Citrus Sinensis ID: 018176

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIRAKSIKSPGKLNVTPLARDDSTPGRNVPQPVAAPIPIPMSASVPPTMPASANVPSVSTAGRAASESTFMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAGFGAEEDEWVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQRRRHDVRGCRCRFLVRYDHDQSEEIVPLRKVCRRPETDYRLQQLHAMNDSVMVDHQKTSADLSASTATRVTVSSAEMMHKQVNANIAQGAPLSHSFVSVPAQTVEPKNASASSGISSSNPAVPPGGAAVISGTAATTAATGHPS
cHHHHHHHccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEHHHHHHccccccccccEEEEEccccccccEEEEccccccccccccccccccccccccEEEEEEEccccEEEEEEEEEEEEEcccccccccEEEEEEEEccccEEEEcccEEEcccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHccccccHHHHHHHHHHHccccccccccEEcHHHHHHHHHHccHHHccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHcccccccccEEEEEEcccccccccEEEHHHHHHcccccccccccEEEccccEEEEEEcccccEEEEEHEHHHHHHHHccccccEEEEEEEEcccccccEccHHHHccccccHHHHHHHHHHHHHccHHcccccccHHHHccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccEEcccEEHHHHccccc
megilqehhnamPSREILVALAEKfsesperkgKIMVQMKQVWNWFQNRRYAIRAKsikspgklnvtplarddstpgrnvpqpvaapipipmsasvpptmpasanvpsvstagraasesTFMEFEaksardgawYDVSAFLAqrnfdtadpeVQVRFagfgaeedEWVNIKRhvrqrslpceasecvavlpgdlilCFQEGKDQALYFDAHVLDAqrrrhdvrgcrcrflvrydhdqseeivplrkvcrrpetDYRLQQLHAMNdsvmvdhqktsadlsastaTRVTVSSAEMMHKQVNAniaqgaplshsfvsvpaqtvepknasassgisssnpavppggaavisgtaattaatghps
megilqehhnampsREILVALAEKFsesperkgkIMVQMKQVWNWFQNRRYAIRaksikspgklnvtplarddstpgrnvPQPVAAPIPIPMSASVPPTMPASANVPSVSTAGRAASESTFMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAGfgaeedewVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLdaqrrrhdvrgCRCRFlvrydhdqseeivplrkvcrrPETDYRLQQLHAMNDSVMVDHQKTSADLSASTATRVTVSSAEMMHKQVNANIAQGAPLSHSFVSVPAQTVEPKNASASSGISSSNPAVPPGGAAVISGTAATTAATGHPS
MEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIRAKSIKSPGKLNVTPLARDDSTPGRNvpqpvaapipipMSASVPPTMPASANVPSVSTAGRAASESTFMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAGFGAEEDEWVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQrrrhdvrgcrcrFLVRYDHDQSEEIVPLRKVCRRPETDYRLQQLHAMNDSVMVDHQKTSADLsastatrvtvssaEMMHKQVNANIAQGAPLSHSFVSVPAQTVEPKNasassgisssNPAVPPggaavisgtaattaatgHPS
*********************************KIMVQMKQVWNWFQNRRYAIRAK*************************************************************************RDGAWYDVSAFLAQRNFDTADPEVQVRFAGFGAEEDEWVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQRRRHDVRGCRCRFLVRYDHDQSEEIVPLRKVCRRPETDYRLQQL****************************************************************************************************
*EG*****HNAMPSREILVALAEKF***********VQMKQVWNWFQNRR***********************************************************************MEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAGFGAEEDEWVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQRRRHDVRGCRCRFLVRYDHDQSEEIVPLRKVCRRPETDYRLQ******************************************************************************************************
MEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIRAKSIKSPGKLNVTPLARDDSTPGRNVPQPVAAPIPIPMSASVPPTMPASANVPSVSTAGRAASESTFMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAGFGAEEDEWVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQRRRHDVRGCRCRFLVRYDHDQSEEIVPLRKVCRRPETDYRLQQLHAMNDSVMVDHQ**************TVSSAEMMHKQVNANIAQGAPLSHSFVSVPAQ*******************VPPGGAAVISGT***********
*EGILQ**HNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYA*****************************************************************ESTFMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAGFGAEEDEWVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQRRRHDVRGCRCRFLVRYDHDQSEEIVPLRKVCRRPETDYRLQQLHAMNDSV*****************************************************************************VISGTAATTAATG***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIRAKSIKSPGKLNVTPLARDDSTPGRNVPQPVAAPIPIPMSASVPPTMPASANVPSVSTAGRAASESTFMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAGFGAEEDEWVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQRRRHDVRGCRCRFLVRYDHDQSEEIVPLRKVCRRPETDYRLQQLHAMNDSVMVDHQKTSADLSASTATRVTVSSAEMMHKQVNANIAQGAPLSHSFVSVPAQTVEPKNASASSGISSSNPAVPPGGAAVISGTAATTAATGHPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
357516491375 hypothetical protein MTR_8g061040 [Medic 0.938 0.901 0.613 1e-125
356514643383 PREDICTED: uncharacterized protein LOC10 0.936 0.879 0.620 1e-123
255554650401 DNA binding protein, putative [Ricinus c 0.969 0.870 0.607 1e-122
302142941419 unnamed protein product [Vitis vinifera] 0.988 0.849 0.609 1e-118
224061280286 predicted protein [Populus trichocarpa] 0.736 0.926 0.750 1e-116
449457011350 PREDICTED: uncharacterized protein LOC10 0.933 0.96 0.573 1e-115
224114579290 predicted protein [Populus trichocarpa] 0.747 0.927 0.721 1e-115
297834744349 sequence-specific DNA binding protein [A 0.886 0.914 0.603 1e-111
22331151348 sequence-specific DNA binding transcript 0.888 0.919 0.598 1e-110
334185436346 sequence-specific DNA binding transcript 0.886 0.921 0.6 1e-109
>gi|357516491|ref|XP_003628534.1| hypothetical protein MTR_8g061040 [Medicago truncatula] gi|355522556|gb|AET03010.1| hypothetical protein MTR_8g061040 [Medicago truncatula] Back     alignment and taxonomy information
 Score =  455 bits (1170), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 219/357 (61%), Positives = 269/357 (75%), Gaps = 19/357 (5%)

Query: 1   MEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIRAKSIKS 60
           ME IL EH+NAMP+R++L ALA+KFSESP+RKGKI VQMKQVWNWFQN+RYAIRAKS K+
Sbjct: 22  MEAILSEHNNAMPARDVLQALADKFSESPDRKGKITVQMKQVWNWFQNKRYAIRAKSSKT 81

Query: 61  PGKLNVTPLARDDSTPGRNVPQPVAAPIPIPMSASVPPTMPASANVPSVSTAGRAASEST 120
           P KLN+TP+ R D TPGR + QP A+PIP P +              SV T  +AA E++
Sbjct: 82  PAKLNITPMPRTDLTPGRIMTQPTASPIPAPSA--------------SVQTTAKAAPENS 127

Query: 121 FMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAGFGAEEDEWVNIKRHVRQRSLP 180
            MEFEAKS RDGAWYDV+ FL+ R+ +++DPEV VRFAGFG+EEDEW+N++++VR RSLP
Sbjct: 128 VMEFEAKSGRDGAWYDVATFLSYRHLESSDPEVLVRFAGFGSEEDEWINVRKNVRPRSLP 187

Query: 181 CEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQRRRHDVRGCRCRFLVRYDHDQSEE 240
           CE+SECVAVLPGDLILCFQEGK+QALYFDAHVLDAQRRRHDVRGCRCRFLVRYDHDQSEE
Sbjct: 188 CESSECVAVLPGDLILCFQEGKEQALYFDAHVLDAQRRRHDVRGCRCRFLVRYDHDQSEE 247

Query: 241 IVPLRKVCRRPETDYRLQQLHAMNDSVMVDHQKTSADLSASTATRVTVSSAEMMHKQVN- 299
           IVPLRK+CRRPETDYRL QLHA+ND+   D QK + D  A+       + +EM+ KQ   
Sbjct: 248 IVPLRKICRRPETDYRLHQLHAVNDAAPTDQQKIALDHPANVHGARVTNPSEMVQKQQQI 307

Query: 300 ANIAQGAPLSHSFVSVPAQT--VEPKNASASSGISSSNPAVPPGGAAVISGTAATTA 354
           ANI    P+  + VS+P Q+  V+P  A   + + + N   P   +A  +G  AT++
Sbjct: 308 ANIHIVTPVLQTNVSIPPQSMNVDPMKAETKADVQAGNSVTP--SSAAFTGIIATSS 362

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356514643|ref|XP_003526014.1| PREDICTED: uncharacterized protein LOC100783895 [Glycine max] Back     alignment and taxonomy information
>gi|255554650|ref|XP_002518363.1| DNA binding protein, putative [Ricinus communis] gi|223542458|gb|EEF43999.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302142941|emb|CBI20236.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224061280|ref|XP_002300405.1| predicted protein [Populus trichocarpa] gi|222847663|gb|EEE85210.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449457011|ref|XP_004146242.1| PREDICTED: uncharacterized protein LOC101220528 [Cucumis sativus] gi|449495505|ref|XP_004159861.1| PREDICTED: uncharacterized LOC101220528 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224114579|ref|XP_002316800.1| predicted protein [Populus trichocarpa] gi|222859865|gb|EEE97412.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297834744|ref|XP_002885254.1| sequence-specific DNA binding protein [Arabidopsis lyrata subsp. lyrata] gi|297331094|gb|EFH61513.1| sequence-specific DNA binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22331151|ref|NP_188467.2| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] gi|20260286|gb|AAM13041.1| unknown protein [Arabidopsis thaliana] gi|28059773|gb|AAO30091.1| unknown protein [Arabidopsis thaliana] gi|332642567|gb|AEE76088.1| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334185436|ref|NP_001189923.1| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] gi|332642569|gb|AEE76090.1| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query360
TAIR|locus:2095077349 SHH2 "SAWADEE homeodomain homo 0.758 0.782 0.626 1.1e-87
TAIR|locus:1005716727258 SHH1 "AT1G15215" [Arabidopsis 0.652 0.910 0.403 4.9e-37
TAIR|locus:2095077 SHH2 "SAWADEE homeodomain homolog 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 876 (313.4 bits), Expect = 1.1e-87, P = 1.1e-87
 Identities = 178/284 (62%), Positives = 209/284 (73%)

Query:     1 MEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIRAKSIKS 60
             ME IL +H+ AMP R IL ALA+KFSESPERKGK++VQ KQ+WNWFQNRRYA+RA+  K+
Sbjct:    22 MEAILLQHNTAMPGRHILEALADKFSESPERKGKVVVQFKQIWNWFQNRRYALRARGNKA 81

Query:    61 PGKLNVTPLARDDSTPG--RNXXXXXXXXXXXXMSASVPPTMPASAN--VPSVSTAGRAA 116
             PGKLNV+ + R D  P   R+            M+ ++P   PA +   VP V  +G   
Sbjct:    82 PGKLNVSSMPRMD-LPNQMRSVIQPLSVPKTTHMTGNLPGMTPAPSGSLVPGVMRSG--- 137

Query:   117 SESTFMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAGFGAEEDEWVNIKRHVRQ 176
             S+++++EFEAKSARDGAWYDV AFLA RN +  DPEVQVRFAGF  EEDEW+N+K+HVRQ
Sbjct:   138 SDNSYLEFEAKSARDGAWYDVQAFLAHRNLEIGDPEVQVRFAGFEVEEDEWINVKKHVRQ 197

Query:   177 RSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQXXXXXXXXXXXXFLVRYDHD 236
             RSLPCEASECVAVL GDL+LCFQEGKDQALYFDA VLDAQ            FLVRY HD
Sbjct:   198 RSLPCEASECVAVLAGDLVLCFQEGKDQALYFDAIVLDAQRRRHDVRGCRCRFLVRYSHD 257

Query:   237 QSE-EIVPLRKVCRRPETDYRLQQLH-AMNDSVMVD-HQKTSAD 277
             QSE EIVPLRK+CRRPETDYRLQQLH A+ND    + HQ  + D
Sbjct:   258 QSEQEIVPLRKICRRPETDYRLQQLHNAVNDLANSNQHQIPALD 301
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
TAIR|locus:1005716727 SHH1 "AT1G15215" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.I.4927.1
hypothetical protein (286 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query360
smart0038957 smart00389, HOX, Homeodomain 3e-04
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 5e-04
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information 
 Score = 38.0 bits (89), Expect = 3e-04
 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 10/47 (21%)

Query: 8  HHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIR 54
            N  PSRE    LA+K   S           +QV  WFQNRR   +
Sbjct: 21 QKNPYPSREEREELAKKLGLSE----------RQVKVWFQNRRAKWK 57

DNA-binding factors that are involved in the transcriptional regulation of key developmental processes. Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 360
cd0008659 homeodomain Homeodomain; DNA binding domains invol 97.86
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 97.76
PF0004657 Homeobox: Homeobox domain not present here.; Inter 97.65
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 96.1
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 95.56
PF15057124 DUF4537: Domain of unknown function (DUF4537) 94.58
KOG0775304 consensus Transcription factor SIX and related HOX 93.65
KOG0850245 consensus Transcription factor DLX and related pro 93.59
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 93.55
COG5576156 Homeodomain-containing transcription factor [Trans 91.7
KOG2251228 consensus Homeobox transcription factor [Transcrip 91.66
cd0002455 CHROMO Chromatin organization modifier (chromo) do 91.42
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 90.61
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 90.53
PLN00104 450 MYST -like histone acetyltransferase; Provisional 90.07
KOG0483198 consensus Transcription factor HEX, contains HOX a 89.97
KOG0488309 consensus Transcription factor BarH and related HO 89.58
KOG0491194 consensus Transcription factor BSH, contains HOX d 88.78
KOG0843197 consensus Transcription factor EMX1 and related HO 88.41
KOG0489261 consensus Transcription factor zerknullt and relat 87.91
smart0029855 CHROMO Chromatin organization modifier domain. 86.87
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 85.5
smart0074361 Agenet Tudor-like domain present in plant sequence 84.86
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 84.46
KOG0487308 consensus Transcription factor Abd-B, contains HOX 84.32
PF06003264 SMN: Survival motor neuron protein (SMN); InterPro 83.25
smart0056196 MBT Present in Drosophila Scm, l(3)mbt, and verteb 83.2
KOG0492246 consensus Transcription factor MSH, contains HOX d 81.7
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information 
Probab=97.86  E-value=2.1e-05  Score=56.09  Aligned_cols=42  Identities=38%  Similarity=0.605  Sum_probs=36.6

Q ss_pred             ChhhhhhhcCCCCCHHHHHHHHHHhcCCCCCCCCcccchhhHHHHHhhhhhhhh
Q 018176            1 MEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIR   54 (360)
Q Consensus         1 ME~~l~e~~~~~p~r~~~q~LAe~Fs~S~~RaGK~~Vq~kQV~~WFQnrr~~~~   54 (360)
                      ||+.|..  +..|+.+-++.||+..+          |+-+||.+||+|||...+
T Consensus        15 Le~~f~~--~~~P~~~~~~~la~~~~----------l~~~qV~~WF~nrR~~~~   56 (59)
T cd00086          15 LEKEFEK--NPYPSREEREELAKELG----------LTERQVKIWFQNRRAKLK   56 (59)
T ss_pred             HHHHHHh--CCCCCHHHHHHHHHHHC----------cCHHHHHHHHHHHHHHHh
Confidence            5677777  67999999999999987          888999999999988754

>smart00389 HOX Homeodomain Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>PF15057 DUF4537: Domain of unknown function (DUF4537) Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>PF06003 SMN: Survival motor neuron protein (SMN); InterPro: IPR010304 This family consists of several eukaryotic survival motor neuron (SMN) proteins Back     alignment and domain information
>smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 98.73
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 97.55
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 97.46
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 97.45
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 97.44
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 97.44
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 97.43
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 97.43
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 97.43
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 97.42
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 97.42
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 97.37
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 97.36
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 97.35
1uhs_A72 HOP, homeodomain only protein; structural genomics 97.34
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 97.32
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 97.31
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 97.31
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 97.31
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 97.29
3a02_A60 Homeobox protein aristaless; homeodomain, developm 97.29
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 97.28
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 97.27
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 97.27
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 97.25
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 97.25
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 97.24
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 97.23
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 97.22
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 97.2
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 97.19
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 97.19
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 97.18
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 97.17
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 97.16
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 97.16
1lfb_A99 Liver transcription factor (LFB1); transcription r 97.16
1wh5_A80 ZF-HD homeobox family protein; structural genomics 97.16
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 97.15
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 97.14
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 97.13
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 97.12
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 97.1
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 97.1
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 97.09
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 97.08
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 97.07
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 97.07
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 97.06
2e19_A64 Transcription factor 8; homeobox domain, structura 97.03
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 97.01
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 97.01
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 96.99
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 96.98
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 96.96
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 96.96
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 96.95
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 96.95
3a01_A93 Homeodomain-containing protein; homeodomain, prote 96.92
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 96.88
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 96.87
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 96.64
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 96.46
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 96.43
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 96.41
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 96.15
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 96.05
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 95.64
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 95.52
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 95.42
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 95.23
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 95.15
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 95.05
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 94.92
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 94.58
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 94.4
2bud_A92 Males-absent on the first protein; transferase, MO 93.78
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 93.55
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 93.4
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 93.35
2lcc_A76 AT-rich interactive domain-containing protein 4A; 92.9
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 92.85
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 92.47
2xsd_C164 POU domain, class 3, transcription factor 1; trans 92.41
2diq_A110 Tudor and KH domain-containing protein; tudor doma 92.37
4hae_A81 CDY-like 2, chromodomain Y-like protein 2; protein 92.23
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 92.05
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 92.05
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 91.94
1e3o_C160 Octamer-binding transcription factor 1; transcript 91.93
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 91.92
3d1n_I151 POU domain, class 6, transcription factor 1; prote 91.6
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 91.54
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 91.46
3s6w_A54 Tudor domain-containing protein 3; methylated argi 90.94
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 90.86
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 90.58
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 90.36
3s6w_A54 Tudor domain-containing protein 3; methylated argi 90.19
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 90.13
2rsn_A75 Chromo domain-containing protein 1; chromodomain, 89.37
2d9t_A78 Tudor domain-containing protein 3; structural geno 89.24
3sd4_A69 PHD finger protein 20; tudor domain, transcription 88.57
2d9t_A78 Tudor domain-containing protein 3; structural geno 88.49
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 88.01
3qii_A85 PHD finger protein 20; tudor domain, structural ge 87.97
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 87.9
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 87.01
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 86.92
2lcc_A76 AT-rich interactive domain-containing protein 4A; 85.96
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 85.76
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 84.11
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 84.1
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 84.08
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 83.42
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 83.23
4b9w_A201 TDRD1, tudor domain-containing protein 1; replicat 82.71
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 82.28
4b9x_A226 TDRD1, tudor domain-containing protein 1; replicat 82.01
2rso_A92 Chromatin-associated protein SWI6; chromodomain, s 81.04
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 80.35
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 80.1
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=98.73  E-value=1.3e-08  Score=80.46  Aligned_cols=57  Identities=26%  Similarity=0.394  Sum_probs=51.0

Q ss_pred             ChhhhhhhcCCCCCHHHHHHHHHHhc-----CCCCCCCCcccchhhHHHHHhhhhhhhhhcccC
Q 018176            1 MEGILQEHHNAMPSREILVALAEKFS-----ESPERKGKIMVQMKQVWNWFQNRRYAIRAKSIK   59 (360)
Q Consensus         1 ME~~l~e~~~~~p~r~~~q~LAe~Fs-----~S~~RaGK~~Vq~kQV~~WFQnrr~~~~~k~~~   59 (360)
                      ||+.|++  +..|+.+.++.||++++     .+++++|+..|+.+||++||||||...+.+...
T Consensus        22 Le~~F~~--~~yP~~~~r~~lA~~l~~~~~~~~~~~~~~~~ls~~qV~~WFqNRR~k~kr~~~~   83 (95)
T 2cuf_A           22 MESYFNE--NQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANI   83 (95)
T ss_dssp             HHHHHHH--CSSCCHHHHHHHHHHHHHHHCCTTCCCCTTTCCCHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHhc--CCCCCHHHHHHHHHHHCchhhcccccccccCcCCHHHHHHHHHHHHHHHHHHhhc
Confidence            5777876  78999999999999999     999999999999999999999999987766543
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} Back     alignment and structure
>2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 360
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 9e-04
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 0.001
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 0.002
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 0.002
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 0.004
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.1 bits (81), Expect = 9e-04
 Identities = 12/51 (23%), Positives = 20/51 (39%), Gaps = 11/51 (21%)

Query: 1  MEGILQEHH-NAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRR 50
          M   L +H  +  P+ +    +A +            + + QV NWF N R
Sbjct: 17 MRSWLFQHIGHPYPTEDEKKQIAAQ----------TNLTLLQVNNWFINAR 57
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query360
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.1
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 98.0
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 97.83
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 97.79
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 97.78
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 97.73
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 97.68
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 97.67
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 97.63
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 97.61
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 97.6
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 97.6
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 97.59
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 97.57
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 97.56
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 97.56
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 97.55
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 97.51
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 97.5
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 97.5
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 97.48
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 97.46
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 97.43
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 97.42
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 97.41
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 97.39
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 97.29
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 97.22
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 97.16
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 97.1
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 96.9
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 96.88
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 95.87
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 95.54
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 92.63
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 90.39
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 90.37
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 89.38
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 89.08
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 88.1
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 87.48
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 86.44
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 84.77
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 84.48
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 84.34
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 84.26
d1wjqa_107 Lethal(3)malignant brain tumor-like 3 protein, L3M 83.11
d1guwa_73 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 81.98
d1g6za_70 Histone methyltransferase clr4, chromo domain {Fis 80.07
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Hepatocyte nuclear factor 1a (LFB1/HNF1)
species: Rat (Rattus rattus) [TaxId: 10117]

Probab=98.10  E-value=1.1e-06  Score=67.33  Aligned_cols=54  Identities=26%  Similarity=0.396  Sum_probs=44.4

Q ss_pred             ChhhhhhhcCCCCCHHHHHHHHHHhc-----------CCCCCCCCcccchhhHHHHHhhhhhhhhhc
Q 018176            1 MEGILQEHHNAMPSREILVALAEKFS-----------ESPERKGKIMVQMKQVWNWFQNRRYAIRAK   56 (360)
Q Consensus         1 ME~~l~e~~~~~p~r~~~q~LAe~Fs-----------~S~~RaGK~~Vq~kQV~~WFQnrr~~~~~k   56 (360)
                      ||+.|++  +..|+.+--+.||++-|           ..-+.+|+..|+-.||++||||||...+.+
T Consensus        12 Le~~F~~--n~yPs~~~Re~LA~~ln~~~~~~~~~~~~~~~~~~~~~vt~~~V~~WF~NRR~~~kr~   76 (78)
T d1lfba_          12 LFQAYER--QKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR   76 (78)
T ss_dssp             HHHHHTT--CSSCCHHHHHHHHHHHHHHHHTTTTCCTTCTTTTGGGCCCHHHHHHHHHHHHHTTSCC
T ss_pred             HHHHHHh--CCCCCHHHHHHHHHHhchhhhccccccccccccccccCCCHHHHHHHHHHHHHHHHHh
Confidence            3566665  68899999999999998           355667899999999999999999876543
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure