSSSTWESNN 232
             EF+E+ETLRLLPKC HAFH+ CIDTWLRSHTNCPLCR+PIV+ N         +  + ++
Sbjct:   223 EFEEEETLRLLPKCKHAFHLYCIDTWLRSHTNCPLCRAPIVEAN---------TMIDDHS 273

Query:   233 EDSGTRESTQVGILTENGGRNDMESEIGAVERRNINERNDQD-SDDEIQPIRRSVSLDSL 291
             E  G  E + V I  ENG   D E E    ER        +D  + + Q +RRSVSLDSL
Sbjct:   274 E--GLEEIS-VMIPEENGDDTDEEIE---EERDGFVSNISRDHGESQQQRVRRSVSLDSL 327

Query:   292 SASKMIHALGNFDPEETTRNSD 313
             S  ++   +   + E+  R ++
Sbjct:   328 SGLRVSEVVVGREKEKLKRGNN 349




GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2207066 AT1G72220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151421 AT5G17600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142449 RING1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096444 AT3G03550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XLY8 LOC_Os04g50100 "E3 ubiquitin-protein ligase Os04g0590900" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:4515103413 ATL4H [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199902 AT1G23980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018334 AT1G04360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081740 ATL5 "AtL5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-15
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-12
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 4e-12
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 6e-11
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 3e-09
smart0018440 smart00184, RING, Ring finger 1e-07
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-06
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 5e-06
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 9e-06
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 2e-05
PHA02926242 PHA02926, PHA02926, zinc finger-like protein; Prov 4e-05
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 5e-05
pfam1179370 pfam11793, FANCL_C, FANCL C-terminal domain 2e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 4e-04
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 0.002
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 0.003
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 69.3 bits (170), Expect = 2e-15
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 166 ECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSP 211
           EC +CL EF+  E + +LP C H FH  C+D WLRS   CPLCR+P
Sbjct: 2   ECPICLDEFEPGEEVVVLP-CGHVFHKECLDKWLRSSNTCPLCRAP 46


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|165237 PHA02926, PHA02926, zinc finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|204746 pfam11793, FANCL_C, FANCL C-terminal domain Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 360
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.76
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.44
PHA02929238 N1R/p28-like protein; Provisional 99.24
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.21
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.19
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.16
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.87
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.86
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.79
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.73
PHA02926242 zinc finger-like protein; Provisional 98.73
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.72
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.67
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.66
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.66
PF1463444 zf-RING_5: zinc-RING finger domain 98.57
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.56
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.52
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.5
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.46
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.36
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.35
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.35
COG52191525 Uncharacterized conserved protein, contains RING Z 98.25
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.22
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.2
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.16
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.08
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.97
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.97
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.95
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.85
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.82
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.77
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.74
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.71
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.68
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.64
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.53
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.52
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.49
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.37
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.36
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.35
KOG4445368 consensus Uncharacterized conserved protein, conta 97.24
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.06
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.06
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.01
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.99
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.59
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.46
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.41
KOG1941518 consensus Acetylcholine receptor-associated protei 96.33
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.24
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.19
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.18
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.06
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.71
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.64
PHA02862156 5L protein; Provisional 95.14
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.01
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.96
PHA02825162 LAP/PHD finger-like protein; Provisional 94.94
PHA03096284 p28-like protein; Provisional 94.94
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 94.93
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.87
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.72
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 94.56
KOG2660 331 consensus Locus-specific chromosome binding protei 94.47
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 94.32
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.1
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.82
KOG3039303 consensus Uncharacterized conserved protein [Funct 93.38
COG5152259 Uncharacterized conserved protein, contains RING a 93.3
PF15102146 TMEM154: TMEM154 protein family 92.88
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 92.63
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 92.41
KOG4739233 consensus Uncharacterized protein involved in syna 92.33
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 91.47
PF04641260 Rtf2: Rtf2 RING-finger 91.42
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.16
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 90.35
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 90.18
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 89.81
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 88.95
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 88.7
PF10272358 Tmpp129: Putative transmembrane protein precursor; 88.48
KOG1940276 consensus Zn-finger protein [General function pred 87.78
COG5236 493 Uncharacterized conserved protein, contains RING Z 87.41
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 87.09
COG5175 480 MOT2 Transcriptional repressor [Transcription] 86.73
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 86.25
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 86.11
COG5222427 Uncharacterized conserved protein, contains RING Z 85.7
PF0170891 Gemini_mov: Geminivirus putative movement protein 85.63
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 85.0
KOG1001674 consensus Helicase-like transcription factor HLTF/ 84.5
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 83.42
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 83.11
KOG03091081 consensus Conserved WD40 repeat-containing protein 82.69
KOG02981394 consensus DEAD box-containing helicase-like transc 82.53
PF02009299 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR00 81.11
PF05568189 ASFV_J13L: African swine fever virus J13L protein; 80.65
KOG3653534 consensus Transforming growth factor beta/activin 80.62
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 80.2
PF10577807 UPF0560: Uncharacterised protein family UPF0560; I 80.03
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.76  E-value=3.2e-18  Score=167.45  Aligned_cols=76  Identities=32%  Similarity=0.832  Sum_probs=66.4

Q ss_pred             CCCCHHHHHhhcceEeecCCCCcCCCcccccCCccccCcceeecCCCCCCCChhhHHHHHhcCC-CCCcccCCccccC
Q 018110          140 VGLQSSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHT-NCPLCRSPIVKIN  216 (360)
Q Consensus       140 ~gl~~~~i~~lp~~~~~~~~~~~~~~~C~ICl~~~~~~~~~r~lp~C~H~FH~~CI~~Wl~~~~-tCP~CR~~l~~~~  216 (360)
                      ..+.+..++++|...|+..+.......|+||||+|+.++++|+|| |+|.||..||++||.... .||+||+++....
T Consensus       205 ~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLP-C~H~FH~~CIDpWL~~~r~~CPvCK~di~~~~  281 (348)
T KOG4628|consen  205 NRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILP-CSHKFHVNCIDPWLTQTRTFCPVCKRDIRTDS  281 (348)
T ss_pred             hhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEec-CCCchhhccchhhHhhcCccCCCCCCcCCCCC
Confidence            456788999999999998776544579999999999999999999 999999999999998764 5999999887643



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF01708 Gemini_mov: Geminivirus putative movement protein ; InterPro: IPR002621 This family consists of putative movement proteins from Maize streak virus and Wheat dwarf virus [] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF02009 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world Back     alignment and domain information
>PF05568 ASFV_J13L: African swine fever virus J13L protein; InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10577 UPF0560: Uncharacterised protein family UPF0560; InterPro: IPR018890 This family of proteins has no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 7e-14
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 5e-09
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 5e-09
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 9e-07
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 1e-06
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 2e-04
2ecl_A81 Solution Structure Of The Ring Domain Of The Human 2e-04
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 5e-04
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure

Iteration: 1

Score = 74.7 bits (182), Expect = 7e-14, Method: Composition-based stats. Identities = 27/51 (52%), Positives = 36/51 (70%) Query: 163 EGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIV 213 +G EC+VCL+E ++ E R LP+C H FH C+D WL SH+ CPLCR +V Sbjct: 4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2ECL|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring-Box Protein 2 Length = 81 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-31
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 6e-31
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-25
2ect_A78 Ring finger protein 126; metal binding protein, st 8e-24
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-22
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 2e-22
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-19
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-18
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-18
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-16
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 1e-13
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 2e-12
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-11
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-11
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 7e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 8e-10
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-09
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 6e-09
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 3e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 1e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 5e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 1e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 5e-07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3nw0_A238 Non-structural maintenance of chromosomes element 5e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 1e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 3e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 9e-05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 3e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 4e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 6e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 6e-04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 7e-04
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 7e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 7e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score =  112 bits (282), Expect = 2e-31
 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 144 SSVIREIAVLKYKKSDGLVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHT 203
           S    ++   ++  ++   E T C VC+ +F+  + LR+LP CNH FH  C+D WL+++ 
Sbjct: 3   SGSSGQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKANR 61

Query: 204 NCPLCRSPIVK 214
            CP+CR+    
Sbjct: 62  TCPICRADSGP 72


>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.63
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.59
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.5
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.48
2ect_A78 Ring finger protein 126; metal binding protein, st 99.45
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.44
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.41
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.36
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.34
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.29
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.29
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.28
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.25
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.25
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.25
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.23
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.22
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.17
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.16
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.14
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.11
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.09
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.07
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.06
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.02
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.01
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.0
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.98
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.98
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.97
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.96
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.95
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.95
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.94
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.94
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.92
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.89
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.85
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.85
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.84
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.83
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.79
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.73
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.71
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.69
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.69
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.63
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.63
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.63
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.62
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.6
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.57
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.56
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.56
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.55
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.53
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.5
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.42
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.39
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.36
2ea5_A68 Cell growth regulator with ring finger domain prot 98.33
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.33
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.3
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.15
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.11
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.97
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.96
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.87
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.85
3nw0_A238 Non-structural maintenance of chromosomes element 97.8
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.81
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.19
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.22
1we9_A64 PHD finger family protein; structural genomics, PH 85.1
2klu_A70 T-cell surface glycoprotein CD4; cell membrane, di 83.44
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 83.03
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 82.42
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 82.42
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 82.22
2knc_A54 Integrin alpha-IIB; transmembrane signaling, prote 81.7
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 80.81
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 80.13
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.63  E-value=2.4e-16  Score=125.79  Aligned_cols=77  Identities=25%  Similarity=0.640  Sum_probs=67.7

Q ss_pred             cccCCCCHHHHHhhcceEeecCCC-CcCCCcccccCCccccCcceeecCCCCCCCChhhHHHHHhcCCCCCcccCCccc
Q 018110          137 INTVGLQSSVIREIAVLKYKKSDG-LVEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIVK  214 (360)
Q Consensus       137 ~~~~gl~~~~i~~lp~~~~~~~~~-~~~~~~C~ICl~~~~~~~~~r~lp~C~H~FH~~CI~~Wl~~~~tCP~CR~~l~~  214 (360)
                      ....+++++.|+.||.+.+..... ..++..|+||++.|..++.++.+| |+|.||..||..|++.+.+||+||+.+.+
T Consensus        12 ~~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           12 VANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELP-CHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             SCCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEET-TTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             cCCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecC-CCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            356799999999999999876543 345678999999999988899999 99999999999999999999999998864



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2klu_A T-cell surface glycoprotein CD4; cell membrane, disulfide bond, HOST- virus interaction, immune response, immunoglobulin domain, lipoprotein; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 360
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-20
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 7e-14
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 7e-11
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 8e-11
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-10
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-08
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 4e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 6e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-05
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 3e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.001
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 0.001
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 81.8 bits (202), Expect = 2e-20
 Identities = 27/51 (52%), Positives = 36/51 (70%)

Query: 163 EGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIV 213
           +G EC+VCL+E ++ E  R LP+C H FH  C+D WL SH+ CPLCR  +V
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.64
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.41
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.36
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.35
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.35
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.27
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.22
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.05
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.99
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.95
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.95
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.91
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.78
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.61
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.57
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.38
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.33
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 90.04
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 86.45
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 84.61
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 83.75
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.64  E-value=3.7e-17  Score=117.69  Aligned_cols=52  Identities=52%  Similarity=1.259  Sum_probs=47.4

Q ss_pred             cCCCcccccCCccccCcceeecCCCCCCCChhhHHHHHhcCCCCCcccCCcc
Q 018110          162 VEGTECSVCLSEFQEDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRSPIV  213 (360)
Q Consensus       162 ~~~~~C~ICl~~~~~~~~~r~lp~C~H~FH~~CI~~Wl~~~~tCP~CR~~l~  213 (360)
                      .++.+|+||+++|..++.++.++.|+|.||..||.+||+.+.+||+||++|.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            3567899999999999999888779999999999999999999999999875



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure