Citrus Sinensis ID: 018158


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MAQTTPNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAGGARE
cccccccccEEEEEEEEEccccccccEEEEccccccccEEEEEEEEccccHHHHHHcccccccccccccccEEEEEEEEEcccccccccccEEEEEEEcccccccHHHccccccccccccEEEEccccccccccccccccEEEcccEEEEccccccccccccccccccccccHHHcccccccccccEEEEEccccHHHHHHHHHHHHccEEEEEcccccHHHHHHHHccccEEEEcccHHHHHHHHccccEEEEcccccccHHHHHHccccccEEEEEccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHcccccEEEEEEccccccc
ccccccccccEEEEEEEcccccccEEEEEEccccccccEEEEEEEEEcccccHHHHHcccccccccEEcccEEEEEEEEEcccccccccccEEEEEEEEccccccHHHccccHHcccccEEEEcccccccccccccccEEEEEcccEEEEccccccHHHHHHHHHHcHccccHHHHccccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHccccEEEEcccHHHHHHHHccccEEEEEccccHHHHHHHHHHccccEEEEEcccccccccccccEEEccEEEEEEEccccHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHccccEEEEEEEccHcccc
maqttpnhtqsvvgwaahdpsgkitpYIFKrrengvndvTIKILYCgichtdihhvkndwgitmypvvpgheITGIITKvgsnvknfkvgdrAAVGCLAAACMEcefckdsqenycdkiqftyngifwdgsityggysEMLVADYRFVVhvpeniamdAAAPLLCAgitvfcpmkdnnlidspakkrigivglggLGHVAVKFGKAFGHhvtvistspskEKEAKellgadefiLSTNAMQMQAGKRTLDFILDTVSAKHSLGPILELLKVngtlsvvgapeapfelpsfplifgkrsvkgsmtggmrETQEMMNVCGKynitcnievikpdQINEALDRLARNDVRYRFVIDIAGGARE
maqttpnhtqsvvgwaahdpsgKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVtvistspskekEAKELLGADEFILSTNAMQMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEapfelpsfplifGKRSVKGSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALdrlarndvryRFVIDIAGGARE
MAQTTPNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKRigivglgglghvAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAGGARE
***********VVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVIS************LGADEFILSTNAMQMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSV***********QEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIA*****
************VGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAGG***
************VGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVIS********AKELLGADEFILSTNAMQMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAGGARE
******NHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQTTPNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAGGARE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query360 2.2.26 [Sep-21-2011]
Q7XWU3360 Probable cinnamyl alcohol yes no 0.991 0.991 0.706 1e-151
P42734360 Probable cinnamyl alcohol yes no 0.961 0.961 0.580 1e-114
Q9SJ25376 Cinnamyl alcohol dehydrog no no 0.947 0.906 0.556 1e-108
Q9SJ10375 Cinnamyl alcohol dehydrog no no 0.947 0.909 0.549 1e-108
Q9ZRF1359 Probable mannitol dehydro N/A no 0.961 0.963 0.566 1e-108
P93257361 Probable mannitol dehydro N/A no 0.980 0.977 0.540 1e-106
Q2KNL6360 Geraniol dehydrogenase 1 N/A no 0.961 0.961 0.545 1e-105
P42754337 Mannitol dehydrogenase (F N/A no 0.916 0.979 0.572 1e-105
Q43137354 Probable mannitol dehydro N/A no 0.955 0.971 0.564 1e-104
Q38707365 Mannitol dehydrogenase OS N/A no 0.991 0.978 0.513 1e-103
>sp|Q7XWU3|CADH6_ORYSJ Probable cinnamyl alcohol dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CAD6 PE=2 SV=2 Back     alignment and function desciption
 Score =  533 bits (1372), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 253/358 (70%), Positives = 310/358 (86%), Gaps = 1/358 (0%)

Query: 3   QTTPNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGI 62
           + TPNHTQ+V GWAA D SGKI P++FKRRENGV+DVTIK+ YCG+CHTD+H + NDWGI
Sbjct: 2   EVTPNHTQTVSGWAAMDESGKIVPFVFKRRENGVDDVTIKVKYCGMCHTDLHFIHNDWGI 61

Query: 63  TMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFT 122
           TMYPVVPGHEITG++TKVG+NV  FKVGDR  VGC+AA+C++CE C+ S+ENYCDK+  T
Sbjct: 62  TMYPVVPGHEITGVVTKVGTNVAGFKVGDRVGVGCIAASCLDCEHCRRSEENYCDKVALT 121

Query: 123 YNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDS 182
           YNGIFWDGSITYGGYS MLVA  RFVV +P+ + +DAAAPLLCAGITV+ PMK + ++ +
Sbjct: 122 YNGIFWDGSITYGGYSGMLVAHKRFVVRIPDTLPLDAAAPLLCAGITVYSPMKQHGMLQA 181

Query: 183 -PAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQ 241
             A +R+G+VGLGGLGHVAVKFGKAFG HVTVISTSP+KE+EA+E L AD F++ST+  Q
Sbjct: 182 DAAGRRLGVVGLGGLGHVAVKFGKAFGLHVTVISTSPAKEREARENLKADNFVVSTDQKQ 241

Query: 242 MQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKG 301
           MQA  R+LD+I+DTV+A HSLGPILELLKVNG L +VGAPE P ELPSFPLIFGKR+V G
Sbjct: 242 MQAMTRSLDYIIDTVAATHSLGPILELLKVNGKLVLVGAPEKPVELPSFPLIFGKRTVSG 301

Query: 302 SMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAGGAR 359
           SMTGGM+ETQEMM++CG++NITC+IE++  D+IN+AL RLARNDVRYRFVI++ G ++
Sbjct: 302 SMTGGMKETQEMMDICGEHNITCDIEIVSTDRINDALARLARNDVRYRFVINVGGDSK 359




Involved in lignin biosynthesis. Catalyzes the final step specific for the production of lignin monomers, like coniferyl alcohol, sinapyl alcohol and 4-coumaryl alcohol.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 9EC: 5
>sp|P42734|CADH9_ARATH Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=2 SV=2 Back     alignment and function description
>sp|Q9SJ25|CADH2_ARATH Cinnamyl alcohol dehydrogenase 2 OS=Arabidopsis thaliana GN=CAD2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SJ10|CADH3_ARATH Cinnamyl alcohol dehydrogenase 3 OS=Arabidopsis thaliana GN=CAD3 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZRF1|MTDH_FRAAN Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1 Back     alignment and function description
>sp|P93257|MTDH_MESCR Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1 Back     alignment and function description
>sp|Q2KNL6|GEDH1_OCIBA Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1 Back     alignment and function description
>sp|P42754|MTDH_PETCR Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1 Back     alignment and function description
>sp|Q43137|MTDH1_STYHU Probable mannitol dehydrogenase 1 OS=Stylosanthes humilis GN=CAD1 PE=2 SV=1 Back     alignment and function description
>sp|Q38707|MTDH_APIGR Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
255539034362 alcohol dehydrogenase, putative [Ricinus 0.986 0.980 0.859 1e-178
229368450359 cinnamyl alcohol dehydrogenase 3 [Gossyp 0.994 0.997 0.824 1e-174
225457871360 PREDICTED: probable cinnamyl alcohol deh 0.986 0.986 0.817 1e-170
258549503360 putative cinnamyl alcohol dehydrogenase 0.994 0.994 0.781 1e-168
224065751360 cinnamyl alcohol dehydrogenase-like prot 0.986 0.986 0.789 1e-165
363806976361 uncharacterized protein LOC100820588 [Gl 0.991 0.988 0.765 1e-162
449437186362 PREDICTED: probable cinnamyl alcohol deh 0.983 0.977 0.769 1e-161
357438545360 Cinnamyl alcohol dehydrogenase-related p 0.991 0.991 0.765 1e-157
363807556362 uncharacterized protein LOC100779140 [Gl 0.983 0.977 0.743 1e-155
115457380360 Os04g0229100 [Oryza sativa Japonica Grou 0.991 0.991 0.706 1e-149
>gi|255539034|ref|XP_002510582.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223551283|gb|EEF52769.1| alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  630 bits (1626), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 306/356 (85%), Positives = 330/356 (92%), Gaps = 1/356 (0%)

Query: 1   MAQTTPNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDW 60
           M QTTPNHTQ+V GWAAHD SGKITPYIFKRRENG+NDVTIKILYCGICHTDIHH KNDW
Sbjct: 1   MTQTTPNHTQTVSGWAAHDSSGKITPYIFKRRENGINDVTIKILYCGICHTDIHHAKNDW 60

Query: 61  GITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQ 120
           GIT+YPVVPGHEITGIITKVGSNVKNFKVGDRA VGCLAA+C+ CEFC + QENYCD+IQ
Sbjct: 61  GITIYPVVPGHEITGIITKVGSNVKNFKVGDRAGVGCLAASCLNCEFCNNDQENYCDQIQ 120

Query: 121 FTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLI 180
            TYNGIFWDGSITYGGYSE LVAD+R+VVH+PE++ MDAAAPLLCAGITVF PMKDN L+
Sbjct: 121 LTYNGIFWDGSITYGGYSEFLVADHRYVVHIPESLPMDAAAPLLCAGITVFSPMKDNKLL 180

Query: 181 DSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAM 240
           DSP KK   IVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKE LGAD+FI+STN  
Sbjct: 181 DSPGKKIG-IVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKERLGADDFIVSTNPE 239

Query: 241 QMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVK 300
           QMQ GK+TLD ILDTVSA HSLGPILELLKVNGTL  VGAPE PFELPSFPLIFGKRSVK
Sbjct: 240 QMQEGKKTLDLILDTVSANHSLGPILELLKVNGTLVAVGAPEKPFELPSFPLIFGKRSVK 299

Query: 301 GSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAG 356
           GSMTGG++ETQEMM+VCGK+NITC+IEV+KPD+INE+LDRLARNDVRYRFVIDIAG
Sbjct: 300 GSMTGGIKETQEMMDVCGKHNITCDIEVVKPDKINESLDRLARNDVRYRFVIDIAG 355




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|229368450|gb|ACQ59091.1| cinnamyl alcohol dehydrogenase 3 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|225457871|ref|XP_002269356.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6 [Vitis vinifera] gi|302142719|emb|CBI19922.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|258549503|gb|ACV74414.1| putative cinnamyl alcohol dehydrogenase [Camellia sinensis] Back     alignment and taxonomy information
>gi|224065751|ref|XP_002301953.1| cinnamyl alcohol dehydrogenase-like protein [Populus trichocarpa] gi|118488352|gb|ABK95994.1| unknown [Populus trichocarpa] gi|222843679|gb|EEE81226.1| cinnamyl alcohol dehydrogenase-like protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|363806976|ref|NP_001242314.1| uncharacterized protein LOC100820588 [Glycine max] gi|255641358|gb|ACU20956.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449437186|ref|XP_004136373.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Cucumis sativus] gi|449528943|ref|XP_004171461.1| PREDICTED: probable cinnamyl alcohol dehydrogenase 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357438545|ref|XP_003589548.1| Cinnamyl alcohol dehydrogenase-related protein [Medicago truncatula] gi|355478596|gb|AES59799.1| Cinnamyl alcohol dehydrogenase-related protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|363807556|ref|NP_001242404.1| uncharacterized protein LOC100779140 [Glycine max] gi|255636023|gb|ACU18356.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|115457380|ref|NP_001052290.1| Os04g0229100 [Oryza sativa Japonica Group] gi|75327567|sp|Q7XWU3.2|CADH6_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase 6; Short=OsCAD6 gi|38344562|emb|CAD39904.2| OSJNBa0065B15.8 [Oryza sativa Japonica Group] gi|113563861|dbj|BAF14204.1| Os04g0229100 [Oryza sativa Japonica Group] gi|116308968|emb|CAH66093.1| H0209A05.10 [Oryza sativa Indica Group] gi|215701095|dbj|BAG92519.1| unnamed protein product [Oryza sativa Japonica Group] gi|215708763|dbj|BAG94032.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
TAIR|locus:2136278360 CAD9 "cinnamyl alcohol dehydro 0.961 0.961 0.554 1.2e-104
TAIR|locus:2052516376 CAD2 "cinnamyl alcohol dehydro 0.947 0.906 0.533 2.4e-99
TAIR|locus:2052494375 CAD3 "cinnamyl alcohol dehydro 0.947 0.909 0.526 8.2e-99
TAIR|locus:2005528359 ELI3-2 "elicitor-activated gen 0.944 0.947 0.520 7.8e-94
TAIR|locus:2120968363 CAD6 "cinnamyl alcohol dehydro 0.980 0.972 0.476 3e-92
TAIR|locus:2005527357 ELI3-1 "elicitor-activated gen 0.944 0.952 0.508 1.3e-91
UNIPROTKB|Q0JA75379 CAD7 "Cinnamyl alcohol dehydro 0.977 0.928 0.479 1.7e-89
UNIPROTKB|Q6ZHS4363 CAD2 "Cinnamyl alcohol dehydro 0.958 0.950 0.455 5e-83
TAIR|locus:2090704365 ATCAD4 [Arabidopsis thaliana ( 0.958 0.945 0.432 2e-81
UNIPROTKB|O24562367 CAD "Probable cinnamyl alcohol 0.958 0.940 0.449 4.1e-81
TAIR|locus:2136278 CAD9 "cinnamyl alcohol dehydrogenase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1036 (369.7 bits), Expect = 1.2e-104, P = 1.2e-104
 Identities = 193/348 (55%), Positives = 247/348 (70%)

Query:     8 HTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPV 67
             H   V GW A D SG ++P+ F RR+NG NDVT+KIL+CG+CHTD+H +KNDWG + YPV
Sbjct:     9 HPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPV 68

Query:    68 VPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIF 127
             VPGHEI GI TKVG NV  FK GDR  VG ++ +C  CE C    ENYC ++ FTYN I 
Sbjct:    69 VPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIG 128

Query:   128 WDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKR 187
              DG+  YGGYSE +V D RFV+  PEN+  D+ APLLCAGITV+ PMK   + +  A K 
Sbjct:   129 SDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMTE--AGKH 186

Query:   188 XXXXXXXXXXXXAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQAGKR 247
                         AVK GKAFG  VTVIS+S +K +EA   LGAD F+++T+  +M+A   
Sbjct:   187 LGVAGLGGLGHVAVKIGKAFGLKVTVISSSSTKAEEAINHLGADSFLVTTDPQKMKAAIG 246

Query:   248 TLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGM 307
             T+D+I+DT+SA H+L P+L LLKVNG L  +G PE P ELP FPL+ G++ V GS  GGM
Sbjct:   247 TMDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRKMVGGSDVGGM 306

Query:   308 RETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIA 355
             +ETQEM++ C K+NIT +IE+IK D+IN A++RLA++DVRYRFVID+A
Sbjct:   307 KETQEMLDFCAKHNITADIELIKMDEINTAMERLAKSDVRYRFVIDVA 354




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016747 "transferase activity, transferring acyl groups other than amino-acyl groups" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009809 "lignin biosynthetic process" evidence=IMP
GO:0045551 "cinnamyl-alcohol dehydrogenase activity" evidence=IMP
GO:0048046 "apoplast" evidence=IDA
TAIR|locus:2052516 CAD2 "cinnamyl alcohol dehydrogenase homolog 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052494 CAD3 "cinnamyl alcohol dehydrogenase homolog 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005528 ELI3-2 "elicitor-activated gene 3-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120968 CAD6 "cinnamyl alcohol dehydrogenase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005527 ELI3-1 "elicitor-activated gene 3-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0JA75 CAD7 "Cinnamyl alcohol dehydrogenase 7" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZHS4 CAD2 "Cinnamyl alcohol dehydrogenase 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2090704 ATCAD4 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24562 CAD "Probable cinnamyl alcohol dehydrogenase" [Zea mays (taxid:4577)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0A4X1ADHC_MYCBO1, ., 1, ., 1, ., 20.46100.950.9884yesno
P0A4X0ADHC_MYCTU1, ., 1, ., 1, ., 20.46100.950.9884yesno
P42754MTDH_PETCR1, ., 1, ., 1, ., 2, 5, 50.57220.91660.9792N/Ano
C0SPA5ADHA_BACSU1, ., 1, ., 1, ., -0.45420.95550.9856yesno
Q7XWU3CADH6_ORYSJ1, ., 1, ., 1, ., 1, 9, 50.70670.99160.9916yesno
P42734CADH9_ARATH1, ., 1, ., 1, ., 1, 9, 50.58040.96110.9611yesno
P93257MTDH_MESCR1, ., 1, ., 1, ., 2, 5, 50.54060.98050.9778N/Ano
P0CH37ADHC2_MYCS21, ., 1, ., 1, ., 20.46830.950.9799yesno
Q2KNL6GEDH1_OCIBA1, ., 1, ., 1, ., 1, 8, 30.54590.96110.9611N/Ano
Q43137MTDH1_STYHU1, ., 1, ., 1, ., 2, 5, 50.56480.95550.9717N/Ano
P0CH36ADHC1_MYCS21, ., 1, ., 1, ., 20.46830.950.9799yesno
Q9ZRF1MTDH_FRAAN1, ., 1, ., 1, ., 2, 5, 50.56600.96110.9637N/Ano
O82515MTDH_MEDSA1, ., 1, ., 1, ., 2, 5, 50.57010.94160.9442N/Ano
Q6V4H010HGO_CATRO1, ., 1, ., 1, ., 3, 2, 40.51860.96380.9638N/Ano
Q38707MTDH_APIGR1, ., 1, ., 1, ., 2, 5, 50.51380.99160.9780N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00014356001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (360 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 0.0
PLN02586360 PLN02586, PLN02586, probable cinnamyl alcohol dehy 1e-177
PLN02178375 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase 1e-149
PLN02514357 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase 1e-143
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 1e-129
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 1e-123
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 5e-84
cd08296333 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases 8e-78
cd08298329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 7e-64
cd08240350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa 7e-58
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 8e-55
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 4e-54
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 3e-50
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 3e-44
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 3e-43
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 5e-38
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 6e-38
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 1e-37
PRK09422338 PRK09422, PRK09422, ethanol-active dehydrogenase/a 1e-36
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 9e-35
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 9e-35
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 4e-33
cd08278365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro 1e-32
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 3e-32
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like 8e-32
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 2e-30
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 2e-30
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 5e-30
TIGR02822329 TIGR02822, adh_fam_2, zinc-binding alcohol dehydro 2e-29
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 6e-29
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 3e-27
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 1e-26
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 6e-26
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 1e-25
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 3e-25
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 8e-25
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 9e-24
cd08264325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 7e-23
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 2e-22
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formald 2e-22
cd05279365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 3e-22
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 4e-22
cd08281371 cd08281, liver_ADH_like1, Zinc-dependent alcohol d 9e-22
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 2e-20
cd08299373 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV 7e-20
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 1e-19
PLN02702364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 3e-19
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 7e-19
cd08300368 cd08300, alcohol_DH_class_III, class III alcohol d 7e-19
PRK10309347 PRK10309, PRK10309, galactitol-1-phosphate dehydro 8e-19
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 1e-18
TIGR03989369 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa 2e-17
cd08301369 cd08301, alcohol_DH_plants, Plant alcohol dehydrog 8e-17
TIGR02818368 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat 1e-16
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reducta 1e-16
cd08265384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 1e-16
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 5e-16
cd08286345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase 8e-16
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 1e-15
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reducta 1e-15
cd08248350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 2e-15
cd05281341 cd05281, TDH, Threonine dehydrogenase 4e-15
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 9e-15
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 1e-14
TIGR00692340 TIGR00692, tdh, L-threonine 3-dehydrogenase 1e-14
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 1e-14
TIGR03366280 TIGR03366, HpnZ_proposed, putative phosphonate cat 2e-14
TIGR03451358 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi 6e-14
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 2e-13
PRK09880343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 2e-13
cd08289326 cd08289, MDR_yhfp_like, Yhfp putative quinone oxid 6e-13
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 1e-12
TIGR02823323 TIGR02823, oxido_YhdH, putative quinone oxidoreduc 2e-12
cd08242319 cd08242, MDR_like, Medium chain dehydrogenases/red 2e-12
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 4e-12
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 5e-12
TIGR03201349 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1 5e-12
PRK05396341 PRK05396, tdh, L-threonine 3-dehydrogenase; Valida 5e-12
cd08283386 cd08283, FDH_like_1, Glutathione-dependent formald 6e-12
cd08256350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD 8e-12
cd08262341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 2e-11
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 3e-11
cd08247352 cd08247, AST1_like, AST1 is a cytoplasmic protein 8e-11
PRK10083339 PRK10083, PRK10083, putative oxidoreductase; Provi 1e-10
PLN02740381 PLN02740, PLN02740, Alcohol dehydrogenase-like 1e-10
cd05280325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 3e-10
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and 4e-10
cd08282375 cd08282, PFDH_like, Pseudomonas putida aldehyde-di 5e-10
cd08252336 cd08252, AL_MDR, Arginate lyase and other MDR fami 7e-10
cd08275337 cd08275, MDR3, Medium chain dehydrogenases/reducta 8e-10
PLN02827378 PLN02827, PLN02827, Alcohol dehydrogenase-like 2e-09
cd08255277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 5e-09
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 1e-08
cd08230355 cd08230, glucose_DH, Glucose dehydrogenase 3e-08
smart00829287 smart00829, PKS_ER, Enoylreductase 3e-08
cd08287345 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase 5e-08
TIGR02817336 TIGR02817, adh_fam_1, zinc-binding alcohol dehydro 6e-08
cd08251303 cd08251, polyketide_synthase, polyketide synthase 9e-08
TIGR02819393 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenas 2e-07
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reducta 4e-07
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 7e-07
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 2e-06
cd08246393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 6e-06
TIGR01751398 TIGR01751, crot-CoA-red, crotonyl-CoA reductase 8e-06
cd08292324 cd08292, ETR_like_2, 2-enoyl thioester reductase ( 1e-05
PRK10754327 PRK10754, PRK10754, quinone oxidoreductase, NADPH- 2e-05
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 2e-05
cd08243320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 6e-05
cd08270305 cd08270, MDR4, Medium chain dehydrogenases/reducta 1e-04
cd08290341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 2e-04
PRK06436303 PRK06436, PRK06436, glycerate dehydrogenase; Provi 7e-04
cd12169308 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat 0.001
cd08288324 cd08288, MDR_yhdh, Yhdh putative quinone oxidoredu 0.002
COG0111324 COG0111, SerA, Phosphoglycerate dehydrogenase and 0.003
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 0.003
cd12165314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 0.004
cd05300313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 0.004
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
 Score =  518 bits (1338), Expect = 0.0
 Identities = 188/341 (55%), Positives = 240/341 (70%), Gaps = 4/341 (1%)

Query: 13  VGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHE 72
            G+AA D SGK+ P+ F+RR  G +DV IKI YCG+CH+D+H ++N+WG T YP+VPGHE
Sbjct: 1   KGYAARDASGKLEPFTFERRPLGPDDVDIKITYCGVCHSDLHTLRNEWGPTKYPLVPGHE 60

Query: 73  ITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSI 132
           I GI+  VGS V  FKVGDR  VGC   +C  CE CK  +E YC K   TYNG + DG+I
Sbjct: 61  IVGIVVAVGSKVTKFKVGDRVGVGCQVDSCGTCEQCKSGEEQYCPKGVVTYNGKYPDGTI 120

Query: 133 TYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKRIGIVG 192
           T GGY++ +V D RFV  +PE +   AAAPLLCAGITV+ P+K N +      KR+G+VG
Sbjct: 121 TQGGYADHIVVDERFVFKIPEGLDSAAAAPLLCAGITVYSPLKRNGV---GPGKRVGVVG 177

Query: 193 LGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQAGKRTLDFI 252
           +GGLGH+AVKF KA G  VT  S SPSK+++A + LGADEFI + +   M+    +LD I
Sbjct: 178 IGGLGHLAVKFAKALGAEVTAFSRSPSKKEDALK-LGADEFIATKDPEAMKKAAGSLDLI 236

Query: 253 LDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGMRETQE 312
           +DTVSA H L P L LLK  GTL +VGAPE P  +P FPLIFG++SV GS+ GG +ETQE
Sbjct: 237 IDTVSASHDLDPYLSLLKPGGTLVLVGAPEEPLPVPPFPLIFGRKSVAGSLIGGRKETQE 296

Query: 313 MMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVID 353
           M++   ++ I   +EVI  D INEAL+RL + DVRYRFV+D
Sbjct: 297 MLDFAAEHGIKPWVEVIPMDGINEALERLEKGDVRYRFVLD 337


Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 337

>gnl|CDD|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|177834 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|131869 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family Back     alignment and domain information
>gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|132409 TIGR03366, HpnZ_proposed, putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|234026 TIGR02823, oxido_YhdH, putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase Back     alignment and domain information
>gnl|CDD|234025 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>gnl|CDD|235800 PRK06436, PRK06436, glycerate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases Back     alignment and domain information
>gnl|CDD|176248 cd08288, MDR_yhdh, Yhdh putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 360
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 100.0
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 100.0
PLN02586360 probable cinnamyl alcohol dehydrogenase 100.0
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 100.0
PLN02178375 cinnamyl-alcohol dehydrogenase 100.0
PLN02514357 cinnamyl-alcohol dehydrogenase 100.0
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 100.0
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 100.0
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 100.0
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 100.0
PRK09880343 L-idonate 5-dehydrogenase; Provisional 100.0
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 100.0
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 100.0
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 100.0
PLN02827378 Alcohol dehydrogenase-like 100.0
PLN02740381 Alcohol dehydrogenase-like 100.0
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 100.0
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 100.0
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 100.0
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 100.0
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 100.0
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 100.0
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 100.0
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 100.0
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 100.0
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 100.0
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 100.0
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 100.0
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 100.0
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 100.0
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 100.0
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 100.0
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 100.0
PRK10083339 putative oxidoreductase; Provisional 100.0
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 100.0
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 100.0
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 100.0
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 100.0
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 100.0
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 100.0
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 100.0
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 100.0
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 100.0
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 100.0
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 100.0
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 100.0
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 100.0
PRK13771334 putative alcohol dehydrogenase; Provisional 100.0
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 100.0
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 100.0
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 100.0
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 100.0
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 100.0
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 100.0
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 100.0
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 100.0
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 100.0
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 100.0
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 100.0
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 100.0
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 100.0
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 100.0
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 100.0
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 100.0
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 100.0
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 100.0
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 100.0
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 100.0
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 100.0
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 100.0
PLN02702364 L-idonate 5-dehydrogenase 100.0
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 100.0
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 100.0
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 100.0
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 100.0
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 100.0
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 100.0
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 100.0
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 100.0
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 100.0
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 100.0
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 100.0
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 100.0
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 100.0
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 100.0
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 100.0
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 100.0
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 100.0
PTZ00354334 alcohol dehydrogenase; Provisional 100.0
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 100.0
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 100.0
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 100.0
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 100.0
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 100.0
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 100.0
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 100.0
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 100.0
cd08252336 AL_MDR Arginate lyase and other MDR family members 100.0
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 100.0
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 100.0
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 100.0
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 100.0
COG2130340 Putative NADP-dependent oxidoreductases [General f 100.0
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 100.0
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 100.0
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 100.0
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 100.0
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 100.0
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 100.0
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 100.0
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 100.0
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 100.0
cd08251303 polyketide_synthase polyketide synthase. Polyketid 100.0
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.97
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.97
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.96
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.96
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 99.95
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 99.9
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.73
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 99.52
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 99.46
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 99.42
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.68
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.65
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.63
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.59
PLN02494477 adenosylhomocysteinase 98.44
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.42
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.42
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 98.21
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 98.19
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.17
PTZ00075476 Adenosylhomocysteinase; Provisional 98.13
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.11
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 98.1
PRK08324681 short chain dehydrogenase; Validated 98.1
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.1
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 98.08
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.98
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.91
COG0300265 DltE Short-chain dehydrogenases of various substra 97.89
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 97.74
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.69
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.65
PRK05993277 short chain dehydrogenase; Provisional 97.64
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.63
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.6
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 97.59
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.56
PRK05693274 short chain dehydrogenase; Provisional 97.55
PRK12742237 oxidoreductase; Provisional 97.54
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.52
PLN03209 576 translocon at the inner envelope of chloroplast su 97.51
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 97.49
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.49
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 97.48
PRK06182273 short chain dehydrogenase; Validated 97.45
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.45
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.45
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.39
PRK08265261 short chain dehydrogenase; Provisional 97.34
PRK08339263 short chain dehydrogenase; Provisional 97.33
PF11017314 DUF2855: Protein of unknown function (DUF2855); In 97.33
PRK07576264 short chain dehydrogenase; Provisional 97.29
PRK06500249 short chain dehydrogenase; Provisional 97.28
PRK07109 334 short chain dehydrogenase; Provisional 97.28
PRK06139 330 short chain dehydrogenase; Provisional 97.27
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.27
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.23
PRK06484520 short chain dehydrogenase; Validated 97.21
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.2
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 97.19
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.17
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.16
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.15
PRK05872296 short chain dehydrogenase; Provisional 97.15
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.15
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.13
PRK07825273 short chain dehydrogenase; Provisional 97.13
PRK07060245 short chain dehydrogenase; Provisional 97.13
PRK06196 315 oxidoreductase; Provisional 97.12
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.12
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.11
PRK06484 520 short chain dehydrogenase; Validated 97.11
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.1
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.07
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.07
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 97.06
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 97.06
PRK12939250 short chain dehydrogenase; Provisional 97.06
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 97.06
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.05
PRK06057255 short chain dehydrogenase; Provisional 97.04
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.03
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.03
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.02
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.02
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.01
PRK08267260 short chain dehydrogenase; Provisional 97.01
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.01
PRK07326237 short chain dehydrogenase; Provisional 96.98
PRK06719157 precorrin-2 dehydrogenase; Validated 96.96
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 96.96
PRK07832272 short chain dehydrogenase; Provisional 96.94
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.94
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 96.94
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.93
PRK08618325 ornithine cyclodeaminase; Validated 96.93
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.92
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.92
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 96.89
PRK09186256 flagellin modification protein A; Provisional 96.89
PRK07806248 short chain dehydrogenase; Provisional 96.89
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.88
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.87
PRK12550272 shikimate 5-dehydrogenase; Reviewed 96.87
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 96.87
CHL00194 317 ycf39 Ycf39; Provisional 96.87
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 96.86
PRK08263275 short chain dehydrogenase; Provisional 96.85
PRK10538248 malonic semialdehyde reductase; Provisional 96.85
PRK12829264 short chain dehydrogenase; Provisional 96.85
PRK04457262 spermidine synthase; Provisional 96.83
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 96.82
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.81
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 96.81
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.8
PRK13940414 glutamyl-tRNA reductase; Provisional 96.8
PRK12367245 short chain dehydrogenase; Provisional 96.8
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 96.79
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 96.77
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.76
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.76
PRK09072263 short chain dehydrogenase; Provisional 96.76
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 96.75
PRK04148134 hypothetical protein; Provisional 96.74
PRK07831262 short chain dehydrogenase; Provisional 96.73
PRK07814263 short chain dehydrogenase; Provisional 96.73
PRK05866293 short chain dehydrogenase; Provisional 96.72
PRK07062265 short chain dehydrogenase; Provisional 96.72
PRK10258251 biotin biosynthesis protein BioC; Provisional 96.72
PRK07063260 short chain dehydrogenase; Provisional 96.71
PLN00203519 glutamyl-tRNA reductase 96.69
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 96.69
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.68
PRK06180277 short chain dehydrogenase; Provisional 96.67
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.67
PRK07453 322 protochlorophyllide oxidoreductase; Validated 96.66
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.66
PRK05854 313 short chain dehydrogenase; Provisional 96.66
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 96.65
PRK06101240 short chain dehydrogenase; Provisional 96.65
PRK07574385 formate dehydrogenase; Provisional 96.65
PRK05867253 short chain dehydrogenase; Provisional 96.64
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 96.64
PRK07523255 gluconate 5-dehydrogenase; Provisional 96.63
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 96.62
PRK06398258 aldose dehydrogenase; Validated 96.62
PRK06949258 short chain dehydrogenase; Provisional 96.61
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.61
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 96.61
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 96.6
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.6
PRK08017256 oxidoreductase; Provisional 96.59
PRK09291257 short chain dehydrogenase; Provisional 96.58
PRK06194287 hypothetical protein; Provisional 96.58
COG2910211 Putative NADH-flavin reductase [General function p 96.57
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.56
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 96.56
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.56
PRK05717255 oxidoreductase; Validated 96.55
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.54
PRK07478254 short chain dehydrogenase; Provisional 96.54
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.54
PRK06841255 short chain dehydrogenase; Provisional 96.53
PRK06940275 short chain dehydrogenase; Provisional 96.52
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 96.51
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.51
PRK07677252 short chain dehydrogenase; Provisional 96.51
PRK08177225 short chain dehydrogenase; Provisional 96.5
PRK06128300 oxidoreductase; Provisional 96.49
PRK07424406 bifunctional sterol desaturase/short chain dehydro 96.49
PRK09242257 tropinone reductase; Provisional 96.48
PRK13243333 glyoxylate reductase; Reviewed 96.48
PRK07024257 short chain dehydrogenase; Provisional 96.48
PRK05876275 short chain dehydrogenase; Provisional 96.47
PRK07890258 short chain dehydrogenase; Provisional 96.45
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.44
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 96.43
PRK05884223 short chain dehydrogenase; Provisional 96.43
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 96.43
PLN03139386 formate dehydrogenase; Provisional 96.43
PRK12828239 short chain dehydrogenase; Provisional 96.41
PRK08862227 short chain dehydrogenase; Provisional 96.41
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 96.4
PLN02253280 xanthoxin dehydrogenase 96.4
PRK06141314 ornithine cyclodeaminase; Validated 96.39
PRK08643256 acetoin reductase; Validated 96.37
PRK07340304 ornithine cyclodeaminase; Validated 96.37
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.36
PRK06125259 short chain dehydrogenase; Provisional 96.36
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.36
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.35
PRK07067257 sorbitol dehydrogenase; Provisional 96.35
PRK06914280 short chain dehydrogenase; Provisional 96.34
PRK12747252 short chain dehydrogenase; Provisional 96.31
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 96.31
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.3
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 96.3
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 96.3
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 96.3
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 96.3
PRK07985294 oxidoreductase; Provisional 96.29
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.29
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.28
PRK07035252 short chain dehydrogenase; Provisional 96.28
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.26
PRK08317241 hypothetical protein; Provisional 96.25
PLN02928347 oxidoreductase family protein 96.25
PRK08589272 short chain dehydrogenase; Validated 96.24
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 96.24
PRK08213259 gluconate 5-dehydrogenase; Provisional 96.24
PRK06483236 dihydromonapterin reductase; Provisional 96.24
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 96.24
PRK07774250 short chain dehydrogenase; Provisional 96.23
PRK06482276 short chain dehydrogenase; Provisional 96.23
PLN03075296 nicotianamine synthase; Provisional 96.2
PRK06197306 short chain dehydrogenase; Provisional 96.2
PRK06172253 short chain dehydrogenase; Provisional 96.2
PRK14967223 putative methyltransferase; Provisional 96.19
PRK08340259 glucose-1-dehydrogenase; Provisional 96.18
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 96.18
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.17
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 96.17
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.16
PRK06701290 short chain dehydrogenase; Provisional 96.16
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 96.15
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 96.14
PRK08291330 ectoine utilization protein EutC; Validated 96.14
PRK06138252 short chain dehydrogenase; Provisional 96.13
PRK00811283 spermidine synthase; Provisional 96.12
PRK08085254 gluconate 5-dehydrogenase; Provisional 96.12
PLN02366308 spermidine synthase 96.12
PRK06198260 short chain dehydrogenase; Provisional 96.11
PRK11207197 tellurite resistance protein TehB; Provisional 96.11
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.11
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.11
PRK05875276 short chain dehydrogenase; Provisional 96.1
PRK07074257 short chain dehydrogenase; Provisional 96.1
PRK12743256 oxidoreductase; Provisional 96.1
PRK03562621 glutathione-regulated potassium-efflux system prot 96.09
KOG0725270 consensus Reductases with broad range of substrate 96.09
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 96.09
PRK10669558 putative cation:proton antiport protein; Provision 96.08
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 96.07
PRK06181263 short chain dehydrogenase; Provisional 96.07
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.07
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.06
PRK08219227 short chain dehydrogenase; Provisional 96.06
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.05
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 96.05
PRK08277278 D-mannonate oxidoreductase; Provisional 96.05
PRK06720169 hypothetical protein; Provisional 96.04
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.03
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.03
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 96.02
PRK07454241 short chain dehydrogenase; Provisional 96.01
PRK08251248 short chain dehydrogenase; Provisional 96.01
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.01
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.0
PRK12937245 short chain dehydrogenase; Provisional 95.99
PRK06953222 short chain dehydrogenase; Provisional 95.98
PRK07904253 short chain dehydrogenase; Provisional 95.97
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.97
PRK07417 279 arogenate dehydrogenase; Reviewed 95.97
PRK13255218 thiopurine S-methyltransferase; Reviewed 95.96
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.96
PRK07069251 short chain dehydrogenase; Validated 95.95
COG0673 342 MviM Predicted dehydrogenases and related proteins 95.95
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.94
PLN02233261 ubiquinone biosynthesis methyltransferase 95.94
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.93
PRK03659601 glutathione-regulated potassium-efflux system prot 95.93
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 95.92
KOG1208314 consensus Dehydrogenases with different specificit 95.92
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 95.92
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 95.92
PRK07402196 precorrin-6B methylase; Provisional 95.92
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.9
PRK12938246 acetyacetyl-CoA reductase; Provisional 95.87
PRK06124256 gluconate 5-dehydrogenase; Provisional 95.87
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 95.86
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 95.85
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.84
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 95.83
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 95.83
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 95.83
PRK07097265 gluconate 5-dehydrogenase; Provisional 95.82
PRK12746254 short chain dehydrogenase; Provisional 95.82
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.81
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 95.81
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 95.81
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.81
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 95.78
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.78
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 95.76
PRK06179270 short chain dehydrogenase; Provisional 95.76
PRK05855582 short chain dehydrogenase; Validated 95.74
PRK08226263 short chain dehydrogenase; Provisional 95.74
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.74
PRK13403 335 ketol-acid reductoisomerase; Provisional 95.73
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 95.73
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 95.72
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.72
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.72
PRK07791286 short chain dehydrogenase; Provisional 95.7
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 95.68
PRK06114254 short chain dehydrogenase; Provisional 95.67
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 95.66
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 95.65
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 95.65
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 95.65
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.65
PRK07775274 short chain dehydrogenase; Provisional 95.64
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.64
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.64
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 95.64
PRK14982340 acyl-ACP reductase; Provisional 95.62
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 95.62
PRK07577234 short chain dehydrogenase; Provisional 95.62
PLN02244340 tocopherol O-methyltransferase 95.61
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.61
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 95.6
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 95.59
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.59
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 95.59
COG3268 382 Uncharacterized conserved protein [Function unknow 95.58
PRK08628258 short chain dehydrogenase; Provisional 95.58
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.57
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.57
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 95.56
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 95.56
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 95.56
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.55
PRK08264238 short chain dehydrogenase; Validated 95.54
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 95.5
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.5
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 95.49
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 95.49
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 95.47
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 95.47
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.46
COG0421282 SpeE Spermidine synthase [Amino acid transport and 95.46
PRK06436303 glycerate dehydrogenase; Provisional 95.46
PRK08655 437 prephenate dehydrogenase; Provisional 95.46
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.46
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.46
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 95.45
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 95.45
PRK05650270 short chain dehydrogenase; Provisional 95.45
PRK06823315 ornithine cyclodeaminase; Validated 95.44
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.44
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.43
PRK09135249 pteridine reductase; Provisional 95.42
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.41
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 95.41
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.41
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.4
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 95.4
PRK07856252 short chain dehydrogenase; Provisional 95.39
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 95.39
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 95.37
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 95.36
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 95.35
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 95.34
PRK12480330 D-lactate dehydrogenase; Provisional 95.33
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 95.32
PRK07102243 short chain dehydrogenase; Provisional 95.31
PLN02896 353 cinnamyl-alcohol dehydrogenase 95.31
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 95.31
PRK13302271 putative L-aspartate dehydrogenase; Provisional 95.3
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 95.29
PRK01581374 speE spermidine synthase; Validated 95.28
PRK08303 305 short chain dehydrogenase; Provisional 95.28
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.27
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 95.25
PLN02490340 MPBQ/MSBQ methyltransferase 95.24
PRK10637 457 cysG siroheme synthase; Provisional 95.23
PRK09134258 short chain dehydrogenase; Provisional 95.23
TIGR00438188 rrmJ cell division protein FtsJ. 95.23
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 95.22
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=3.7e-69  Score=477.23  Aligned_cols=332  Identities=40%  Similarity=0.687  Sum_probs=306.2

Q ss_pred             cceeEEeccCCCCCceEEEEeCCCCCCCeEEEEEeeeecccchhhhhccCCCCCCCCCccccccceEEEEecCCCCCCCC
Q 018158           10 QSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVKNFKV   89 (360)
Q Consensus        10 ~~~~~~~~~~~~~~l~~~~~~~p~~~~~evlVkv~~~~i~~~D~~~~~g~~~~~~~p~~~G~e~~G~V~~vG~~v~~~~~   89 (360)
                      |||.++..++  ++++++|++.|+|+++||+|||+++|+|++|+|.++|.++...+|.++|||.+|+|+++|++|++||+
T Consensus         4 mkA~~~~~~~--~pl~i~e~~~p~p~~~eVlI~v~~~GVChsDlH~~~G~~~~~~~P~ipGHEivG~V~~vG~~V~~~k~   81 (339)
T COG1064           4 MKAAVLKKFG--QPLEIEEVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWPVPKLPLIPGHEIVGTVVEVGEGVTGLKV   81 (339)
T ss_pred             eEEEEEccCC--CCceEEeccCCCCCCCeEEEEEEEEeecchhhhhhcCCCCCCCCCccCCcceEEEEEEecCCCccCCC
Confidence            6666665544  44999999999999999999999999999999999999998889999999999999999999999999


Q ss_pred             CCEEEeccCccCCCCChhhhCCCCCCcccccccccccccCCCccccceeeEEEeecceeEECCCCCCccccccccchhhh
Q 018158           90 GDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGIT  169 (360)
Q Consensus        90 Gd~V~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~g~~~~~~~~~g~~~~~~~v~~~~~~~iP~~~~~~~aa~l~~~~~t  169 (360)
                      ||||.+.++..+|++|.+|++|+.++|++...       .++..+|+|+||+++|+++++++|+++++++||++.|++.|
T Consensus        82 GDrVgV~~~~~~Cg~C~~C~~G~E~~C~~~~~-------~gy~~~GGyaeyv~v~~~~~~~iP~~~d~~~aApllCaGiT  154 (339)
T COG1064          82 GDRVGVGWLVISCGECEYCRSGNENLCPNQKI-------TGYTTDGGYAEYVVVPARYVVKIPEGLDLAEAAPLLCAGIT  154 (339)
T ss_pred             CCEEEecCccCCCCCCccccCcccccCCCccc-------cceeecCcceeEEEEchHHeEECCCCCChhhhhhhhcCeee
Confidence            99999978889999999999999999998433       33468999999999999999999999999999999999999


Q ss_pred             hhchhhccCCCCCCCCcEEEEEcCChHHHHHHHHHHHcCCeEEEEeCChhHHHHHHHHcCCCeEeeCccHHHHHhcCCCc
Q 018158          170 VFCPMKDNNLIDSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQAGKRTL  249 (360)
Q Consensus       170 a~~~l~~~~~~~~~~~~~vlI~Gag~vG~~aiqla~~~G~~V~~~~~~~~~~~~~~~~~g~~~~v~~~~~~~~~~~~~~~  249 (360)
                      .|++|++..   ++||++|+|+|+|++|++++|+||.+|++|+++++++++++.+++ +|++++++..+.+......+.+
T Consensus       155 ~y~alk~~~---~~pG~~V~I~G~GGlGh~avQ~Aka~ga~Via~~~~~~K~e~a~~-lGAd~~i~~~~~~~~~~~~~~~  230 (339)
T COG1064         155 TYRALKKAN---VKPGKWVAVVGAGGLGHMAVQYAKAMGAEVIAITRSEEKLELAKK-LGADHVINSSDSDALEAVKEIA  230 (339)
T ss_pred             EeeehhhcC---CCCCCEEEEECCcHHHHHHHHHHHHcCCeEEEEeCChHHHHHHHH-hCCcEEEEcCCchhhHHhHhhC
Confidence            999999866   669999999999999999999999999999999999999999999 9999999987555555554559


Q ss_pred             CEEEEcCCCcccHHHHHHHhccCCEEEEeCCCC-CC-cccChhhHhccCcEEEEeecCCHHHHHHHHHHHhcCCCccce-
Q 018158          250 DFILDTVSAKHSLGPILELLKVNGTLSVVGAPE-AP-FELPSFPLIFGKRSVKGSMTGGMRETQEMMNVCGKYNITCNI-  326 (360)
Q Consensus       250 d~vid~~g~~~~~~~~~~~l~~~G~~v~~g~~~-~~-~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~l~~~~l~~~i-  326 (360)
                      |+++|+++ ...++.+++.|+++|+++.+|... .. ..++.+.+..+++++.|+..+++.++++++++..++++++.+ 
T Consensus       231 d~ii~tv~-~~~~~~~l~~l~~~G~~v~vG~~~~~~~~~~~~~~li~~~~~i~GS~~g~~~d~~e~l~f~~~g~Ikp~i~  309 (339)
T COG1064         231 DAIIDTVG-PATLEPSLKALRRGGTLVLVGLPGGGPIPLLPAFLLILKEISIVGSLVGTRADLEEALDFAAEGKIKPEIL  309 (339)
T ss_pred             cEEEECCC-hhhHHHHHHHHhcCCEEEEECCCCCcccCCCCHHHhhhcCeEEEEEecCCHHHHHHHHHHHHhCCceeeEE
Confidence            99999999 778999999999999999999984 44 457888899999999999999999999999999999999999 


Q ss_pred             EEECCccHHHHHHHHHcCCCceeEEEecC
Q 018158          327 EVIKPDQINEALDRLARNDVRYRFVIDIA  355 (360)
Q Consensus       327 ~~~~~~~~~~a~~~~~~~~~~gkvvi~~~  355 (360)
                      +.++++++++||++|++++..||.|+++.
T Consensus       310 e~~~l~~in~A~~~m~~g~v~gR~Vi~~~  338 (339)
T COG1064         310 ETIPLDEINEAYERMEKGKVRGRAVIDMS  338 (339)
T ss_pred             eeECHHHHHHHHHHHHcCCeeeEEEecCC
Confidence            79999999999999999999999999875



>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
1yqd_A366 Sinapyl Alcohol Dehydrogenase Complexed With Nadp+ 1e-110
1uuf_A369 Crystal Structure Of A Zinc-Type Alcohol Dehydrogen 2e-77
2cf5_A357 Crystal Structures Of The Arabidopsis Cinnamyl Alco 3e-75
3two_A348 The Crystal Structure Of Cad From Helicobacter Pylo 3e-59
1ps0_A360 Crystal Structure Of The Nadp(H)-Dependent Cinnamyl 8e-41
1llu_A342 The Ternary Complex Of Pseudomonas Aeruginosa Alcoh 1e-37
1rjw_A339 Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd 3e-36
3s1l_A340 Crystal Structure Of Apo-Form Furx Length = 340 4e-36
3pii_A339 Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog 4e-36
3meq_A365 Crystal Structure Of Alcohol Dehydrogenase From Bru 3e-34
2hcy_A347 Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevi 8e-31
4eex_A348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 4e-23
4eez_A348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 7e-23
1h2b_A359 Crystal Structure Of The Alcohol Dehydrogenase From 5e-22
3i4c_A347 Crystal Structure Of Sulfolobus Solfataricus Adh(Ss 9e-17
2eer_A347 Structural Study Of Project Id St2577 From Sulfolob 9e-17
1r37_A347 Alcohol Dehydrogenase From Sulfolobus Solfataricus 3e-16
1nto_A347 N249y Mutant Of Alcohol Dehydrogenase From The Arch 4e-16
1jvb_A347 Alcohol Dehydrogenase From The Archaeon Sulfolobus 5e-14
2xaa_A345 Alcohol Dehydrogenase Adh-'a' From Rhodococcus Rube 6e-13
3uog_A363 Crystal Structure Of Putative Alcohol Dehydrogenase 1e-12
1e3j_A352 Ketose Reductase (Sorbitol Dehydrogenase) From Silv 2e-12
1hdy_A374 Three-Dimensional Structures Of Three Human Alcohol 3e-12
1cdo_A374 Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Co 3e-12
1d1t_A373 Mutant Of Human Sigma Alcohol Dehydrogenase With Le 3e-12
1agn_A373 X-Ray Structure Of Human Sigma Alcohol Dehydrogenas 3e-12
3uko_A378 Crystal Structure Of S-Nitrosoglutathione Reductase 6e-12
2h6e_A344 Crystal Structure Of The D-Arabinose Dehydrogenase 9e-12
4dl9_A396 Crystal Structure Of S-nitrosoglutathione Reductase 2e-11
1hdx_A374 Three-Dimensional Structures Of Three Human Alcohol 2e-11
1htb_A374 Crystallization Of Human Beta3 Alcohol Dehydrogenas 2e-11
1f8f_A371 Crystal Structure Of Benzyl Alcohol Dehydrogenase F 3e-11
4a2c_A346 Crystal Structure Of Galactitol-1-Phosphate Dehydro 3e-11
1hdz_A374 Three-Dimensional Structures Of Three Human Alcohol 3e-11
4ej6_A370 Crystal Structure Of A Putative Zinc-Binding Dehydr 3e-11
1ht0_A374 Human Gamma-2 Alcohol Dehydrogense Length = 374 2e-10
1vj0_A380 Crystal Structure Of Alcohol Dehydrogenase (Tm0436) 3e-10
3cos_A381 Crystal Structure Of Human Class Ii Alcohol Dehydro 4e-10
1mc5_A374 Ternary Complex Of Human Glutathione-Dependent Form 5e-10
1teh_A373 Structure Of Human Liver Chichi Alcohol Dehydrogena 5e-10
3qj5_A374 S-Nitrosoglutathione Reductase (Gsnor) In Complex W 5e-10
1hso_A374 Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 5e-10
2eih_A343 Crystal Structure Of Nad-Dependent Alcohol Dehydrog 2e-09
1e3l_A376 P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase 2e-09
4ilk_A359 Crystal Structure Of Short Chain Alcohol Dehydrogen 3e-09
2fzw_A373 Structure Of The Binary Complex Of The E67l Mutant 4e-09
1p0c_A373 Crystal Structure Of The Nadp(H)-Dependent Vertebra 8e-09
1pl7_A356 Human Sorbitol Dehydrogenase (Apo) Length = 356 1e-08
1axg_A374 Crystal Structure Of The Val203->ala Mutant Of Live 1e-08
1ju9_A374 Horse Liver Alcohol Dehydrogenase Val292ser Mutant 1e-08
1n8k_A374 Horse Liver Alcohol Dehydrogenase Val292thr Mutant 1e-08
6adh_A374 Structure Of Triclinic Ternary Complex Of Horse Liv 1e-08
1qlh_A374 Horse Liver Alcohol Dehydrogenase Complexed To Nad 1e-08
3oq6_A374 Horse Liver Alcohol Dehydrogenase A317c Mutant Comp 1e-08
1mgo_A374 Horse Liver Alcohol Dehydrogenase Phe93ala Mutant L 2e-08
1pl6_A356 Human SdhNADHINHIBITOR COMPLEX Length = 356 2e-08
1e3e_A376 Mouse Class Ii Alcohol Dehydrogenase Complex With N 2e-08
1a71_A374 Ternary Complex Of An Active Site Double Mutant Of 2e-08
1axe_A374 Crystal Structure Of The Active-Site Mutant Phe93-> 2e-08
3ip1_A404 Structure Of Putative Alcohol Dehydrogenase (Tm_042 3e-08
3qe3_A355 Sheep Liver Sorbitol Dehydrogenase Length = 355 7e-08
1ee2_A373 The Structure Of Steroid-Active Alcohol Dehydrogena 7e-08
1ee2_B373 The Structure Of Steroid-Active Alcohol Dehydrogena 7e-08
1qv6_A374 Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG 8e-08
2dfv_A347 Hyperthermophilic Threonine Dehydrogenase From Pyro 1e-07
2d8a_A348 Crystal Structure Of Ph0655 From Pyrococcus Horikos 1e-07
2dq4_A343 Crystal Structure Of Threonine 3-Dehydrogenase Leng 2e-07
3gfb_A350 L-Threonine Dehydrogenase (Tktdh) From The Hyperthe 6e-07
1kol_A398 Crystal Structure Of Formaldehyde Dehydrogenase Len 2e-06
3m6i_A363 L-Arabinitol 4-Dehydrogenase Length = 363 1e-05
2dph_A398 Crystal Structure Of Formaldehyde Dismutase Length 8e-05
3fpl_A351 Chimera Of Alcohol Dehydrogenase By Exchange Of The 2e-04
1ykf_A352 Nadp-Dependent Alcohol Dehydrogenase From Thermoana 2e-04
2nvb_A352 Contribution Of Pro275 To The Thermostability Of Th 2e-04
1jqb_A351 Alcohol Dehydrogenase From Clostridium Beijerinckii 2e-04
3ftn_A352 Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDRO 2e-04
3fsr_A352 Chimera Of Alcohol Dehydrogenase By Exchange Of The 2e-04
1ped_A351 Bacterial Secondary Alcohol Dehydrogenase (Apo-Form 3e-04
3jyl_A325 Crystal Structures Of Pseudomonas Syringae Pv. Toma 3e-04
3fpc_A352 Chimera Of Alcohol Dehydrogenase By Exchange Of The 4e-04
2b83_A351 A Single Amino Acid Substitution In The Clostridium 9e-04
>pdb|1YQD|A Chain A, Sinapyl Alcohol Dehydrogenase Complexed With Nadp+ Length = 366 Back     alignment and structure

Iteration: 1

Score = 395 bits (1014), Expect = e-110, Method: Compositional matrix adjust. Identities = 190/348 (54%), Positives = 240/348 (68%), Gaps = 2/348 (0%) Query: 8 HTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPV 67 H GWAA D SG ++P+ F RR G DV K+LYCG+CH+D+H +KNDWG +MYP+ Sbjct: 13 HPVKAFGWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGVCHSDLHSIKNDWGFSMYPL 72 Query: 68 VPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIF 127 VPGHEI G +T+VGS VK VGD+ VGCL AC CE C + ENYC K+ TY I+ Sbjct: 73 VPGHEIVGEVTEVGSKVKKVNVGDKVGVGCLVGACHSCESCANDLENYCPKMILTYASIY 132 Query: 128 WDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNLIDSPAKKR 187 DG+ITYGGYS +VA+ R+++ P+N+ +D APLLCAGITV+ P+K L D P K Sbjct: 133 HDGTITYGGYSNHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGL-DEPG-KH 190 Query: 188 XXXXXXXXXXXXAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQAGKR 247 AVKF KAFG VTVISTSPSK++EA + GAD F++S + QMQA Sbjct: 191 IGIVGLGGLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNFGADSFLVSRDQEQMQAAAG 250 Query: 248 TLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGM 307 TLD I+DTVSA H L P+ LLK +G L +VGAPE P ELP+F LI G++ V GS GGM Sbjct: 251 TLDGIIDTVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKIVAGSGIGGM 310 Query: 308 RETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIA 355 +ETQEM++ K+NIT +IEVI D +N A++RLA+NDVRYRFVID+ Sbjct: 311 KETQEMIDFAAKHNITADIEVISTDYLNTAMERLAKNDVRYRFVIDVG 358
>pdb|1UUF|A Chain A, Crystal Structure Of A Zinc-Type Alcohol Dehydrogenase-Like Protein Yahk Length = 369 Back     alignment and structure
>pdb|2CF5|A Chain A, Crystal Structures Of The Arabidopsis Cinnamyl Alcohol Dehydrogenases, Atcad5 Length = 357 Back     alignment and structure
>pdb|3TWO|A Chain A, The Crystal Structure Of Cad From Helicobacter Pylori Complexed With Nadp(H) Length = 348 Back     alignment and structure
>pdb|1PS0|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Cinnamyl Alcohol Dehydrogenase From Saccharomyces Cerevisiae Length = 360 Back     alignment and structure
>pdb|1LLU|A Chain A, The Ternary Complex Of Pseudomonas Aeruginosa Alcohol Dehydrogenase With Its Coenzyme And Weak Substrate Length = 342 Back     alignment and structure
>pdb|1RJW|A Chain A, Crystal Structure Of Nad(+)-Dependent Alcohol Dehydrogenase From Bacillus Stearothermophilus Strain Lld-R Length = 339 Back     alignment and structure
>pdb|3S1L|A Chain A, Crystal Structure Of Apo-Form Furx Length = 340 Back     alignment and structure
>pdb|3PII|A Chain A, Crystal Structure Of Mutant Of Ht- Alcohol Dehydrogenase With Substrate Analogue Butyramide Length = 339 Back     alignment and structure
>pdb|3MEQ|A Chain A, Crystal Structure Of Alcohol Dehydrogenase From Brucella Mel Length = 365 Back     alignment and structure
>pdb|2HCY|A Chain A, Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevisiae Fermentative Enzyme Length = 347 Back     alignment and structure
>pdb|4EEX|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Length = 348 Back     alignment and structure
>pdb|4EEZ|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Variant Re1 Length = 348 Back     alignment and structure
>pdb|1H2B|A Chain A, Crystal Structure Of The Alcohol Dehydrogenase From The Hyperthermophilic Archaeon Aeropyrum Pernix At 1.65a Resolution Length = 359 Back     alignment and structure
>pdb|3I4C|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Adh(Ssadh) Double Mutant (W95l,N249y) Length = 347 Back     alignment and structure
>pdb|2EER|A Chain A, Structural Study Of Project Id St2577 From Sulfolobus Tokodaii Strain7 Length = 347 Back     alignment and structure
>pdb|1R37|A Chain A, Alcohol Dehydrogenase From Sulfolobus Solfataricus Complexed With Nad(H) And 2-Ethoxyethanol Length = 347 Back     alignment and structure
>pdb|1NTO|A Chain A, N249y Mutant Of Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus-Monoclinic Crystal Form Length = 347 Back     alignment and structure
>pdb|1JVB|A Chain A, Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus Length = 347 Back     alignment and structure
>pdb|2XAA|A Chain A, Alcohol Dehydrogenase Adh-'a' From Rhodococcus Ruber Dsm 44541 At Ph 8.5 In Complex With Nad And Butane-1,4-Diol Length = 345 Back     alignment and structure
>pdb|3UOG|A Chain A, Crystal Structure Of Putative Alcohol Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 363 Back     alignment and structure
>pdb|1E3J|A Chain A, Ketose Reductase (Sorbitol Dehydrogenase) From Silverleaf Whitefly Length = 352 Back     alignment and structure
>pdb|1HDY|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1CDO|A Chain A, Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Complexed With Nicotinamide Adenine Dinucleotide (Nad), And Zinc Length = 374 Back     alignment and structure
>pdb|1D1T|A Chain A, Mutant Of Human Sigma Alcohol Dehydrogenase With Leucine At Position 141 Length = 373 Back     alignment and structure
>pdb|1AGN|A Chain A, X-Ray Structure Of Human Sigma Alcohol Dehydrogenase Length = 373 Back     alignment and structure
>pdb|3UKO|A Chain A, Crystal Structure Of S-Nitrosoglutathione Reductase From Arabidopsis Thaliana, Complex With Nadh Length = 378 Back     alignment and structure
>pdb|2H6E|A Chain A, Crystal Structure Of The D-Arabinose Dehydrogenase From Sulfolobus Solfataricus Length = 344 Back     alignment and structure
>pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ Length = 396 Back     alignment and structure
>pdb|1HDX|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HTB|A Chain A, Crystallization Of Human Beta3 Alcohol Dehydrogenase (10 MgML) IN 100 MM SODIUM PHOSPHATE (PH 7.5), 7.5 MM NAD+ And 1 Mm 4-Iodopyrazole At 25 C Length = 374 Back     alignment and structure
>pdb|1F8F|A Chain A, Crystal Structure Of Benzyl Alcohol Dehydrogenase From Acinetobacter Calcoaceticus Length = 371 Back     alignment and structure
>pdb|4A2C|A Chain A, Crystal Structure Of Galactitol-1-Phosphate Dehydrogenase From Escherichia Coli Length = 346 Back     alignment and structure
>pdb|1HDZ|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|4EJ6|A Chain A, Crystal Structure Of A Putative Zinc-Binding Dehydrogenase (Target Psi-012003) From Sinorhizobium Meliloti 1021 Length = 370 Back     alignment and structure
>pdb|1HT0|A Chain A, Human Gamma-2 Alcohol Dehydrogense Length = 374 Back     alignment and structure
>pdb|1VJ0|A Chain A, Crystal Structure Of Alcohol Dehydrogenase (Tm0436) From Thermotoga Maritima At 2.00 A Resolution Length = 380 Back     alignment and structure
>pdb|3COS|A Chain A, Crystal Structure Of Human Class Ii Alcohol Dehydrogenase (Adh4) In Complex With Nad And Zn Length = 381 Back     alignment and structure
>pdb|1MC5|A Chain A, Ternary Complex Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With S-(Hydroxymethyl)glutathione And Nadh Length = 374 Back     alignment and structure
>pdb|1TEH|A Chain A, Structure Of Human Liver Chichi Alcohol Dehydrogenase (A Glutathione- Dependent Formaldehyde Dehydrogenase) Length = 373 Back     alignment and structure
>pdb|3QJ5|A Chain A, S-Nitrosoglutathione Reductase (Gsnor) In Complex With N6022 Length = 374 Back     alignment and structure
>pdb|1HSO|A Chain A, Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 374 Back     alignment and structure
>pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 Back     alignment and structure
>pdb|1E3L|A Chain A, P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|4ILK|A Chain A, Crystal Structure Of Short Chain Alcohol Dehydrogenase (rspb) From E. Coli Cft073 (efi Target Efi-506413) Complexed With Cofactor Nadh Length = 359 Back     alignment and structure
>pdb|2FZW|A Chain A, Structure Of The Binary Complex Of The E67l Mutant Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With Nad(H) Length = 373 Back     alignment and structure
>pdb|1P0C|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Vertebrate Alcohol Dehydrogenase (Adh8) Length = 373 Back     alignment and structure
>pdb|1PL7|A Chain A, Human Sorbitol Dehydrogenase (Apo) Length = 356 Back     alignment and structure
>pdb|1AXG|A Chain A, Crystal Structure Of The Val203->ala Mutant Of Liver Alcohol Dehydrogenase Complexed With Cofactor Nad And Inhibitor Trifluoroethanol Solved To 2.5 Angstrom Resolution Length = 374 Back     alignment and structure
>pdb|1JU9|A Chain A, Horse Liver Alcohol Dehydrogenase Val292ser Mutant Length = 374 Back     alignment and structure
>pdb|1N8K|A Chain A, Horse Liver Alcohol Dehydrogenase Val292thr Mutant Complexed To Nad+ And Pyrazole Length = 374 Back     alignment and structure
>pdb|6ADH|A Chain A, Structure Of Triclinic Ternary Complex Of Horse Liver Alcohol Dehydrogenase At 2.9 Angstroms Resolution Length = 374 Back     alignment and structure
>pdb|1QLH|A Chain A, Horse Liver Alcohol Dehydrogenase Complexed To Nad Double Mutant Of Gly 293 Ala And Pro 295 Thr Length = 374 Back     alignment and structure
>pdb|3OQ6|A Chain A, Horse Liver Alcohol Dehydrogenase A317c Mutant Complexed With Nad+ And 2,3,4,5,6-Pentafluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|1MGO|A Chain A, Horse Liver Alcohol Dehydrogenase Phe93ala Mutant Length = 374 Back     alignment and structure
>pdb|1PL6|A Chain A, Human SdhNADHINHIBITOR COMPLEX Length = 356 Back     alignment and structure
>pdb|1E3E|A Chain A, Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|1A71|A Chain A, Ternary Complex Of An Active Site Double Mutant Of Horse Liver Alcohol Dehydrogenase, Phe93>trp, Val203>ala With Nad And Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|1AXE|A Chain A, Crystal Structure Of The Active-Site Mutant Phe93->trp Of Horse Liver Alcohol Dehydrogenase In Complex With Nad And Inhibitor Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|3IP1|A Chain A, Structure Of Putative Alcohol Dehydrogenase (Tm_042) From Thermotoga Maritima Length = 404 Back     alignment and structure
>pdb|3QE3|A Chain A, Sheep Liver Sorbitol Dehydrogenase Length = 355 Back     alignment and structure
>pdb|1EE2|A Chain A, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1EE2|B Chain B, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1QV6|A Chain A, Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG MUTANT Complexed With Nad+ And 2,4-Difluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|2DFV|A Chain A, Hyperthermophilic Threonine Dehydrogenase From Pyrococcus Horikoshii Length = 347 Back     alignment and structure
>pdb|2D8A|A Chain A, Crystal Structure Of Ph0655 From Pyrococcus Horikoshii Ot3 Length = 348 Back     alignment and structure
>pdb|2DQ4|A Chain A, Crystal Structure Of Threonine 3-Dehydrogenase Length = 343 Back     alignment and structure
>pdb|3GFB|A Chain A, L-Threonine Dehydrogenase (Tktdh) From The Hyperthermophilic Archaeon Thermococcus Kodakaraensis Length = 350 Back     alignment and structure
>pdb|1KOL|A Chain A, Crystal Structure Of Formaldehyde Dehydrogenase Length = 398 Back     alignment and structure
>pdb|3M6I|A Chain A, L-Arabinitol 4-Dehydrogenase Length = 363 Back     alignment and structure
>pdb|2DPH|A Chain A, Crystal Structure Of Formaldehyde Dismutase Length = 398 Back     alignment and structure
>pdb|3FPL|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of C. Beijerinckii Adh By T. Brockii Adh Length = 351 Back     alignment and structure
>pdb|1YKF|A Chain A, Nadp-Dependent Alcohol Dehydrogenase From Thermoanaerobium Brockii Length = 352 Back     alignment and structure
>pdb|2NVB|A Chain A, Contribution Of Pro275 To The Thermostability Of The Alcohol Dehydrogenases (Adhs) Length = 352 Back     alignment and structure
>pdb|1JQB|A Chain A, Alcohol Dehydrogenase From Clostridium Beijerinckii: Crystal Structure Of Mutant With Enhanced Thermal Stability Length = 351 Back     alignment and structure
>pdb|3FTN|A Chain A, Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDROGENASE BY EXCHANGE Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|3FSR|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|1PED|A Chain A, Bacterial Secondary Alcohol Dehydrogenase (Apo-Form) Length = 351 Back     alignment and structure
>pdb|3JYL|A Chain A, Crystal Structures Of Pseudomonas Syringae Pv. Tomato Dc3000 Quinone Oxidoreductase Length = 325 Back     alignment and structure
>pdb|3FPC|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-294 Of T. Brockii Adh By E. Histolytica Adh Length = 352 Back     alignment and structure
>pdb|2B83|A Chain A, A Single Amino Acid Substitution In The Clostridium Beijerinckii Alcohol Dehydrogenase Is Critical For Thermostabilization Length = 351 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 0.0
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 0.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 0.0
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 0.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 0.0
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 1e-157
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 1e-154
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 1e-152
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 4e-83
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 2e-81
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 3e-79
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 2e-78
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 1e-48
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 3e-47
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 2e-44
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 2e-43
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 1e-41
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 2e-40
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 8e-40
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 5e-39
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 1e-38
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 1e-37
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 2e-37
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 3e-37
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 5e-37
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 2e-36
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 3e-36
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 2e-34
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 3e-34
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 3e-34
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 3e-34
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 4e-34
3krt_A456 Crotonyl COA reductase; structural genomics, prote 1e-32
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 1e-27
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 2e-26
3fbg_A346 Putative arginate lyase; structural genomics, unkn 2e-24
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 2e-24
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 4e-24
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 6e-23
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 1e-22
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 1e-22
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 5e-22
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 6e-22
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 7e-22
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 9e-22
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 1e-21
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 5e-21
3gms_A340 Putative NADPH:quinone reductase; structural genom 2e-20
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 3e-20
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 4e-19
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 2e-18
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 2e-18
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 3e-18
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 2e-17
4eye_A342 Probable oxidoreductase; structural genomics, niai 4e-17
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 4e-17
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 2e-15
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 3e-15
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 2e-14
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 2e-14
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 3e-14
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 4e-13
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 3e-10
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 2e-05
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 4e-05
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 4e-05
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 3e-04
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 Back     alignment and structure
 Score =  587 bits (1516), Expect = 0.0
 Identities = 201/357 (56%), Positives = 254/357 (71%), Gaps = 3/357 (0%)

Query: 1   MAQTT-PNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKND 59
           M+++    H     GWAA D SG ++P+ F RR  G  DV  K+LYCG+CH+D+H +KND
Sbjct: 5   MSKSPEEEHPVKAFGWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGVCHSDLHSIKND 64

Query: 60  WGITMYPVVPGHEITGIITKVGSNVKNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKI 119
           WG +MYP+VPGHEI G +T+VGS VK   VGD+  VGCL  AC  CE C +  ENYC K+
Sbjct: 65  WGFSMYPLVPGHEIVGEVTEVGSKVKKVNVGDKVGVGCLVGACHSCESCANDLENYCPKM 124

Query: 120 QFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITVFCPMKDNNL 179
             TY  I+ DG+ITYGGYS  +VA+ R+++  P+N+ +D  APLLCAGITV+ P+K   L
Sbjct: 125 ILTYASIYHDGTITYGGYSNHMVANERYIIRFPDNMPLDGGAPLLCAGITVYSPLKYFGL 184

Query: 180 IDSPAKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNA 239
                 K IGIVGLGGLGHVAVKF KAFG  VTVISTSPSK++EA +  GAD F++S + 
Sbjct: 185 --DEPGKHIGIVGLGGLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNFGADSFLVSRDQ 242

Query: 240 MQMQAGKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSV 299
            QMQA   TLD I+DTVSA H L P+  LLK +G L +VGAPE P ELP+F LI G++ V
Sbjct: 243 EQMQAAAGTLDGIIDTVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKIV 302

Query: 300 KGSMTGGMRETQEMMNVCGKYNITCNIEVIKPDQINEALDRLARNDVRYRFVIDIAG 356
            GS  GGM+ETQEM++   K+NIT +IEVI  D +N A++RLA+NDVRYRFVID+  
Sbjct: 303 AGSGIGGMKETQEMIDFAAKHNITADIEVISTDYLNTAMERLAKNDVRYRFVIDVGN 359


>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Length = 328 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Length = 324 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Length = 330 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Length = 315 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 100.0
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 100.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 100.0
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 100.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 100.0
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 100.0
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 100.0
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 100.0
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 100.0
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 100.0
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 100.0
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 100.0
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 100.0
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 100.0
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 100.0
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 100.0
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 100.0
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 100.0
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 100.0
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 100.0
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 100.0
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 100.0
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 100.0
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 100.0
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 100.0
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 100.0
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 100.0
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 100.0
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 100.0
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 100.0
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 100.0
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 100.0
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 100.0
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 100.0
3krt_A456 Crotonyl COA reductase; structural genomics, prote 100.0
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 100.0
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 100.0
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 100.0
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 100.0
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 100.0
4eye_A342 Probable oxidoreductase; structural genomics, niai 100.0
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 100.0
3fbg_A346 Putative arginate lyase; structural genomics, unkn 100.0
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 100.0
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 100.0
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 100.0
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 100.0
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 100.0
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 100.0
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 100.0
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 100.0
3gms_A340 Putative NADPH:quinone reductase; structural genom 100.0
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 100.0
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 100.0
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 100.0
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 100.0
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 100.0
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 100.0
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 100.0
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 100.0
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 100.0
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 100.0
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 100.0
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 100.0
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 100.0
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 100.0
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 100.0
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.85
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.18
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 99.12
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 99.01
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.95
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.95
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.92
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.75
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.66
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.52
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.51
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.38
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.33
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.32
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.29
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.28
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.21
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.19
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.19
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 98.15
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.14
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.12
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.1
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.09
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.94
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.88
4eso_A255 Putative oxidoreductase; NADP, structural genomics 97.86
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.78
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.77
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 97.77
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.75
2b25_A336 Hypothetical protein; structural genomics, methyl 97.75
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.74
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 97.73
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 97.72
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.72
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.72
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.72
4dqx_A277 Probable oxidoreductase protein; structural genomi 97.71
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.71
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 97.7
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 97.69
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.69
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.68
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.68
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.66
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 97.66
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 97.66
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.66
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.66
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.65
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.62
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.61
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.61
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.61
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.59
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 97.58
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.58
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.58
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 97.57
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.57
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.56
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.56
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.56
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 97.56
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 97.55
1nff_A260 Putative oxidoreductase RV2002; directed evolution 97.54
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.54
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.53
3tjr_A301 Short chain dehydrogenase; structural genomics, se 97.53
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.53
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 97.51
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 97.5
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.5
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.49
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 97.49
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 97.49
3imf_A257 Short chain dehydrogenase; structural genomics, in 97.49
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 97.49
1spx_A278 Short-chain reductase family member (5L265); paral 97.49
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 97.48
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.48
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.46
3gem_A260 Short chain dehydrogenase; structural genomics, AP 97.45
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 97.44
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 97.43
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.43
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 97.42
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 97.42
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.42
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.41
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 97.41
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 97.41
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.4
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.4
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 97.39
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 97.39
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 97.39
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.39
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.39
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.39
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.39
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.39
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 97.38
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 97.38
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.38
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.37
3tox_A280 Short chain dehydrogenase; structural genomics, PS 97.37
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.37
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 97.37
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.36
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.36
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 97.36
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 97.36
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 97.36
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 97.35
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 97.34
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 97.34
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.34
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.34
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 97.34
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.34
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.33
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.32
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.32
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 97.32
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 97.31
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 97.3
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.3
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.3
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.3
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.3
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.3
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.3
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.3
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 97.3
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.28
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.27
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 97.27
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.27
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 97.27
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.26
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 97.26
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 97.26
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 97.26
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 97.26
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.25
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 97.25
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.25
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.25
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 97.24
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 97.24
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.24
1xhl_A297 Short-chain dehydrogenase/reductase family member 97.24
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.22
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.22
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 97.22
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 97.21
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 97.21
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.21
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 97.2
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.19
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.19
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.19
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 97.19
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 97.19
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.18
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 97.18
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.17
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.17
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.17
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.17
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.16
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.15
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 97.15
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 97.15
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.15
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 97.15
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.14
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 97.14
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 97.14
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 97.14
3edm_A259 Short chain dehydrogenase; structural genomics, ox 97.13
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 97.13
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 97.12
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 97.12
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.12
3tsc_A277 Putative oxidoreductase; structural genomics, seat 97.12
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.11
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 97.11
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.11
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.11
3m33_A226 Uncharacterized protein; structural genomics, PSI- 97.11
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.1
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 97.1
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.1
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 97.09
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.09
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.09
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 97.08
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 97.08
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 97.08
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.08
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.08
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.08
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 97.07
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 97.07
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 97.06
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 97.05
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 97.05
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.05
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 97.05
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 97.05
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.04
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 97.04
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.04
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 97.03
3rih_A293 Short chain dehydrogenase or reductase; structural 97.03
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 97.02
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 97.02
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 97.02
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 97.02
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.01
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.0
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.0
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 97.0
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 97.0
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 97.0
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.0
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 97.0
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 96.99
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 96.99
3e03_A274 Short chain dehydrogenase; structural genomics, PS 96.99
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 96.99
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 96.98
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.98
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 96.98
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 96.96
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 96.96
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.96
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 96.95
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.95
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.95
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 96.95
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.93
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.93
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.92
3cxt_A291 Dehydrogenase with different specificities; rossma 96.92
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 96.92
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.92
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.91
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 96.91
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.9
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 96.9
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 96.9
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.9
1xq6_A253 Unknown protein; structural genomics, protein stru 96.89
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 96.89
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 96.89
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.89
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.89
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 96.88
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 96.88
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 96.88
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.87
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 96.87
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.87
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 96.87
1xq1_A266 Putative tropinone reducatse; structural genomics, 96.86
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 96.86
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 96.86
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.84
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 96.83
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.83
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 96.83
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 96.83
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.83
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 96.83
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.83
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.82
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.81
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 96.81
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.81
1xkq_A280 Short-chain reductase family member (5D234); parra 96.81
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.79
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 96.79
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 96.79
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.79
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 96.78
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 96.77
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.77
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 96.76
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.76
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 96.75
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 96.75
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 96.75
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 96.75
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 96.75
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 96.74
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.74
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 96.74
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 96.74
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 96.74
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.73
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 96.73
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 96.72
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 96.72
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.72
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.72
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 96.71
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 96.69
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 96.68
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 96.67
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.67
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.66
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.66
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 96.66
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 96.66
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 96.65
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.65
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 96.64
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 96.64
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.64
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 96.63
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 96.62
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 96.62
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 96.61
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.59
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.59
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 96.58
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.57
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 96.56
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.56
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 96.55
2avd_A229 Catechol-O-methyltransferase; structural genomics, 96.53
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.53
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 96.53
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 96.52
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 96.52
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 96.52
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 96.52
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.51
2kw5_A202 SLR1183 protein; structural genomics, northeast st 96.49
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.49
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 96.48
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 96.48
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 96.48
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.47
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.47
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 96.46
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.46
1ooe_A236 Dihydropteridine reductase; structural genomics, P 96.46
3i9f_A170 Putative type 11 methyltransferase; structural gen 96.46
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 96.45
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 96.45
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 96.44
4had_A 350 Probable oxidoreductase protein; structural genomi 96.44
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.43
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.43
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.43
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.43
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.43
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 96.39
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 96.38
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.38
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 96.36
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.36
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.36
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.34
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 96.34
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 96.34
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 96.34
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 96.33
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 96.32
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 96.3
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 96.3
3hnr_A220 Probable methyltransferase BT9727_4108; structural 96.28
3qlj_A322 Short chain dehydrogenase; structural genomics, se 96.28
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 96.28
3f4k_A257 Putative methyltransferase; structural genomics, P 96.28
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 96.27
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 96.27
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 96.27
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.26
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.26
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 96.26
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 96.24
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 96.24
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 96.23
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 96.21
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 96.2
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 96.19
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 96.19
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 96.19
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 96.19
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 96.18
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 96.18
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 96.18
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 96.17
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 96.17
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 96.15
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.15
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.14
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 96.14
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.13
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 96.13
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.12
2o07_A304 Spermidine synthase; structural genomics, structur 96.11
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.1
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 96.1
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 96.09
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.08
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.08
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 96.07
2i7c_A283 Spermidine synthase; transferase, structural genom 96.07
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.07
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 96.07
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 96.06
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 96.05
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 96.05
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 96.04
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.04
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.04
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 96.04
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.04
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.04
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 96.03
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 96.03
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 96.02
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.01
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-60  Score=443.58  Aligned_cols=348  Identities=57%  Similarity=1.012  Sum_probs=310.9

Q ss_pred             CCcccceeEEeccCCCCCceEEEEeCCCCCCCeEEEEEeeeecccchhhhhccCCCCCCCCCccccccceEEEEecCCCC
Q 018158            6 PNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGSNVK   85 (360)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~l~~~~~~~p~~~~~evlVkv~~~~i~~~D~~~~~g~~~~~~~p~~~G~e~~G~V~~vG~~v~   85 (360)
                      +.+||+++++..+++++.++++++|.|+|+++||+|||.+++||++|++.+.|.++...+|.++|||++|+|+++|++|+
T Consensus        11 ~~~~mk~~~~~~~~~~~~l~~~~~~~p~~~~~eVlVkv~a~gi~~~D~~~~~g~~~~~~~P~v~GhE~~G~V~~vG~~V~   90 (366)
T 1yqd_A           11 EEHPVKAFGWAARDQSGHLSPFNFSRRATGEEDVRFKVLYCGVCHSDLHSIKNDWGFSMYPLVPGHEIVGEVTEVGSKVK   90 (366)
T ss_dssp             HHSSEEEEEEEECSTTCCEEEEEEEECCCCTTEEEEEEEEEEECHHHHHHHHTSSSCCCSSBCCCCCEEEEEEEECTTCC
T ss_pred             hhCCeeEEEEEEcCCCCCcEEEEccCCCCCCCeEEEEEEEEeechhhHHHHcCCCCCCCCCEecccceEEEEEEECCCCC
Confidence            34479999999998889999999999999999999999999999999999998775556899999999999999999999


Q ss_pred             CCCCCCEEEeccCccCCCCChhhhCCCCCCcccccccccccccCCCccccceeeEEEeecceeEECCCCCCccccccccc
Q 018158           86 NFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLC  165 (360)
Q Consensus        86 ~~~~Gd~V~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~g~~~~~~~~~g~~~~~~~v~~~~~~~iP~~~~~~~aa~l~~  165 (360)
                      +|++||||++.+....|+.|.+|+.|+++.|++..+.+.|....+...+|+|+||+.+|+++++++|+++++++||++++
T Consensus        91 ~~~vGDrV~~~~~~~~Cg~C~~c~~g~~~~C~~~~~~~~~~~~~g~~~~G~~aey~~v~~~~~~~~P~~ls~~~aa~l~~  170 (366)
T 1yqd_A           91 KVNVGDKVGVGCLVGACHSCESCANDLENYCPKMILTYASIYHDGTITYGGYSNHMVANERYIIRFPDNMPLDGGAPLLC  170 (366)
T ss_dssp             SCCTTCEEEECSEEECCSSSHHHHTTCGGGCTTCEESSSSBCTTSCBCCCSSBSEEEEEGGGCEECCTTSCTTTTGGGGT
T ss_pred             cCCCCCEEEEcCCcCCCCCChhhhCcCcccCCcccccccccccCCCcCCCccccEEEEchhhEEECCCCCCHHHhhhhhh
Confidence            99999999887777799999999999999997654444443333445679999999999999999999999999999999


Q ss_pred             hhhhhhchhhccCCCCCC-CCcEEEEEcCChHHHHHHHHHHHcCCeEEEEeCChhHHHHHHHHcCCCeEeeCccHHHHHh
Q 018158          166 AGITVFCPMKDNNLIDSP-AKKRIGIVGLGGLGHVAVKFGKAFGHHVTVISTSPSKEKEAKELLGADEFILSTNAMQMQA  244 (360)
Q Consensus       166 ~~~ta~~~l~~~~~~~~~-~~~~vlI~Gag~vG~~aiqla~~~G~~V~~~~~~~~~~~~~~~~~g~~~~v~~~~~~~~~~  244 (360)
                      ++.|||+++....   ++ +|++|||+|+|++|++++|+|+.+|++|+++++++++++.+++++|+++++++.+.+....
T Consensus       171 ~~~ta~~al~~~~---~~~~g~~VlV~GaG~vG~~~~q~a~~~Ga~Vi~~~~~~~~~~~~~~~lGa~~v~~~~~~~~~~~  247 (366)
T 1yqd_A          171 AGITVYSPLKYFG---LDEPGKHIGIVGLGGLGHVAVKFAKAFGSKVTVISTSPSKKEEALKNFGADSFLVSRDQEQMQA  247 (366)
T ss_dssp             HHHHHHHHHHHTT---CCCTTCEEEEECCSHHHHHHHHHHHHTTCEEEEEESCGGGHHHHHHTSCCSEEEETTCHHHHHH
T ss_pred             hHHHHHHHHHhcC---cCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEeCCHHHHHHHHHhcCCceEEeccCHHHHHH
Confidence            9999999998766   55 8999999999999999999999999999999999999999884499999999887655555


Q ss_pred             cCCCcCEEEEcCCCcccHHHHHHHhccCCEEEEeCCCCCCcccChhhHhccCcEEEEeecCCHHHHHHHHHHHhcCCCcc
Q 018158          245 GKRTLDFILDTVSAKHSLGPILELLKVNGTLSVVGAPEAPFELPSFPLIFGKRSVKGSMTGGMRETQEMMNVCGKYNITC  324 (360)
Q Consensus       245 ~~~~~d~vid~~g~~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~l~~~~l~~  324 (360)
                      ...++|++||++|....+..++++++++|+++.+|.......++...++.+++++.++.....++++++++++.++++++
T Consensus       248 ~~~~~D~vid~~g~~~~~~~~~~~l~~~G~iv~~g~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~l~~~g~l~~  327 (366)
T 1yqd_A          248 AAGTLDGIIDTVSAVHPLLPLFGLLKSHGKLILVGAPEKPLELPAFSLIAGRKIVAGSGIGGMKETQEMIDFAAKHNITA  327 (366)
T ss_dssp             TTTCEEEEEECCSSCCCSHHHHHHEEEEEEEEECCCCSSCEEECHHHHHTTTCEEEECCSCCHHHHHHHHHHHHHTTCCC
T ss_pred             hhCCCCEEEECCCcHHHHHHHHHHHhcCCEEEEEccCCCCCCcCHHHHHhCCcEEEEecCCCHHHHHHHHHHHHcCCCCC
Confidence            55689999999998766799999999999999999876666677777889999999998888889999999999999998


Q ss_pred             ceEEECCccHHHHHHHHHcCCCceeEEEecCC
Q 018158          325 NIEVIKPDQINEALDRLARNDVRYRFVIDIAG  356 (360)
Q Consensus       325 ~i~~~~~~~~~~a~~~~~~~~~~gkvvi~~~~  356 (360)
                      .+++|+|+++++|++.+.+++..||+|+++++
T Consensus       328 ~~~~~~l~~~~~A~~~~~~~~~~gKvvl~~~~  359 (366)
T 1yqd_A          328 DIEVISTDYLNTAMERLAKNDVRYRFVIDVGN  359 (366)
T ss_dssp             CEEEECGGGHHHHHHHHHTTCCSSEEEECHHH
T ss_pred             ceEEEcHHHHHHHHHHHHcCCcceEEEEEccc
Confidence            88999999999999999999888999999854



>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 360
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 2e-29
d1uufa1179 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein 8e-25
d1uufa2168 c.2.1.1 (A:145-312) Hypothetical protein YahK {Esc 1e-23
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 5e-22
d1piwa2168 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase 5e-20
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 6e-20
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 1e-19
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 3e-18
d1e3ia1202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 3e-18
d1vj0a1184 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein 6e-17
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 6e-16
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 8e-15
d1llua2166 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudom 1e-13
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 2e-13
d1h2ba2172 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeo 3e-13
d2jhfa1198 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase 3e-13
d1rjwa1171 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase 5e-13
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 8e-13
d1vj0a2182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 2e-12
d1jqba1177 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon 4e-12
d1f8fa2174 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { 5e-12
d1h2ba1171 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas 7e-12
d1jvba1177 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase 2e-11
d1rjwa2168 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillu 3e-10
d1jqba2174 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol 5e-10
d2jhfa2176 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( 1e-09
d1e3ia2174 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( 1e-09
d1cdoa2175 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga 2e-09
d1p0fa2174 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog 3e-09
d2fzwa2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 9e-09
d1d1ta2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 4e-08
d1jvba2170 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeo 1e-07
d1tt7a1162 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein 3e-06
d1iz0a1131 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase 2e-05
d1xa0a1152 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo 5e-05
d1o89a1146 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein 9e-05
d1e3ja2170 c.2.1.1 (A:143-312) Ketose reductase (sorbitol deh 1e-04
d1iz0a2171 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus 9e-04
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Cinnamyl alcohol dehydrogenase, ADH6
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  109 bits (274), Expect = 2e-29
 Identities = 55/160 (34%), Positives = 79/160 (49%), Gaps = 4/160 (2%)

Query: 14  GWAAHDPSGKITPYI--FKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGH 71
           G A         P    +  +    +D+ IKI  CG+C +DIH     WG    P+V GH
Sbjct: 9   GIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGH 68

Query: 72  EITGIITKVGSNVK-NFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDG 130
           EI G + K+G       KVG R  VG    +C+EC+ CK+  E YC K   TY+  + DG
Sbjct: 69  EIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDG 128

Query: 131 SITYGGYSEMLVADYRFVVHVPENIAMDAAAPLLCAGITV 170
            ++ GGY+  +     FVV +PENI ++    +  AG+  
Sbjct: 129 YVSQGGYANYVRVHEHFVVPIPENIWVETLP-VGEAGVHE 167


>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 168 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 168 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 172 Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 170 Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 170 Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 100.0
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 100.0
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 100.0
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 100.0
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 100.0
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 100.0
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 100.0
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 100.0
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 100.0
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 99.98
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 99.98
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.98
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.97
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.97
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.97
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.97
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.97
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 99.97
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.96
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.94
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.94
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.94
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.94
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.94
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.94
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.94
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 99.93
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.93
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.93
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.93
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.93
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.93
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.92
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.92
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.92
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.92
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.92
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.92
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.91
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.91
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.9
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.89
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.89
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.89
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.89
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.89
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.89
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.88
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.87
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.85
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.84
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.84
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.64
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 99.64
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.46
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.53
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.34
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.16
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.07
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 98.07
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 98.02
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.99
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 97.96
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.95
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.93
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.91
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 97.86
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.85
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 97.85
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.84
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.83
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 97.83
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.83
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.82
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 97.81
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 97.81
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.81
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 97.77
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.75
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 97.74
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.74
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.73
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.73
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 97.73
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.72
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.7
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.67
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.65
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.64
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.62
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.62
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.61
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.6
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 97.59
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.57
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.55
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 97.53
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 97.5
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.5
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.5
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 97.41
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 97.41
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.4
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 97.38
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.37
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.37
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.37
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.36
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 97.33
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 97.33
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 97.33
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 97.32
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 97.31
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 97.31
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.29
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.28
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.27
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 97.25
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.25
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 97.25
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 97.24
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 97.22
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.22
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 97.22
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 97.21
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 97.2
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.17
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 97.16
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.16
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.12
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 97.11
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.06
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.05
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 97.05
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.03
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 97.0
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.99
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.93
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 96.91
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 96.89
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.85
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 96.85
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 96.83
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 96.81
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.79
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.79
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 96.78
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 96.78
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 96.77
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.76
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 96.69
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.66
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 96.65
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.64
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 96.63
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.58
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.54
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 96.52
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.5
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 96.49
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.43
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 96.42
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 96.29
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 96.29
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 96.29
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 96.27
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.27
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.25
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.24
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 96.17
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.16
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.15
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 96.14
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 96.13
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 95.98
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 95.95
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.95
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 95.94
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.94
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 95.92
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 95.91
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 95.9
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 95.88
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 95.87
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.84
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 95.83
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 95.82
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 95.81
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.7
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.68
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.68
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.6
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 95.58
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 95.54
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.53
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.53
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.53
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.44
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.41
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.4
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.39
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 95.35
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.35
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.33
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 95.32
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 95.31
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 95.24
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.17
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 95.14
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.1
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.06
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 94.98
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.98
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 94.98
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.96
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.95
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 94.93
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.91
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 94.91
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.88
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 94.83
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.81
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 94.8
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 94.72
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 94.69
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.67
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.58
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 94.58
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 94.54
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.53
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.5
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 94.47
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.47
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.42
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.42
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 94.33
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.32
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.29
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.23
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 94.21
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 94.21
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 94.2
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 94.16
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.16
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.15
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.15
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 94.12
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 94.1
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 94.07
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 94.02
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.02
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 93.95
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 93.94
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 93.86
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.84
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.82
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 93.76
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 93.55
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 93.53
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 93.52
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 93.46
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 93.41
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 93.38
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 93.38
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 93.34
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.31
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 93.28
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.26
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 93.24
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.23
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 93.16
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 93.13
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 93.11
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.08
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.08
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 93.05
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 93.02
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 92.99
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 92.9
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 92.85
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 92.85
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 92.83
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 92.83
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 92.81
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 92.67
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 92.48
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 92.48
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 92.39
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.37
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 92.31
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.14
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 92.11
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 92.09
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 92.05
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 92.02
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 91.92
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 91.86
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.84
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 91.76
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 91.74
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 91.54
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 91.47
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 91.46
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 91.42
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 91.32
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 91.25
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.13
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 91.1
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 90.83
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 90.72
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 90.72
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 90.67
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 90.65
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.55
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 90.53
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 90.52
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 90.44
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 90.42
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 90.41
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 90.3
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 90.2
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 90.16
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 90.16
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 90.04
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 89.94
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 89.93
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 89.93
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.88
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 89.82
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.76
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 89.68
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 89.61
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 89.51
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 89.45
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 89.45
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 89.45
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 89.37
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 89.2
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 89.2
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 89.17
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 89.1
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 89.02
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 88.84
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 88.82
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.82
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 88.63
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.62
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 88.58
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 88.57
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 88.55
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 88.55
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 88.44
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.43
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 88.39
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.36
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 88.22
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 88.05
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 88.04
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 87.98
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.93
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 87.83
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 87.69
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 87.58
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 87.3
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 87.25
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 87.09
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 86.61
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 86.5
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 86.31
d1p3ha_99 Chaperonin-10 (GroES) {Mycobacterium tuberculosis 86.3
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 86.23
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 85.99
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 85.89
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 85.74
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 85.66
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 85.44
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 85.35
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 85.0
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.9
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 84.88
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 84.71
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 84.64
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 84.57
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 84.57
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 84.33
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.33
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 84.06
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 83.99
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 83.91
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 83.89
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 83.64
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 83.45
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 83.3
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 82.58
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 82.5
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 81.88
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 81.52
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 81.15
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 80.88
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 80.86
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.82
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 80.24
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Cinnamyl alcohol dehydrogenase, ADH6
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=1.3e-36  Score=252.39  Aligned_cols=185  Identities=29%  Similarity=0.524  Sum_probs=163.4

Q ss_pred             CCCCCcccceeEEeccCCCCCceEEEEeCCCCCCCeEEEEEeeeecccchhhhhccCCCCCCCCCccccccceEEEEecC
Q 018158            3 QTTPNHTQSVVGWAAHDPSGKITPYIFKRRENGVNDVTIKILYCGICHTDIHHVKNDWGITMYPVVPGHEITGIITKVGS   82 (360)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~p~~~~~evlVkv~~~~i~~~D~~~~~g~~~~~~~p~~~G~e~~G~V~~vG~   82 (360)
                      |.+|+| ++++++...+....+++++.+.++++|+|||||+++++||++|++++.|.++..++|+++|||++|+|+++|+
T Consensus         1 m~~P~~-~ka~~~~~~~~~~~~~~~~~~p~p~~~~eVlVkv~a~giC~sDl~~~~g~~~~~~~P~i~GHE~~G~Vv~vG~   79 (192)
T d1piwa1           1 MSYPEK-FEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGP   79 (192)
T ss_dssp             CCTTTC-EEEEEECCSSSTTSCEEEEECCCCCCTTEEEEEEEEEEECHHHHHHHTTTTSCCCSSEECCCCEEEEEEEECT
T ss_pred             CCCCce-eEEEEEeCCCcCCcceEeeccCCCCCCCeEEEEEeeeCCCcchHHHHcCCCCCCCCCcCcccccccchhhccc
Confidence            468998 8877777777777888989887788999999999999999999999999888888999999999999999999


Q ss_pred             CC-CCCCCCCEEEeccCccCCCCChhhhCCCCCCcccccccccccccCCCccccceeeEEEeecceeEECCCCCCccccc
Q 018158           83 NV-KNFKVGDRAAVGCLAAACMECEFCKDSQENYCDKIQFTYNGIFWDGSITYGGYSEMLVADYRFVVHVPENIAMDAAA  161 (360)
Q Consensus        83 ~v-~~~~~Gd~V~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~g~~~~~~~~~g~~~~~~~v~~~~~~~iP~~~~~~~aa  161 (360)
                      ++ +.+++||||.+.+....|+.|.+|+.|+++.|++......+....|...+|+|+||+++++++++++|+++++++|+
T Consensus        80 ~v~~~~k~GdrV~~~~~~~~c~~c~~c~~g~~~~C~~~~~~~~~~~~~G~~~~Ggfaey~~v~~~~~~~iP~~l~~e~Aa  159 (192)
T d1piwa1          80 KSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIWVETLP  159 (192)
T ss_dssp             TCCSSCCTTCEEEECSEEECCSCSHHHHTTCGGGCTTCEESSSCBCTTSCBCCCSSBSEEEEEGGGEEECCTTCCEEEEE
T ss_pred             ccccccCCCCeeeEeeeccCCCCchhhhcCCcccccccccccccccccccccccceeeEEEeehHHeEECCCCCCHHHHH
Confidence            88 56999999999888889999999999999999997766666666677889999999999999999999999998877


Q ss_pred             cccchhhhhhchhhccCCCCCCCCcEEEEE
Q 018158          162 PLLCAGITVFCPMKDNNLIDSPAKKRIGIV  191 (360)
Q Consensus       162 ~l~~~~~ta~~~l~~~~~~~~~~~~~vlI~  191 (360)
                      .+.+.+.|||+++....   ++++++|||.
T Consensus       160 l~~~~~~ta~~~l~~~~---vk~g~~Vvv~  186 (192)
T d1piwa1         160 VGEAGVHEAFERMEKGD---VRYRFTLVGY  186 (192)
T ss_dssp             SSHHHHHHHHHHHHHTC---CSSEEEEECC
T ss_pred             HHHHHHHHHHHHHHHhC---CCCCCEEEEE
Confidence            66666789999998654   5599999874



>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure