Citrus Sinensis ID: 018233
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 359 | ||||||
| 224133660 | 311 | predicted protein [Populus trichocarpa] | 0.771 | 0.890 | 0.546 | 8e-86 | |
| 225431110 | 294 | PREDICTED: E3 ubiquitin-protein ligase R | 0.752 | 0.918 | 0.521 | 2e-75 | |
| 297734999 | 352 | unnamed protein product [Vitis vinifera] | 0.752 | 0.767 | 0.521 | 2e-75 | |
| 297797773 | 308 | hypothetical protein ARALYDRAFT_497000 [ | 0.746 | 0.870 | 0.476 | 2e-71 | |
| 15239276 | 310 | receptor homology-transmembrane-ring H2 | 0.746 | 0.864 | 0.476 | 4e-70 | |
| 42573810 | 290 | receptor homology-transmembrane-ring H2 | 0.740 | 0.917 | 0.479 | 7e-70 | |
| 225470792 | 446 | PREDICTED: E3 ubiquitin-protein ligase R | 0.782 | 0.630 | 0.431 | 3e-60 | |
| 255577542 | 577 | zinc finger protein, putative [Ricinus c | 0.707 | 0.440 | 0.477 | 1e-58 | |
| 255586465 | 434 | zinc finger protein, putative [Ricinus c | 0.760 | 0.629 | 0.417 | 1e-58 | |
| 296081075 | 424 | unnamed protein product [Vitis vinifera] | 0.729 | 0.617 | 0.439 | 1e-57 |
| >gi|224133660|ref|XP_002327649.1| predicted protein [Populus trichocarpa] gi|222836734|gb|EEE75127.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 323 bits (828), Expect = 8e-86, Method: Compositional matrix adjust.
Identities = 154/282 (54%), Positives = 203/282 (71%), Gaps = 5/282 (1%)
Query: 69 MREKFLMKFLIIYLNLCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVAD 128
MRE + + Y + ++ SSAT++ KP S+ FPDLPAK A+ +N S CG+LHVA+
Sbjct: 1 MREGLFLILSLFYAIM--IIEGSSATVLIKPSSISFPDLPAKSALSLNGSSVCGSLHVAN 58
Query: 129 PADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVS 188
P DACSPL N N++ F LIVRG+C FEDKI+NAQ+AG+RAAIV++D++ +L+
Sbjct: 59 PLDACSPLRNRFEFNESG--RFALIVRGECAFEDKIKNAQSAGFRAAIVFDDKDNRNLIY 116
Query: 189 MTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFA 248
M + EG+KVHA+FV+ G LK+ ARG+ GECCI+ +W+VL +S+ S++V+
Sbjct: 117 MMVNPEGIKVHAVFVTKYAGEILKDRARGKEGECCIYSSRTDAAWTVLAISLISVVVILG 176
Query: 249 LFAVAFITPRPWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDY 308
L + F+TPR W W N + +DSK+VEALPCF F +AS SQCH GETCAICLEDY
Sbjct: 177 LLILVFVTPRHWLHWQRTNNR-CKSVDSKMVEALPCFTFRNASLSQCHVGETCAICLEDY 235
Query: 309 QDGEKLKVLSCKHEFHASCVDSWLTKWGTFCPVCKHDMRNNS 350
+DGE LKVL C HEFH++CVDSWLTKWGTFCPVCK DM++ S
Sbjct: 236 KDGEVLKVLPCHHEFHSTCVDSWLTKWGTFCPVCKLDMKDKS 277
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225431110|ref|XP_002265670.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297734999|emb|CBI17361.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297797773|ref|XP_002866771.1| hypothetical protein ARALYDRAFT_497000 [Arabidopsis lyrata subsp. lyrata] gi|297312606|gb|EFH43030.1| hypothetical protein ARALYDRAFT_497000 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15239276|ref|NP_201417.1| receptor homology-transmembrane-ring H2 domain protein 1 [Arabidopsis thaliana] gi|6942147|gb|AAF32325.1|AF218807_1 ReMembR-H2 protein JR700 [Arabidopsis thaliana] gi|10177131|dbj|BAB10421.1| ReMembR-H2 protein JR700 [Arabidopsis thaliana] gi|14334832|gb|AAK59594.1| putative ReMembR-H2 protein JR700 [Arabidopsis thaliana] gi|15293205|gb|AAK93713.1| putative ReMembR-H2 protein JR700 [Arabidopsis thaliana] gi|332010784|gb|AED98167.1| receptor homology-transmembrane-ring H2 domain protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42573810|ref|NP_975001.1| receptor homology-transmembrane-ring H2 domain protein 1 [Arabidopsis thaliana] gi|332010783|gb|AED98166.1| receptor homology-transmembrane-ring H2 domain protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225470792|ref|XP_002269731.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255577542|ref|XP_002529649.1| zinc finger protein, putative [Ricinus communis] gi|223530875|gb|EEF32736.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255586465|ref|XP_002533876.1| zinc finger protein, putative [Ricinus communis] gi|223526177|gb|EEF28507.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|296081075|emb|CBI18269.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 359 | ||||||
| TAIR|locus:2156872 | 310 | RMR1 "receptor homology region | 0.754 | 0.874 | 0.474 | 1.1e-69 | |
| TAIR|locus:2016044 | 448 | AT1G71980 [Arabidopsis thalian | 0.757 | 0.607 | 0.399 | 5.5e-54 | |
| TAIR|locus:2014726 | 318 | AT1G35630 [Arabidopsis thalian | 0.754 | 0.852 | 0.371 | 3.8e-46 | |
| TAIR|locus:2133697 | 448 | AT4G09560 [Arabidopsis thalian | 0.766 | 0.613 | 0.389 | 6.2e-46 | |
| TAIR|locus:2199665 | 422 | AT1G22670 [Arabidopsis thalian | 0.760 | 0.646 | 0.370 | 1.2e-42 | |
| UNIPROTKB|F1MFJ1 | 350 | F1MFJ1 "Uncharacterized protei | 0.693 | 0.711 | 0.309 | 2.1e-29 | |
| UNIPROTKB|Q0VD51 | 380 | RNF13 "E3 ubiquitin-protein li | 0.710 | 0.671 | 0.313 | 2.4e-28 | |
| UNIPROTKB|I3LG86 | 381 | RNF13 "Ring finger protein 13" | 0.710 | 0.669 | 0.313 | 2.4e-28 | |
| UNIPROTKB|F1NA38 | 380 | RNF13 "E3 ubiquitin-protein li | 0.640 | 0.605 | 0.318 | 3.9e-28 | |
| UNIPROTKB|F1NUJ3 | 272 | RNF13 "E3 ubiquitin-protein li | 0.640 | 0.845 | 0.318 | 3.9e-28 |
| TAIR|locus:2156872 RMR1 "receptor homology region transmembrane domain ring H2 motif protein 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 706 (253.6 bits), Expect = 1.1e-69, P = 1.1e-69
Identities = 131/276 (47%), Positives = 183/276 (66%)
Query: 84 LCFVVSLSSATLVWKPLSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASN 143
L ++ +S AT+V +S F DLPAKF V +G CGAL+VADP D CSPL + ASN
Sbjct: 16 LSSLLRVSLATVVLNSISASFADLPAKFDGSVTKNGICGALYVADPLDGCSPLLHAAASN 75
Query: 144 DADH--INFVLIVRGQCIFEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHEGVKVHAI 201
H F LI+RG+C FEDK+ NAQ +G++A IVY++ + L+ M + + + V A+
Sbjct: 76 WTQHRTTKFALIIRGECSFEDKLLNAQNSGFQAVIVYDNIDNEDLIVMKVNPQDITVDAV 135
Query: 202 FVSLETGVYLKEHARGETGECCIFPESNRGSWSVLMVSVFSLIVVFALFAVAFITPRPWR 261
FVS G L+++ARG GECC+ P +W+VL +S FSL+++ +AF PR W
Sbjct: 136 FVSNVAGEILRKYARGRDGECCLNPPDRGSAWTVLAISFFSLLLIVTFLLIAFFAPRHWT 195
Query: 262 PWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKH 321
W G++ + RLD+K+V LPCF F+ ++ + GETCAICLEDY+ GE L++L C+H
Sbjct: 196 QWRGRHTR-TIRLDAKLVHTLPCFTFTDSAHHKA--GETCAICLEDYRFGESLRLLPCQH 252
Query: 322 EFHASCVDSWLTKWGTFCPVCKHDMRNNSESNEVKR 357
FH +C+DSWLTKWGT CPVCKHD+R + S+EV +
Sbjct: 253 AFHLNCIDSWLTKWGTSCPVCKHDIRTETMSSEVHK 288
|
|
| TAIR|locus:2016044 AT1G71980 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014726 AT1G35630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133697 AT4G09560 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199665 AT1G22670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MFJ1 F1MFJ1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VD51 RNF13 "E3 ubiquitin-protein ligase RNF13" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LG86 RNF13 "Ring finger protein 13" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NA38 RNF13 "E3 ubiquitin-protein ligase RNF13" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NUJ3 RNF13 "E3 ubiquitin-protein ligase RNF13" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 359 | |||
| cd02123 | 153 | cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-a | 2e-40 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 3e-16 | |
| cd04818 | 118 | cd04818, PA_subtilisin_1, PA_subtilisin_1: Proteas | 5e-16 | |
| cd00538 | 126 | cd00538, PA, PA: Protease-associated (PA) domain | 3e-15 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 4e-13 | |
| cd02133 | 143 | cd02133, PA_C5a_like, PA_C5a_like: Protease-associ | 2e-11 | |
| pfam02225 | 96 | pfam02225, PA, PA domain | 5e-11 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 1e-10 | |
| cd02127 | 118 | cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease- | 5e-10 | |
| cd04813 | 117 | cd04813, PA_1, PA_1: Protease-associated (PA) doma | 2e-09 | |
| cd02126 | 126 | cd02126, PA_EDEM3_like, PA_EDEM3_like: protease as | 6e-09 | |
| cd02122 | 138 | cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-a | 8e-09 | |
| cd02132 | 139 | cd02132, PA_GO-like, PA_GO-like: Protease-associat | 9e-09 | |
| cd02130 | 122 | cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-as | 4e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 5e-08 | |
| cd02124 | 129 | cd02124, PA_PoS1_like, PA_PoS1_like: Protease-asso | 7e-08 | |
| cd04816 | 122 | cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease- | 2e-06 | |
| COG5219 | 1525 | COG5219, COG5219, Uncharacterized conserved protei | 5e-06 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 3e-05 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-04 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 6e-04 | |
| cd02125 | 127 | cd02125, PA_VSR, PA_VSR: Protease-associated (PA) | 0.001 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 0.001 |
| >gnl|CDD|239038 cd02123, PA_C_RZF_like, PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like | Back alignment and domain information |
|---|
Score = 139 bits (353), Expect = 2e-40
Identities = 59/128 (46%), Positives = 78/128 (60%), Gaps = 4/128 (3%)
Query: 100 LSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCI 159
L+ F DLPA F SG G L VA+P +ACSP+ NP +++A VLI RG C
Sbjct: 20 LTDEFDDLPANFGPIPPGSGLKGVLVVAEPLNACSPIENPPLNSNASGSFIVLIRRGNCS 79
Query: 160 FEDKIRNAQAAGYRAAIVYNDREKGSLVSMTASHE---GVKVHAIFVSLETGVYLKEHAR 216
FE K+RNAQ AGY+AAIVYND E L+SM+ + + G+ + ++FV TG LK++A
Sbjct: 80 FETKVRNAQRAGYKAAIVYND-ESNDLISMSGNDQEIKGIDIPSVFVGKSTGEILKKYAS 138
Query: 217 GETGECCI 224
E G I
Sbjct: 139 YEKGVILI 146
|
This group includes various PA domain-containing proteins similar to C-RZF (chicken embryo RING zinc finger) protein. These proteins contain a C3H2C3 RING finger. C-RZF is expressed in embryo cells and is restricted mainly to brain and heart, it is localized to both the nucleus and endosomes. Additional C3H2C3 RING finger proteins belonging to this group, include Arabidopsis ReMembR-H2 protein and mouse sperizin. ReMembR-H2 is likely to be an integral membrane protein, and to traffic through the endosomal pathway. Sperizin is expressed in haploid germ cells and localized in the cytoplasm, it may participate in spermatogenesis. The significance of the PA domain to these proteins has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Length = 153 |
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240122 cd04818, PA_subtilisin_1, PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|238300 cd00538, PA, PA: Protease-associated (PA) domain | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|239048 cd02133, PA_C5a_like, PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase | Back alignment and domain information |
|---|
| >gnl|CDD|216938 pfam02225, PA, PA domain | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|239042 cd02127, PA_hPAP21_like, PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) | Back alignment and domain information |
|---|
| >gnl|CDD|240117 cd04813, PA_1, PA_1: Protease-associated (PA) domain subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|239041 cd02126, PA_EDEM3_like, PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239037 cd02122, PA_GRAIL_like, PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like | Back alignment and domain information |
|---|
| >gnl|CDD|239047 cd02132, PA_GO-like, PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 | Back alignment and domain information |
|---|
| >gnl|CDD|239045 cd02130, PA_ScAPY_like, PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|239039 cd02124, PA_PoS1_like, PA_PoS1_like: Protease-associated (PA) domain PoS1-like | Back alignment and domain information |
|---|
| >gnl|CDD|240120 cd04816, PA_SaNapH_like, PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) | Back alignment and domain information |
|---|
| >gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239040 cd02125, PA_VSR, PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 359 | |||
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| cd02123 | 153 | PA_C_RZF_like PA_C-RZF_ like: Protease-associated | 99.9 | |
| cd02125 | 127 | PA_VSR PA_VSR: Protease-associated (PA) domain-con | 99.89 | |
| cd02126 | 126 | PA_EDEM3_like PA_EDEM3_like: protease associated d | 99.89 | |
| cd02127 | 118 | PA_hPAP21_like PA_hPAP21_like: Protease-associated | 99.88 | |
| cd02122 | 138 | PA_GRAIL_like PA _GRAIL_like: Protease-associated | 99.86 | |
| cd02132 | 139 | PA_GO-like PA_GO-like: Protease-associated domain | 99.85 | |
| cd04813 | 117 | PA_1 PA_1: Protease-associated (PA) domain subgrou | 99.83 | |
| cd02129 | 120 | PA_hSPPL_like PA_hSPPL_like: Protease-associated d | 99.8 | |
| cd04818 | 118 | PA_subtilisin_1 PA_subtilisin_1: Protease-associat | 99.78 | |
| cd04816 | 122 | PA_SaNapH_like PA_SaNapH_like: Protease-associated | 99.75 | |
| cd02130 | 122 | PA_ScAPY_like PA_ScAPY_like: Protease-associated d | 99.72 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 99.66 | |
| cd04817 | 139 | PA_VapT_like PA_VapT_like: Protease-associated dom | 99.64 | |
| KOG3920 | 193 | consensus Uncharacterized conserved protein, conta | 99.63 | |
| cd02124 | 129 | PA_PoS1_like PA_PoS1_like: Protease-associated (PA | 99.59 | |
| PF02225 | 101 | PA: PA domain; InterPro: IPR003137 The PA (Proteas | 99.58 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.56 | |
| KOG2442 | 541 | consensus Uncharacterized conserved protein, conta | 99.46 | |
| cd00538 | 126 | PA PA: Protease-associated (PA) domain. The PA dom | 99.4 | |
| cd02133 | 143 | PA_C5a_like PA_C5a_like: Protease-associated domai | 99.36 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.29 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.28 | |
| cd04819 | 127 | PA_2 PA_2: Protease-associated (PA) domain subgrou | 99.2 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 99.2 | |
| cd04815 | 134 | PA_M28_2 PA_M28_2: Protease-associated (PA) domain | 99.05 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 99.02 | |
| cd02120 | 126 | PA_subtilisin_like PA_subtilisin_like: Protease-as | 99.01 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.98 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.98 | |
| cd02128 | 183 | PA_TfR PA_TfR: Protease-associated domain containi | 98.95 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.91 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.91 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.89 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.88 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.77 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.77 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.76 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.76 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.74 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.73 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.68 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.61 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.58 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 98.46 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.45 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.44 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 98.41 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 98.38 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.37 | |
| cd02121 | 220 | PA_GCPII_like PA_GCPII_like: Protease-associated d | 98.34 | |
| cd04822 | 151 | PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) do | 98.32 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 98.29 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.25 | |
| cd04820 | 137 | PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) do | 98.14 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.09 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 98.08 | |
| cd04814 | 142 | PA_M28_1 PA_M28_1: Protease-associated (PA) domain | 98.05 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.05 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.04 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 98.03 | |
| cd02131 | 153 | PA_hNAALADL2_like PA_hNAALADL2_like: Protease-asso | 98.01 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.01 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 97.99 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.87 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.87 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.81 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.66 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.66 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 97.64 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.49 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.46 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.39 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.31 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 97.17 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.16 | |
| KOG0801 | 205 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.15 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.05 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.03 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.02 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.99 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.98 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.95 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.74 | |
| PHA02862 | 156 | 5L protein; Provisional | 96.74 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 96.5 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 96.46 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 96.45 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.44 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.35 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.25 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.23 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 95.9 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 95.69 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 95.62 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.58 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.46 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 95.36 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 95.35 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 95.28 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 95.2 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.19 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.13 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.11 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.05 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 95.03 | |
| PHA03096 | 284 | p28-like protein; Provisional | 94.61 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.04 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 93.97 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 93.86 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 93.86 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 93.8 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 93.61 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 93.54 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 93.35 | |
| cd04821 | 157 | PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) do | 93.21 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 92.86 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 92.72 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 92.07 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 91.9 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 91.7 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 91.17 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 90.89 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.49 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 90.25 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.16 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 89.87 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 89.63 | |
| KOG1609 | 323 | consensus Protein involved in mRNA turnover and st | 89.42 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 87.89 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.02 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.3 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 84.75 | |
| KOG1829 | 580 | consensus Uncharacterized conserved protein, conta | 84.62 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 84.34 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.4 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 82.24 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 80.55 | |
| KOG3899 | 381 | consensus Uncharacterized conserved protein [Funct | 80.54 |
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-51 Score=392.40 Aligned_cols=255 Identities=41% Similarity=0.738 Sum_probs=217.7
Q ss_pred ccccccccccccccccCCCCeeEEEeeCCCCCCCCCCCCCCCCCCCCcceEEEEEcCCCChHHHHHHHHHcCCcEEEEec
Q 018233 100 LSLHFPDLPAKFAVDVNSSGTCGALHVADPADACSPLSNPVASNDADHINFVLIVRGQCIFEDKIRNAQAAGYRAAIVYN 179 (359)
Q Consensus 100 ~~~~f~~~~A~FG~~~~~~~~~g~L~~~~p~~aC~~~~~~~~~~~~~~~~ivLV~RG~CsF~~K~~~Aq~aGA~avIi~n 179 (359)
.+.+|.+.+|+||+.+..++..|.|+.++|.|||+++.+.+........+++||+||+|+|++|+++||++|++|+||||
T Consensus 32 ~S~sf~d~~a~f~~s~~~e~~~G~l~~~ep~~aC~~i~~~p~~~~~~~~~laLI~Rg~CsFe~Kv~~AQ~aGfkaaIVyn 111 (348)
T KOG4628|consen 32 TSLSFADLPALFGPSLPSEGNLGVLVVAEPLNACNPITNFPEHSTRSTSFLALIRRGGCSFEDKVLNAQRAGFKAAIVYN 111 (348)
T ss_pred ccccccCCccccCCccccccceeeeecCCCccccCccccCccCCCCCcceEEEEEccCCchHHHHhhcccccCceEEEec
Confidence 67789999999999999999999999999999999998744333445689999999999999999999999999999999
Q ss_pred ccCccccccccCCCCcceeeEEeechhhHHHHHHhhccCCCceeecC-CCCCccccceeeeehhHHHHHHHhhhhccCCC
Q 018233 180 DREKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGETGECCIFP-ESNRGSWSVLMVSVFSLIVVFALFAVAFITPR 258 (359)
Q Consensus 180 ~~~~~~~~~m~~~~~~i~Ip~v~i~~~~G~~L~~~~~~~~~~v~I~~-~~~~~~~~~m~IsfiillvIiavlli~~~~~r 258 (359)
|.+.+.++.|..+..++.|+++|++...|+.|.++.......+...+ ....+.|.++.++++.++++.+++++.+++++
T Consensus 112 n~~~~~lv~~~~~~~~v~i~~~~vs~~~ge~l~~~~~~~~~~~~~~~~~~~~~~ws~~~~~~i~~l~v~~il~~~f~i~~ 191 (348)
T KOG4628|consen 112 NVGSEDLVAMASNPSKVDIHIVFVSVFSGELLSSYAGRTEFECLLIPLGFDTSPWSILAISLISLLTVVAILVTCFFIYR 191 (348)
T ss_pred CCCCchheeeccCCccceeEEEEEeeehHHHHHHhhcccceeeeeccccccCCcchhhhhhhhhHHHHHHHHHHHHHHHH
Confidence 98888889998888999999999999999999997665555555555 78888999988888888888888877777766
Q ss_pred CCCCCCCCCCccccccchhhhhccceeeeccCCCcCCCCCcccccccccccCCCceEEecCCCcccHHHHHHHHhcCCCC
Q 018233 259 PWRPWPGQNQPLSRRLDSKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHEFHASCVDSWLTKWGTF 338 (359)
Q Consensus 259 ~r~~~~~~~~~~~~~l~~~~i~~lp~~~~~~~~~~~~~~~~~C~ICLe~f~~~~~vr~LpC~H~FH~~CI~~Wl~~~~~~ 338 (359)
++...+.++..+..++.++.++++|...|....++... +.|+||||+|++||++|+|||+|.||..|||+||.++++.
T Consensus 192 ~~~~~~~r~~~~~~r~~k~~l~~~p~~~f~~~~~~~~~--~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~ 269 (348)
T KOG4628|consen 192 IRRLIRARNRLRRNRLIKRLLKKLPVRTFTKGDDEDAT--DTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTF 269 (348)
T ss_pred HHHHHHHHhHhhhhhhHHHHHhhCCcEEeccccccCCC--ceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCcc
Confidence 55444333324466889999999999999986655222 7999999999999999999999999999999999999878
Q ss_pred CCCccccCCCCCCCcccc
Q 018233 339 CPVCKHDMRNNSESNEVK 356 (359)
Q Consensus 339 CPlCR~~i~~~~~~~~~~ 356 (359)
||+||+++....+.++..
T Consensus 270 CPvCK~di~~~~~~~~~~ 287 (348)
T KOG4628|consen 270 CPVCKRDIRTDSGSEPVS 287 (348)
T ss_pred CCCCCCcCCCCCCCCCcc
Confidence 999999998877665543
|
|
| >cd02123 PA_C_RZF_like PA_C-RZF_ like: Protease-associated (PA) domain C_RZF-like | Back alignment and domain information |
|---|
| >cd02125 PA_VSR PA_VSR: Protease-associated (PA) domain-containing plant vacuolar sorting receptor (VSR) | Back alignment and domain information |
|---|
| >cd02126 PA_EDEM3_like PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins | Back alignment and domain information |
|---|
| >cd02127 PA_hPAP21_like PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa) | Back alignment and domain information |
|---|
| >cd02122 PA_GRAIL_like PA _GRAIL_like: Protease-associated (PA) domain GRAIL-like | Back alignment and domain information |
|---|
| >cd02132 PA_GO-like PA_GO-like: Protease-associated domain containing proteins like Arabidopsis thaliana growth-on protein GRO10 | Back alignment and domain information |
|---|
| >cd04813 PA_1 PA_1: Protease-associated (PA) domain subgroup 1 | Back alignment and domain information |
|---|
| >cd02129 PA_hSPPL_like PA_hSPPL_like: Protease-associated domain containing human signal peptide peptidase-like (hSPPL)-like | Back alignment and domain information |
|---|
| >cd04818 PA_subtilisin_1 PA_subtilisin_1: Protease-associated domain containing subtilisin-like proteases, subgroup 1 | Back alignment and domain information |
|---|
| >cd04816 PA_SaNapH_like PA_SaNapH_like: Protease-associated domain containing proteins like Streptomyces anulatus N-acetylpuromycin N-acetylhydrolase (SaNapH) | Back alignment and domain information |
|---|
| >cd02130 PA_ScAPY_like PA_ScAPY_like: Protease-associated domain containing proteins like Saccharomyces cerevisiae aminopeptidase Y (ScAPY) | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04817 PA_VapT_like PA_VapT_like: Protease-associated domain containing proteins like VapT from Vibrio metschnikovii strain RH530 | Back alignment and domain information |
|---|
| >KOG3920 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02124 PA_PoS1_like PA_PoS1_like: Protease-associated (PA) domain PoS1-like | Back alignment and domain information |
|---|
| >PF02225 PA: PA domain; InterPro: IPR003137 The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG2442 consensus Uncharacterized conserved protein, contains PA domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd00538 PA PA: Protease-associated (PA) domain | Back alignment and domain information |
|---|
| >cd02133 PA_C5a_like PA_C5a_like: Protease-associated domain containing proteins like Streptococcus pyogenes C5a peptidase | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >cd04819 PA_2 PA_2: Protease-associated (PA) domain subgroup 2 | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04815 PA_M28_2 PA_M28_2: Protease-associated (PA) domain, peptidase family M28, subfamily-2 | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >cd02120 PA_subtilisin_like PA_subtilisin_like: Protease-associated domain containing subtilisin-like proteases | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02128 PA_TfR PA_TfR: Protease-associated domain containing proteins like transferrin receptor (TfR) | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >cd02121 PA_GCPII_like PA_GCPII_like: Protease-associated domain containing protein, glutamate carboxypeptidase II (GCPII)-like | Back alignment and domain information |
|---|
| >cd04822 PA_M28_1_3 PA_M28_1_3: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 3 | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04820 PA_M28_1_1 PA_M28_1_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 1 | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >cd04814 PA_M28_1 PA_M28_1: Protease-associated (PA) domain, peptidase family M28, subfamily-1 | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02131 PA_hNAALADL2_like PA_hNAALADL2_like: Protease-associated domain containing proteins like human N-acetylated alpha-linked acidic dipeptidase-like 2 protein (hNAALADL2) | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >cd04821 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 2 | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3899 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 359 | ||||
| 1x4j_A | 75 | Solution Structure Of Ring Finger In Ring Finger Pr | 1e-07 | ||
| 1iym_A | 55 | Ring-H2 Finger Domain Of El5 Length = 55 | 2e-06 | ||
| 2ect_A | 78 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 7e-06 | ||
| 2kiz_A | 69 | Solution Structure Of Arkadia Ring-H2 Finger Domain | 1e-05 | ||
| 2ep4_A | 74 | Solution Structure Of Ring Finger From Human Ring F | 5e-05 | ||
| 2l0b_A | 91 | Solution Nmr Structure Of Zinc Finger Domain Of E3 | 7e-05 | ||
| 3eif_A | 936 | 1.9 Angstrom Crystal Structure Of The Active Form O | 3e-04 |
| >pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 | Back alignment and structure |
|
| >pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 | Back alignment and structure |
| >pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 | Back alignment and structure |
| >pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 | Back alignment and structure |
| >pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 | Back alignment and structure |
| >pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 | Back alignment and structure |
| >pdb|3EIF|A Chain A, 1.9 Angstrom Crystal Structure Of The Active Form Of The C5a Peptidase From Streptococcus Pyogenes (Scpa) Length = 936 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 359 | |||
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 3e-24 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 3e-22 | |
| 3icu_A | 194 | E3 ubiquitin-protein ligase RNF128; E3 ligase, ene | 7e-22 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 5e-21 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 7e-21 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 1e-19 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 3e-16 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 4e-15 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 3e-13 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 7e-12 | |
| 1xf1_A | 926 | C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St | 6e-11 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 7e-11 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 3e-09 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 2e-08 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 3e-08 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 1e-07 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-07 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 5e-07 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 6e-07 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 8e-07 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 1e-06 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 2e-06 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 5e-06 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 1e-05 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 2e-05 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 2e-05 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 2e-05 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 3e-05 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 3e-05 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 3e-05 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 4e-05 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 1e-04 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 2e-04 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 2e-04 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 2e-04 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 3e-04 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 3e-04 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 4e-04 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 5e-04 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 6e-04 | |
| 2ek8_A | 421 | Aminopeptidase; metalloproteinase, hydrolase; 1.80 | 7e-04 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 9e-04 |
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Score = 93.5 bits (233), Expect = 3e-24
Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
Query: 276 SKVVEALPCFLFSSASSSQCHGGETCAICLEDYQDGEKLKVLSCKHEFHASCVDSWLTKW 335
S LP + F+ + C +C+ D++ + L+VL C HEFHA CVD WL
Sbjct: 3 SGSSGQLPSYRFNPNNHQS--EQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKAN 60
Query: 336 GTFCPVCKHDMRNNS 350
T CP+C+ D +S
Sbjct: 61 RT-CPICRADSGPSS 74
|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} Length = 194 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* Length = 421 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 359 | |||
| 3icu_A | 194 | E3 ubiquitin-protein ligase RNF128; E3 ligase, ene | 99.89 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.69 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.64 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.55 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.55 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.54 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.54 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.47 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.45 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.44 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.44 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.41 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.4 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.4 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.36 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.34 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.32 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.31 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.31 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.31 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.28 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.26 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.26 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.25 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.22 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.22 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.22 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.21 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.2 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.18 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 99.17 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.16 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.15 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.14 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.13 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.12 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.1 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.09 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.05 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.05 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.02 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.01 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.0 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.0 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.0 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.99 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.97 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.95 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.91 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.88 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.86 | |
| 2ek8_A | 421 | Aminopeptidase; metalloproteinase, hydrolase; 1.80 | 98.85 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.84 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.83 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.82 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.81 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.8 | |
| 3iib_A | 444 | Peptidase M28; YP_926796.1, structural genomics, J | 98.79 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.74 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.72 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.69 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.67 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.65 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.65 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.63 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.57 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.56 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.55 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.5 | |
| 3fed_A | 707 | Glutamate carboxypeptidase III; metallopeptidase, | 98.49 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.33 | |
| 3kas_A | 640 | Transferrin receptor protein 1; transferrin recept | 98.32 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.26 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.16 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.15 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.05 | |
| 3i6s_A | 649 | Subtilisin-like protease; PA-domain, FN3-domain, h | 97.95 | |
| 1y9z_A | 441 | Alkaline serine protease; subtilisin-like alpha/be | 97.84 | |
| 1xf1_A | 926 | C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St | 97.69 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 97.61 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 93.81 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 92.56 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 92.54 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 90.63 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 85.9 | |
| 3vta_A | 621 | Cucumisin; subtilisin-like fold, serine protease, | 85.39 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 85.36 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 83.84 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 83.75 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 82.09 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 80.96 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 80.62 |
| >3icu_A E3 ubiquitin-protein ligase RNF128; E3 ligase, energy, PA domain, transmembrane,protein turnover conjugation pathway; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.89 E-value=4.7e-23 Score=183.39 Aligned_cols=129 Identities=22% Similarity=0.342 Sum_probs=102.7
Q ss_pred ccccccccccccCCCCeeEEEeeCC---CCCCCCCCCCCCCCC----CCCcceEEEEEcCC-CChHHHHHHHHHcCCcEE
Q 018233 104 FPDLPAKFAVDVNSSGTCGALHVAD---PADACSPLSNPVASN----DADHINFVLIVRGQ-CIFEDKIRNAQAAGYRAA 175 (359)
Q Consensus 104 f~~~~A~FG~~~~~~~~~g~L~~~~---p~~aC~~~~~~~~~~----~~~~~~ivLV~RG~-CsF~~K~~~Aq~aGA~av 175 (359)
+.+.+|+||..++..++.|.|+.+. |.+||++.++...+. +..+++||||+||+ |+|.+|++|||++||+||
T Consensus 54 ~~~e~a~FG~~~p~~~v~G~lv~~~~~~~~~GC~~~~~~~~~~~~~~~~~~gkIaLV~RG~~CsF~~Kv~nAq~aGA~av 133 (194)
T 3icu_A 54 ELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGA 133 (194)
T ss_dssp EEEEEEEECTTSCCSCEEEEEECBSSTTCTTCCSTTCCBCCCBCTTSSCBCCEEEEEESCTTCCHHHHHHHHHHTTCSEE
T ss_pred ecccccccCCCCCCCCcEEEEEecCCCCCcCCCCCCccccCCcccccccCCCeEEEEECCCCcCHHHHHHHHHHCCCcEE
Confidence 6678999999999999999999764 789999987643221 12368999999999 999999999999999999
Q ss_pred EEeccc-CccccccccCCCCcceeeEEeechhhHHHHHHhhccC-CCceeecCCCCCccc
Q 018233 176 IVYNDR-EKGSLVSMTASHEGVKVHAIFVSLETGVYLKEHARGE-TGECCIFPESNRGSW 233 (359)
Q Consensus 176 Ii~n~~-~~~~~~~m~~~~~~i~Ip~v~i~~~~G~~L~~~~~~~-~~~v~I~~~~~~~~~ 233 (359)
||||+. ++..+.+|..++ ...||++||++++|+.|+++++.+ .+.+.+.....+++|
T Consensus 134 IIyNn~~~g~~~~~m~~~~-~~~IPsv~Is~~~G~~L~~~L~~G~~Vtvti~vg~~h~pw 192 (194)
T 3icu_A 134 VIFNFPGTRNEVIPMSHPG-AVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPW 192 (194)
T ss_dssp EEECCTTCTTCCCCCCCTT-CCSSEEEEECHHHHHHHHHHHHTTCCEEEEEEEEEEECCC
T ss_pred EEEeCCCCCCceeeecCCC-CCceeEEEECHHHHHHHHHHHHCCCeEEEEEECCCccCCC
Confidence 999985 334556666443 458999999999999999988765 444555555555555
|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3iib_A Peptidase M28; YP_926796.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.70A {Shewanella amazonensis SB2B} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fed_A Glutamate carboxypeptidase III; metallopeptidase, bimetallic active site, N-glycosylation, C cation, chloride anion, zinc IONS, dipept glycoprotein; HET: NAG BIX; 1.29A {Homo sapiens} PDB: 3fec_A* 3fee_A* 3ff3_A* 2c6c_A* 2c6g_A* 2c6p_A* 2cij_A* 2jbj_A* 2jbk_A* 3rbu_A* 3bi1_A* 2oot_A* 2pvv_A* 2pvw_A* 2xei_A* 2or4_A* 3bi0_A* 3bhx_A* 3d7d_A* 3d7f_A* ... | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3kas_A Transferrin receptor protein 1; transferrin receptor 1, arenavirus, cell MEMB disulfide bond, endocytosis, HOST-virus inter receptor, secreted, transmembrane; HET: NAG FUC BMA MAN; 2.40A {Homo sapiens} PDB: 1de4_C* 3s9l_A* 3s9m_A* 3s9n_A* 1cx8_A* 1suv_A 2nsu_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* | Back alignment and structure |
|---|
| >1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* | Back alignment and structure |
|---|
| >1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 359 | ||||
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-13 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-11 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 3e-11 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 8e-11 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 3e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 4e-08 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 3e-07 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 7e-07 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-06 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 3e-06 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 3e-06 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 6e-05 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 3e-04 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Score = 62.2 bits (151), Expect = 2e-13
Identities = 23/49 (46%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
Query: 298 GETCAICLEDYQDGEKLKVL-SCKHEFHASCVDSWLTKWGTFCPVCKHD 345
G CA+CL + +DGE+ + L C H FHA CVD WL T CP+C+
Sbjct: 5 GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHST-CPLCRLT 52
|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 359 | |||
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.67 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.52 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.5 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.45 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.43 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.42 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.4 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.22 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.18 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.16 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.15 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.12 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.99 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.98 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.86 | |
| d1de4c2 | 193 | Transferrin receptor ectodomain, apical domain {Hu | 98.8 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.55 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.53 | |
| d3bi1a2 | 233 | Glutamate carboxypeptidase II {Human (Homo sapiens | 98.39 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 92.19 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 90.41 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 88.58 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 87.68 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 85.87 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 84.88 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 83.71 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 80.54 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.67 E-value=1e-17 Score=117.75 Aligned_cols=51 Identities=43% Similarity=1.051 Sum_probs=45.7
Q ss_pred CCCcccccccccccCCCceEEec-CCCcccHHHHHHHHhcCCCCCCCccccCC
Q 018233 296 HGGETCAICLEDYQDGEKLKVLS-CKHEFHASCVDSWLTKWGTFCPVCKHDMR 347 (359)
Q Consensus 296 ~~~~~C~ICLe~f~~~~~vr~Lp-C~H~FH~~CI~~Wl~~~~~~CPlCR~~i~ 347 (359)
+++.+|+|||++|+.++.++++| |+|.||.+||++|++.++ +||+||++|.
T Consensus 3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~-~CP~CR~~i~ 54 (55)
T d1iyma_ 3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHS-TCPLCRLTVV 54 (55)
T ss_dssp CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCC-SCSSSCCCSC
T ss_pred CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCC-cCCCCCCEeE
Confidence 45678999999999999998885 999999999999999876 5999999874
|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1de4c2 c.8.4.1 (C:190-382) Transferrin receptor ectodomain, apical domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bi1a2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|