Citrus Sinensis ID: 018278

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MSTLKSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIVISVTYPLFHPLNVLEI
ccHHHHHHHHHHHHHHccccccccEEEEEEEccccccccccHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEEccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHcccccEEEcccccccccccccccccccccHHHHHHHHHHcccccEEcccccHHHHHHHHHccccccccccccccccccccccccEEcccccccccccccccccHHHHHHHHHHHHccccccEEEcccccccccccccccc
cHHHHHHHHHHHHHHHcccccccccEEEcccccHHHccccHHHHHHccHHHHHHHcccEEEccccccEcccccccEcccccccccccccHHHHHHHHHHHHHcccEEEEEEcccEccccEEcccccEEEcccccccccccccHHHEcccccccccccccccccEccccccEEccccHHHHHHHHHHHHHHHHcccccEEEEccHHHccHHHHHHHHHHHcccEEEEcccccccEcccccEccccHHHHHHHHHHHHHHHccccEEEEHHHHHHHHHccccHHHccccccccccHHHHcHHHEEEEccccccccccccccccHHHHHHHHHHHHHcccEEEEEEccEcccccccccccc
MSTLKSFCFLSFLLAIflpftspallfqgfnwessnkaggwynslknsipdlsnagithvwlpppsqsvapqgympgrlydldaskygsQADLKSLIQAFRQKGIKCLADMVINHrtaerkdgrgiycifeggtsddrldwgpsficrgdkeysdgqgnddtgedfqpapdidhlnpRVQKELSDWMNWLKTEIgfdgwrfdfvkgyapsITKVYMentspdfavgekwdslsygpdgkpdanqdghrgALKDWVQAAGGavaafdftTKGILQAAVQGELWrlkdsngkppgfigilpqnavtfidnhdtgstqrlwpfpsdkvmLGYAYIlthpgtpcivisvtyplfhplnvlei
MSTLKSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINhrtaerkdgrgiYCIFEggtsddrldwGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIVISVTYPLFHPLNVLEI
MSTLKSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIVISVTYPLFHPLNVLEI
****KSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLP*********GYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRG******************************QKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWD******************GALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIVISVTYPLFHPLNVL**
***LKSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIVISVTYPLFHP******
MSTLKSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIVISVTYPLFHPLNVLEI
MSTLKSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIVISVTYPLFHPLN****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTLKSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCIVISVTYPLFHPLNVLEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query358 2.2.26 [Sep-21-2011]
P17859421 Alpha-amylase OS=Vigna mu N/A no 0.941 0.800 0.806 1e-164
Q8VZ56423 Alpha-amylase 1 OS=Arabid yes no 0.941 0.796 0.720 1e-142
P27933436 Alpha-amylase isozyme 3D yes no 0.885 0.727 0.703 1e-137
P27932440 Alpha-amylase isozyme 3A no no 0.952 0.775 0.640 1e-134
P27934437 Alpha-amylase isozyme 3E no no 0.932 0.764 0.646 1e-134
P27937438 Alpha-amylase isozyme 3B no no 0.885 0.723 0.694 1e-133
P27939437 Alpha-amylase isozyme 3C no no 0.885 0.725 0.690 1e-133
P04063427 Alpha-amylase type B isoz N/A no 0.899 0.754 0.682 1e-131
P04747368 Alpha-amylase type B isoz N/A no 0.899 0.875 0.679 1e-130
P04750429 Alpha-amylase type B isoz N/A no 0.938 0.783 0.647 1e-129
>sp|P17859|AMYA_VIGMU Alpha-amylase OS=Vigna mungo GN=AMY1.1 PE=2 SV=1 Back     alignment and function desciption
 Score =  578 bits (1489), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/341 (80%), Positives = 301/341 (88%), Gaps = 4/341 (1%)

Query: 1   MSTLKSFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHV 60
            S L  FC    LL +F   +SPALLFQGFNWESS K GGWYNSLKNSIPDL+NAGITHV
Sbjct: 4   FSRLSIFCLFISLLPLF---SSPALLFQGFNWESSKK-GGWYNSLKNSIPDLANAGITHV 59

Query: 61  WLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAER 120
           WLPPPSQSV+P+GY+PGRLYDLDASKYGS+ +LKSLI AF +KGIKCLAD+VINHRTAER
Sbjct: 60  WLPPPSQSVSPEGYLPGRLYDLDASKYGSKNELKSLIAAFHEKGIKCLADIVINHRTAER 119

Query: 121 KDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQ 180
           KDGRGIYCIFEGGT D R DWGPSFICR D  YSDG GN+D+GE +  APDIDHLNP+VQ
Sbjct: 120 KDGRGIYCIFEGGTPDSRQDWGPSFICRDDTAYSDGTGNNDSGEGYDAAPDIDHLNPQVQ 179

Query: 181 KELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKP 240
           +ELS+WMNWLKTEIGFDGWRFDFVKGYAPSI+K+YME T PDFAVGEKWDS+SYG DGKP
Sbjct: 180 RELSEWMNWLKTEIGFDGWRFDFVKGYAPSISKIYMEQTKPDFAVGEKWDSISYGQDGKP 239

Query: 241 DANQDGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQ 300
           + NQD HRGAL +WV++AGGA+ AFDFTTKGILQAAVQGELWRL D NGKPPG IG+ P+
Sbjct: 240 NYNQDSHRGALVNWVESAGGAITAFDFTTKGILQAAVQGELWRLIDPNGKPPGMIGVKPE 299

Query: 301 NAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCI 341
           NAVTFIDNHDTGSTQRLWPFPSDKVM GYAYILTHPGTP I
Sbjct: 300 NAVTFIDNHDTGSTQRLWPFPSDKVMQGYAYILTHPGTPSI 340

Vigna mungo (taxid: 3915)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1
>sp|Q8VZ56|AMY1_ARATH Alpha-amylase 1 OS=Arabidopsis thaliana GN=AMY1 PE=2 SV=1 Back     alignment and function description
>sp|P27933|AMY3D_ORYSJ Alpha-amylase isozyme 3D OS=Oryza sativa subsp. japonica GN=AMY1.3 PE=2 SV=2 Back     alignment and function description
>sp|P27932|AMY3A_ORYSJ Alpha-amylase isozyme 3A OS=Oryza sativa subsp. japonica GN=AMY1.2 PE=2 SV=2 Back     alignment and function description
>sp|P27934|AMY3E_ORYSJ Alpha-amylase isozyme 3E OS=Oryza sativa subsp. japonica GN=AMY1.4 PE=2 SV=1 Back     alignment and function description
>sp|P27937|AMY3B_ORYSJ Alpha-amylase isozyme 3B OS=Oryza sativa subsp. japonica GN=AMY1.6 PE=2 SV=1 Back     alignment and function description
>sp|P27939|AMY3C_ORYSJ Alpha-amylase isozyme 3C OS=Oryza sativa subsp. japonica GN=AMY1.7 PE=2 SV=2 Back     alignment and function description
>sp|P04063|AMY2_HORVU Alpha-amylase type B isozyme OS=Hordeum vulgare GN=AMY1.2 PE=1 SV=3 Back     alignment and function description
>sp|P04747|AMY3_HORVU Alpha-amylase type B isozyme (Fragment) OS=Hordeum vulgare GN=AMY1.3 PE=2 SV=1 Back     alignment and function description
>sp|P04750|AMY6_HORVU Alpha-amylase type B isozyme OS=Hordeum vulgare GN=AMY1.6 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
224137490423 predicted protein [Populus trichocarpa] 0.938 0.794 0.824 1e-166
255538306422 alpha-amylase, putative [Ricinus communi 0.935 0.793 0.816 1e-163
224063525404 predicted protein [Populus trichocarpa] 0.888 0.787 0.861 1e-162
113781421 RecName: Full=Alpha-amylase; AltName: Fu 0.941 0.800 0.806 1e-162
228404421 alpha amylase 0.941 0.800 0.803 1e-162
30962522421 alpha-amylase [Vigna angularis] 0.941 0.800 0.806 1e-162
255538308 1113 pentatricopeptide repeat-containing prot 0.930 0.299 0.804 1e-161
388508160421 unknown [Medicago truncatula] 0.949 0.807 0.788 1e-157
357437821421 Alpha-amylase [Medicago truncatula] gi|3 0.949 0.807 0.788 1e-156
3769330420 alpha-amylase [Phaseolus vulgaris] 0.938 0.8 0.780 1e-156
>gi|224137490|ref|XP_002327139.1| predicted protein [Populus trichocarpa] gi|222835454|gb|EEE73889.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  589 bits (1519), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 278/337 (82%), Positives = 306/337 (90%), Gaps = 1/337 (0%)

Query: 6   SFCFLSFLLAIFLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPP 65
           +FCF S  L++F   TS  LLFQGFNWES NKAGGWYNSLKNS+PDL+NAGITHVWLPP 
Sbjct: 5   TFCFFSLFLSVFPLLTSSYLLFQGFNWESCNKAGGWYNSLKNSVPDLANAGITHVWLPPS 64

Query: 66  SQSVAPQG-YMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGR 124
           SQSVAPQG YMPGRLYDL AS+YGSQ +LKSLI  F QKGIKCLAD+VINHRTAE++D R
Sbjct: 65  SQSVAPQGRYMPGRLYDLSASRYGSQDELKSLIGDFNQKGIKCLADIVINHRTAEKQDER 124

Query: 125 GIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELS 184
           GI+ +FEGGTSDDRLDWGPSFIC  D  YSDG+GN D+G+DF+PAPDIDHLNPRVQ+ELS
Sbjct: 125 GIWSVFEGGTSDDRLDWGPSFICGDDTAYSDGKGNPDSGDDFEPAPDIDHLNPRVQRELS 184

Query: 185 DWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQ 244
           DWMNWLK+EIGFDGWRFDFVKGYAPS+TK+YMENTSPDFAVGEKWDSL+YG DGK D NQ
Sbjct: 185 DWMNWLKSEIGFDGWRFDFVKGYAPSVTKIYMENTSPDFAVGEKWDSLAYGQDGKLDYNQ 244

Query: 245 DGHRGALKDWVQAAGGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVT 304
           D HRG++KDW+QAAGGAV AFDFT+KGILQAAVQGELWRLKDSNGKPPG IG+LPQNAVT
Sbjct: 245 DAHRGSIKDWIQAAGGAVTAFDFTSKGILQAAVQGELWRLKDSNGKPPGLIGLLPQNAVT 304

Query: 305 FIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCI 341
           FIDNHDTGSTQ++WPFPSDKVM GYAYILTHPGTP I
Sbjct: 305 FIDNHDTGSTQQIWPFPSDKVMQGYAYILTHPGTPSI 341

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255538306|ref|XP_002510218.1| alpha-amylase, putative [Ricinus communis] gi|223550919|gb|EEF52405.1| alpha-amylase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224063525|ref|XP_002301187.1| predicted protein [Populus trichocarpa] gi|222842913|gb|EEE80460.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|113781|sp|P17859.1|AMYA_VIGMU RecName: Full=Alpha-amylase; AltName: Full=1,4-alpha-D-glucan glucanohydrolase; Flags: Precursor gi|22060|emb|CAA37217.1| unnamed protein product [Vigna mungo] gi|437945|emb|CAA51734.1| alpha-amylase [Vigna mungo] gi|745990|prf||2016476A alpha amylase Back     alignment and taxonomy information
>gi|228404|prf||1803517A alpha amylase Back     alignment and taxonomy information
>gi|30962522|dbj|BAC76729.1| alpha-amylase [Vigna angularis] Back     alignment and taxonomy information
>gi|255538308|ref|XP_002510219.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550920|gb|EEF52406.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388508160|gb|AFK42146.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357437821|ref|XP_003589186.1| Alpha-amylase [Medicago truncatula] gi|355478234|gb|AES59437.1| Alpha-amylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|3769330|dbj|BAA33879.1| alpha-amylase [Phaseolus vulgaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
TAIR|locus:2117398423 AMY1 "alpha-amylase-like" [Ara 0.941 0.796 0.720 3.2e-136
UNIPROTKB|P27933436 AMY1.3 "Alpha-amylase isozyme 0.952 0.782 0.667 4.4e-132
UNIPROTKB|P27939437 AMY1.7 "Alpha-amylase isozyme 0.946 0.775 0.665 1.1e-128
UNIPROTKB|P27937438 AMY1.6 "Alpha-amylase isozyme 0.949 0.776 0.653 1.7e-128
UNIPROTKB|P27934437 AMY1.4 "Alpha-amylase isozyme 0.932 0.764 0.646 5.9e-128
UNIPROTKB|P27932440 AMY1.2 "Alpha-amylase isozyme 0.952 0.775 0.640 7.6e-128
UNIPROTKB|P17654434 AMY1.1 "Alpha-amylase" [Oryza 0.935 0.771 0.643 3.1e-122
TAIR|locus:2196759887 AMY3 "alpha-amylase-like 3" [A 0.888 0.358 0.493 1.8e-85
TAIR|locus:2199808413 AMY2 "alpha-amylase-like 2" [A 0.846 0.733 0.473 4.2e-79
UNIPROTKB|Q2KES2 626 MGCH7_ch7g964 "Putative unchar 0.270 0.154 0.366 4.4e-16
TAIR|locus:2117398 AMY1 "alpha-amylase-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1334 (474.7 bits), Expect = 3.2e-136, P = 3.2e-136
 Identities = 248/344 (72%), Positives = 283/344 (82%)

Query:     1 MSTLKSFCFLSFLLAIFLP-FT-SPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGIT 58
             M++L +  F S L  I  P FT S  LLFQ FNWES  K GG+YNSL NSI D++NAGIT
Sbjct:     1 MTSLHTLLFSSLLFFIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIANAGIT 60

Query:    59 HVWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTA 118
             H+WLPPPSQSVAP+GY+PG+LYDL++SKYGS+A+LKSLI+A  QKGIK LAD+VINHRTA
Sbjct:    61 HLWLPPPSQSVAPEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRTA 120

Query:   119 ERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPR 178
             ERKD +  YC FEGGTSDDRLDW PSF+CR D ++  G GN DTG DF  APDIDHLNPR
Sbjct:   121 ERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFP-GTGNLDTGGDFDGAPDIDHLNPR 179

Query:   179 VQKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDG 238
             VQKELS+WMNWLKTEIGF GWRFD+V+GYA SITK+Y++NTSPDFAVGEKWD + YG DG
Sbjct:   180 VQKELSEWMNWLKTEIGFHGWRFDYVRGYASSITKLYVQNTSPDFAVGEKWDDMKYGGDG 239

Query:   239 KPDANQDGHRGALKDWVQAAGGAV-AAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGI 297
             K D +Q+ HR  LK W++ AGG V  AFDFTTKGILQ+AV+GELWRLKDS GKPPG IGI
Sbjct:   240 KLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKGELWRLKDSQGKPPGMIGI 299

Query:   298 LPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCI 341
             +P NAVTFIDNHDT  T   W FPSDKV+LGY YILTHPGTPCI
Sbjct:   300 MPGNAVTFIDNHDTFRT---WVFPSDKVLLGYVYILTHPGTPCI 340
GO:0003824 "catalytic activity" evidence=IEA
GO:0004556 "alpha-amylase activity" evidence=IEA;ISS;IMP
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM;TAS
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0048046 "apoplast" evidence=IDA
UNIPROTKB|P27933 AMY1.3 "Alpha-amylase isozyme 3D" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27939 AMY1.7 "Alpha-amylase isozyme 3C" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27937 AMY1.6 "Alpha-amylase isozyme 3B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27934 AMY1.4 "Alpha-amylase isozyme 3E" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27932 AMY1.2 "Alpha-amylase isozyme 3A" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P17654 AMY1.1 "Alpha-amylase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2196759 AMY3 "alpha-amylase-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199808 AMY2 "alpha-amylase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KES2 MGCH7_ch7g964 "Putative uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P27933AMY3D_ORYSJ3, ., 2, ., 1, ., 10.70340.88540.7270yesno
Q8VZ56AMY1_ARATH3, ., 2, ., 1, ., 10.72090.94130.7966yesno
P04747AMY3_HORVU3, ., 2, ., 1, ., 10.67900.89940.875N/Ano
P17859AMYA_VIGMU3, ., 2, ., 1, ., 10.80640.94130.8004N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1.10.991
3rd Layer3.2.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
PLN00196428 PLN00196, PLN00196, alpha-amylase; Provisional 0.0
cd11314302 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase 1e-149
PLN02361401 PLN02361, PLN02361, alpha-amylase 1e-122
PLN02784894 PLN02784, PLN02784, alpha-amylase 1e-120
PRK09441479 PRK09441, PRK09441, cytoplasmic alpha-amylase; Rev 3e-50
cd11318391 cd11318, AmyAc_bac_fung_AmyA, Alpha amylase cataly 3e-40
smart00642166 smart00642, Aamy, Alpha-amylase domain 7e-22
pfam00128314 pfam00128, Alpha-amylase, Alpha amylase, catalytic 8e-22
COG0366 505 COG0366, AmyA, Glycosidases [Carbohydrate transpor 1e-17
cd11320389 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase 2e-14
cd11315352 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic 2e-13
cd11340407 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal 4e-13
cd00551260 cd00551, AmyAc_family, Alpha amylase catalytic dom 5e-13
cd11339344 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catal 4e-12
cd11317329 cd11317, AmyAc_bac_euk_AmyA, Alpha amylase catalyt 1e-10
cd11316403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 3e-10
cd11338389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 1e-09
cd11319375 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic d 3e-09
cd11354357 cd11354, AmyAc_bac_CMD_like, Alpha amylase catalyt 7e-09
cd11350390 cd11350, AmyAc_4, Alpha amylase catalytic domain f 1e-08
cd11334447 cd11334, AmyAc_TreS, Alpha amylase catalytic domai 4e-07
cd11328 470 cd11328, AmyAc_maltase, Alpha amylase catalytic do 5e-07
cd11359 456 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom 1e-05
TIGR02403 543 TIGR02403, trehalose_treC, alpha,alpha-phosphotreh 2e-05
TIGR02456 539 TIGR02456, treS_nterm, trehalose synthase 2e-05
COG1523 697 COG1523, PulA, Type II secretory pathway, pullulan 1e-04
cd11313336 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly 3e-04
cd11329477 cd11329, AmyAc_maltase-like, Alpha amylase catalyt 6e-04
PRK10933 551 PRK10933, PRK10933, trehalose-6-phosphate hydrolas 6e-04
cd11326433 cd11326, AmyAc_Glg_debranch, Alpha amylase catalyt 7e-04
PRK14510 1221 PRK14510, PRK14510, putative bifunctional 4-alpha- 9e-04
cd11333428 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca 0.001
cd11337328 cd11337, AmyAc_CMD_like, Alpha amylase catalytic d 0.001
>gnl|CDD|165762 PLN00196, PLN00196, alpha-amylase; Provisional Back     alignment and domain information 
 Score =  520 bits (1341), Expect = 0.0
 Identities = 218/342 (63%), Positives = 258/342 (75%), Gaps = 5/342 (1%)

Query: 5   KSFCFLSFLLAIFLPFTSPA--LLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWL 62
           +    +  L+ + L     A  +LFQGFNWES  + GGWYN L   + D++ AGITHVWL
Sbjct: 4   RRLSMILLLVLLGLSSNLAAGQVLFQGFNWESWKQNGGWYNFLMGKVDDIAAAGITHVWL 63

Query: 63  PPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKD 122
           PPPS SV+ QGYMPGRLYDLDASKYG++A LKSLI+AF  KG++ +AD+VINHRTAE KD
Sbjct: 64  PPPSHSVSEQGYMPGRLYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKD 123

Query: 123 GRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKE 182
           GRGIYC+FEGGT D RLDWGP  ICR D +YSDG GN DTG DF  APDIDHLN RVQ+E
Sbjct: 124 GRGIYCLFEGGTPDSRLDWGPHMICRDDTQYSDGTGNLDTGADFAAAPDIDHLNKRVQRE 183

Query: 183 LSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDA 242
           L  W+ WLK++IGFD WR DF KGY+  + KVY++ T P FAV E W S++YG DGKP+ 
Sbjct: 184 LIGWLLWLKSDIGFDAWRLDFAKGYSAEVAKVYIDGTEPSFAVAEIWTSMAYGGDGKPEY 243

Query: 243 NQDGHRGALKDWVQAAGGAVA---AFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILP 299
           +Q+ HR  L +WV   GGA +    FDFTTKGIL  AV+GELWRL+ ++GK PG IG  P
Sbjct: 244 DQNAHRQELVNWVDRVGGAASPATVFDFTTKGILNVAVEGELWRLRGADGKAPGVIGWWP 303

Query: 300 QNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTPCI 341
             AVTF+DNHDTGSTQ +WPFPSDKVM GYAYILTHPG PCI
Sbjct: 304 AKAVTFVDNHDTGSTQHMWPFPSDKVMQGYAYILTHPGNPCI 345

Length = 428
>gnl|CDD|200453 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase catalytic domain found in archaeal, bacterial, and plant Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|177990 PLN02361, PLN02361, alpha-amylase Back     alignment and domain information
>gnl|CDD|215419 PLN02784, PLN02784, alpha-amylase Back     alignment and domain information
>gnl|CDD|236518 PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>gnl|CDD|200457 cd11318, AmyAc_bac_fung_AmyA, Alpha amylase catalytic domain found in bacterial and fungal Alpha amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain Back     alignment and domain information
>gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain Back     alignment and domain information
>gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200459 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase catalytic domain found in maltogenic amylases, cyclodextrin glycosyltransferase, and related proteins Back     alignment and domain information
>gnl|CDD|200454 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family Back     alignment and domain information
>gnl|CDD|200478 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200456 cd11317, AmyAc_bac_euk_AmyA, Alpha amylase catalytic domain found in bacterial and eukaryotic Alpha amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200458 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic domain found in eukaryotic Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200491 cd11354, AmyAc_bac_CMD_like, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|200488 cd11350, AmyAc_4, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase Back     alignment and domain information
>gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins Back     alignment and domain information
>gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins Back     alignment and domain information
>gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase Back     alignment and domain information
>gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase Back     alignment and domain information
>gnl|CDD|224440 COG1523, PulA, Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase Back     alignment and domain information
>gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|200465 cd11326, AmyAc_Glg_debranch, Alpha amylase catalytic domain found in glycogen debranching enzymes Back     alignment and domain information
>gnl|CDD|237739 PRK14510, PRK14510, putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins Back     alignment and domain information
>gnl|CDD|200476 cd11337, AmyAc_CMD_like, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 358
PLN00196428 alpha-amylase; Provisional 100.0
PLN02361401 alpha-amylase 100.0
PLN02784894 alpha-amylase 100.0
PRK09441479 cytoplasmic alpha-amylase; Reviewed 100.0
PRK10785 598 maltodextrin glucosidase; Provisional 100.0
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 100.0
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 100.0
PRK09505683 malS alpha-amylase; Reviewed 100.0
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 100.0
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 100.0
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 100.0
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 100.0
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 100.0
PRK13840 495 sucrose phosphorylase; Provisional 100.0
PRK03705 658 glycogen debranching enzyme; Provisional 100.0
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 100.0
TIGR03852470 sucrose_gtfA sucrose phosphorylase. In the forward 100.0
PRK12313 633 glycogen branching enzyme; Provisional 100.0
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 100.0
PRK05402 726 glycogen branching enzyme; Provisional 100.0
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 100.0
PRK14706 639 glycogen branching enzyme; Provisional 100.0
COG0366 505 AmyA Glycosidases [Carbohydrate transport and meta 100.0
KOG0471 545 consensus Alpha-amylase [Carbohydrate transport an 100.0
PRK12568 730 glycogen branching enzyme; Provisional 100.0
PLN02960 897 alpha-amylase 100.0
PRK14705 1224 glycogen branching enzyme; Provisional 100.0
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 100.0
TIGR02455 688 TreS_stutzeri trehalose synthase, Pseudomonas stut 100.0
PLN02447 758 1,4-alpha-glucan-branching enzyme 100.0
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 100.0
COG1523 697 PulA Type II secretory pathway, pullulanase PulA a 100.0
PLN02877 970 alpha-amylase/limit dextrinase 100.0
KOG0470 757 consensus 1,4-alpha-glucan branching enzyme/starch 100.0
KOG2212 504 consensus Alpha-amylase [Carbohydrate transport an 99.98
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.97
smart00642166 Aamy Alpha-amylase domain. 99.96
PLN03244 872 alpha-amylase; Provisional 99.96
PRK14511 879 maltooligosyl trehalose synthase; Provisional 99.92
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 99.88
COG3280 889 TreY Maltooligosyl trehalose synthase [Carbohydrat 99.79
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 99.79
PF14872 811 GHL5: Hypothetical glycoside hydrolase 5 99.38
PF14701423 hDGE_amylase: glucanotransferase domain of human g 98.99
PF02324 809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 98.87
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 98.84
PF02324809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 98.83
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 98.61
PRK14508 497 4-alpha-glucanotransferase; Provisional 98.47
COG1649418 Uncharacterized protein conserved in bacteria [Fun 98.28
PLN02635 538 disproportionating enzyme 98.27
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 98.07
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 98.03
KOG3625 1521 consensus Alpha amylase [Carbohydrate transport an 97.93
PF02446 496 Glyco_hydro_77: 4-alpha-glucanotransferase; InterP 97.9
cd06592303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 97.89
PF02065394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 97.83
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 97.51
cd06599317 GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 97.49
cd06597340 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide 97.49
PF13200316 DUF4015: Putative glycosyl hydrolase domain 97.47
PRK14582671 pgaB outer membrane N-deacetylase; Provisional 97.47
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 97.46
cd06594317 GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl 97.26
cd06591319 GH31_xylosidase_XylS XylS is a glycosyl hydrolase 97.17
PF13199 559 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 97.07
cd06600317 GH31_MGAM-like This family includes the following 96.92
PRK10426 635 alpha-glucosidase; Provisional 96.89
TIGR00217 513 malQ 4-alpha-glucanotransferase. This enzyme is kn 96.87
PRK10658665 putative alpha-glucosidase; Provisional 96.74
PRK14511 879 maltooligosyl trehalose synthase; Provisional 96.68
cd06602339 GH31_MGAM_SI_GAA This family includes the followin 96.56
PF14488166 DUF4434: Domain of unknown function (DUF4434) 96.5
cd06598317 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide 96.5
PRK11052 695 malQ 4-alpha-glucanotransferase; Provisional 96.43
cd06604339 GH31_glucosidase_II_MalA Alpha-glucosidase II (alp 96.42
PF01055 441 Glyco_hydro_31: Glycosyl hydrolases family 31 ; In 96.08
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 95.93
cd06562348 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c 95.88
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 95.59
COG1501 772 Alpha-glucosidases, family 31 of glycosyl hydrolas 95.55
cd06595292 GH31_xylosidase_XylS-like This family represents a 95.27
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 95.25
COG1640 520 MalQ 4-alpha-glucanotransferase [Carbohydrate tran 95.23
PLN02950 909 4-alpha-glucanotransferase 94.96
cd06603339 GH31_GANC_GANAB_alpha This family includes the clo 94.87
KOG1065 805 consensus Maltase glucoamylase and related hydrola 94.86
PLN03236 745 4-alpha-glucanotransferase; Provisional 94.73
cd06568329 GH20_SpHex_like A subgroup of the Glycosyl hydrola 94.73
cd06569445 GH20_Sm-chitobiase-like The chitobiase of Serratia 94.67
COG3589360 Uncharacterized conserved protein [Function unknow 94.66
PLN02763 978 hydrolase, hydrolyzing O-glycosyl compounds 94.59
PRK09936296 hypothetical protein; Provisional 94.5
PF05913357 DUF871: Bacterial protein of unknown function (DUF 94.39
cd06563357 GH20_chitobiase-like The chitobiase of Serratia ma 94.2
cd06601332 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) 94.19
cd02742303 GH20_hexosaminidase Beta-N-acetylhexosaminidases o 94.13
cd06564326 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( 94.05
PRK11052 695 malQ 4-alpha-glucanotransferase; Provisional 93.73
cd06565301 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) 93.69
cd06570311 GH20_chitobiase-like_1 A functionally uncharacteri 93.67
TIGR01370315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 93.67
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 93.56
cd02875358 GH18_chitobiase Chitobiase (also known as di-N-ace 93.12
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 93.1
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 92.88
cd06589265 GH31 The enzymes of glycosyl hydrolase family 31 ( 92.34
PF00728351 Glyco_hydro_20: Glycosyl hydrolase family 20, cata 92.1
PF10566273 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: 91.98
PF14883294 GHL13: Hypothetical glycosyl hydrolase family 13 91.81
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 90.7
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 90.44
PF14701423 hDGE_amylase: glucanotransferase domain of human g 90.23
smart00812384 Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydro 90.11
PLN03059 840 beta-galactosidase; Provisional 89.86
KOG3625 1521 consensus Alpha amylase [Carbohydrate transport an 89.82
TIGR03356427 BGL beta-galactosidase. 89.77
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 89.03
COG1306400 Uncharacterized conserved protein [Function unknow 88.82
PLN03236 745 4-alpha-glucanotransferase; Provisional 87.92
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 86.79
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 86.07
PF01120346 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR00 85.71
PLN02950 909 4-alpha-glucanotransferase 85.4
COG2342300 Predicted extracellular endo alpha-1,4 polygalacto 84.12
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 83.15
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 83.11
PRK15447301 putative protease; Provisional 82.59
PRK09856275 fructoselysine 3-epimerase; Provisional 82.57
cd02874313 GH18_CFLE_spore_hydrolase Cortical fragment-lytic 82.42
PRK01060281 endonuclease IV; Provisional 82.13
PRK14581672 hmsF outer membrane N-deacetylase; Provisional 81.73
PRK13210284 putative L-xylulose 5-phosphate 3-epimerase; Revie 81.49
cd06547339 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG 80.9
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 80.51
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9e-72  Score=528.91  Aligned_cols=343  Identities=63%  Similarity=1.191  Sum_probs=294.3

Q ss_pred             hhhhhhhhhh--cCCCCCCceEEEeeecCCCCCCCCchHHHHhhhhhHHHcCCCEEEeCCCCCCCCCCCCCccccCCCCC
Q 018278            7 FCFLSFLLAI--FLPFTSPALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDA   84 (358)
Q Consensus         7 ~~~~~~~~~~--~~~~~~~~v~~q~F~~~~~~~~~G~~~gl~~~L~yl~~LGv~~I~l~Pi~~~~~~~gY~~~d~~~id~   84 (358)
                      .||++|++++  .|....++||+|.|+|++..+.||++++|+++|+||++||||+|||+|++++.++|||++.|||++++
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~v~~Q~F~W~~~~~~gg~~~~i~~kldyL~~LGvtaIWL~P~~~s~s~hGY~~~D~y~ld~   85 (428)
T PLN00196          6 LSMILLLVLLGLSSNLAAGQVLFQGFNWESWKQNGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVSEQGYMPGRLYDLDA   85 (428)
T ss_pred             hHHHHHHHHhccCcccCCCCEEEEeeccCCCCCCCcCHHHHHHHHHHHHHcCCCEEEeCCCCCCCCCCCCCccccCCCCc
Confidence            5555555544  45555789999999999977778999999999999999999999999999999999999999999982


Q ss_pred             CCCCCHHHHHHHHHHHHHcCCEEEEEeecccccccCCCCCcceeeccCCCCCCCCCCCCCcccCCCCccCCCCCCCCCCC
Q 018278           85 SKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGE  164 (358)
Q Consensus        85 ~~~Gt~~d~~~Lv~~~H~~Gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (358)
                      ++|||.+||++||++||++||+||+|+|+||++.++....+.|..|.++.++++.+|.....+.+...|.++.+++..+.
T Consensus        86 ~~fGt~~elk~Lv~~aH~~GIkVilDvV~NH~~~~~~~~~~~y~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~  165 (428)
T PLN00196         86 SKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPHMICRDDTQYSDGTGNLDTGA  165 (428)
T ss_pred             ccCCCHHHHHHHHHHHHHCCCEEEEEECccCcccccccCCCceEECCCCCCCCccccccccCCCCcccccCCCCceeCCC
Confidence            39999999999999999999999999999999988875555677787777777788877666665556666666777888


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHhcCCCeEeeccCCCCCHHHHHHHHHhcCCCeEEEeccCCCCCCCCCCCCCCC
Q 018278          165 DFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQ  244 (358)
Q Consensus       165 ~~~~~~dln~~n~~v~~~l~~~~~~w~~~~gvDGfR~D~a~~i~~~~~~~~~~~~~p~~~~gE~~~~~~~~~~~~~~~~~  244 (358)
                      ++..+||||++||+||++|+++++||++++||||||+|+|+|++.+|+++++++.+|.|+|||.|.+.+|++.+..++++
T Consensus       166 ~~~~lpDLn~~np~V~~~l~~~~~wl~~~~GiDG~RlD~ak~~~~~f~~~~v~~~~p~f~VGE~W~~~~~~~~~~~~~~~  245 (428)
T PLN00196        166 DFAAAPDIDHLNKRVQRELIGWLLWLKSDIGFDAWRLDFAKGYSAEVAKVYIDGTEPSFAVAEIWTSMAYGGDGKPEYDQ  245 (428)
T ss_pred             CCCCCCccCCCCHHHHHHHHHHHHHHhhCCCCCEEEeehhhhCCHHHHHHHHHccCCcEEEEEEeccccccccCCccccc
Confidence            89999999999999999999999999888999999999999999999999999889999999999987666666777776


Q ss_pred             CCchhhHHHHHHhcCCc---eeeeccchHHHHHHHHcCchhhhhhcCCCCCCccCCCCCceeecccCCCCCcCcCCCCCC
Q 018278          245 DGHRGALKDWVQAAGGA---VAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFP  321 (358)
Q Consensus       245 ~~~~~~~~~~~~~~~~~---~~~~df~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~f~~nHD~~r~~~~~~~~  321 (358)
                      +.+++.+.+|+...++.   ..+|||++...+..++.++.+++.+......+.....|..+|+|++|||++|+++.....
T Consensus       246 ~~~r~~l~~~l~~~g~~~~~~~~fDF~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~P~~aVtFvdNHDT~r~~~~~~~~  325 (428)
T PLN00196        246 NAHRQELVNWVDRVGGAASPATVFDFTTKGILNVAVEGELWRLRGADGKAPGVIGWWPAKAVTFVDNHDTGSTQHMWPFP  325 (428)
T ss_pred             hhhHHHHHHHHHhcCCccCcceeecccchHHHHHHhcCCchhhhhhcccCcchhhcChhhceeeccCCCCccccccCCCc
Confidence            66778888999876543   458999998877777777777776665555566777899999999999999999987767


Q ss_pred             cchHHHHHHHHHcCCCeeeeecCccccC
Q 018278          322 SDKVMLGYAYILTHPGTPCIVISVTYPL  349 (358)
Q Consensus       322 ~~~~~~a~a~l~~~pG~P~IyyGdE~G~  349 (358)
                      .++.++|+|++||+||+||||||+-++.
T Consensus       326 ~~~~~lAyA~iLT~pG~P~IyYg~~~~~  353 (428)
T PLN00196        326 SDKVMQGYAYILTHPGNPCIFYDHFFDW  353 (428)
T ss_pred             cchHHHHHHHHHcCCCcceEeeCCCcCc
Confidence            7788999999999999999999998764

>PLN02361 alpha-amylase Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0471 consensus Alpha-amylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>KOG0470 consensus 1,4-alpha-glucan branching enzyme/starch branching enzyme II [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2212 consensus Alpha-amylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>PRK14508 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02635 disproportionating enzyme Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>KOG3625 consensus Alpha amylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02446 Glyco_hydro_77: 4-alpha-glucanotransferase; InterPro: IPR003385 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 Back     alignment and domain information
>cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>PRK14582 pgaB outer membrane N-deacetylase; Provisional Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride Back     alignment and domain information
>cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate Back     alignment and domain information
>PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A Back     alignment and domain information
>cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II Back     alignment and domain information
>PRK10426 alpha-glucosidase; Provisional Back     alignment and domain information
>TIGR00217 malQ 4-alpha-glucanotransferase Back     alignment and domain information
>PRK10658 putative alpha-glucosidase; Provisional Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY Back     alignment and domain information
>PRK11052 malQ 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities Back     alignment and domain information
>PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1640 MalQ 4-alpha-glucanotransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) Back     alignment and domain information
>KOG1065 consensus Maltase glucoamylase and related hydrolases, glycosyl hydrolase family 31 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03236 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) Back     alignment and domain information
>cd06569 GH20_Sm-chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02763 hydrolase, hydrolyzing O-glycosyl compounds Back     alignment and domain information
>PRK09936 hypothetical protein; Provisional Back     alignment and domain information
>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea Back     alignment and domain information
>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end Back     alignment and domain information
>cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins Back     alignment and domain information
>PRK11052 malQ 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins Back     alignment and domain information
>cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>cd06589 GH31 The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase Back     alignment and domain information
>PF00728 Glyco_hydro_20: Glycosyl hydrolase family 20, catalytic domain; InterPro: IPR015883 Glycoside hydrolase family 20 GH20 from CAZY comprises enzymes with several known activities; beta-hexosaminidase (3 Back     alignment and domain information
>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14883 GHL13: Hypothetical glycosyl hydrolase family 13 Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>smart00812 Alpha_L_fucos Alpha-L-fucosidase Back     alignment and domain information
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information
>KOG3625 consensus Alpha amylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>COG1306 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03236 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PF01120 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR000933 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>COG2342 Predicted extracellular endo alpha-1,4 polygalactosaminidase or related polysaccharide hydrolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>PRK15447 putative protease; Provisional Back     alignment and domain information
>PRK09856 fructoselysine 3-epimerase; Provisional Back     alignment and domain information
>cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>PRK14581 hmsF outer membrane N-deacetylase; Provisional Back     alignment and domain information
>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
1ava_A403 Amy2BASI PROTEIN-Protein Complex From Barley Seed L 1e-132
3bsg_A414 Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant 1e-128
1ht6_A405 Crystal Structure At 1.5a Resolution Of The Barley 1e-128
2qps_A405 "sugar Tongs" Mutant Y380a In Complex With Acarbose 1e-128
2qpu_A405 Sugar Tongs Mutant S378p In Complex With Acarbose L 1e-127
1rp8_A405 Crystal Structure Of Barley Alpha-Amylase Isozyme 1 1e-127
3bsh_A414 Barley Alpha-Amylase Isozyme 1 (Amy1) Double Mutant 1e-127
1mwo_A 435 Crystal Structure Analysis Of The Hyperthermostable 1e-25
1gcy_A 527 High Resolution Crystal Structure Of Maltotetraose- 6e-24
2amg_A418 Structure Of Hydrolase (Glycosidase) Length = 418 6e-24
1jda_A429 Maltotetraose-Forming Exo-Amylase Length = 429 1e-23
1qi3_A429 Mutant (D193n) Maltotetraose-Forming Exo-Amylase In 2e-23
1qi5_A429 Mutant (D294n) Maltotetraose-Forming Exo-Amylase In 2e-23
3qgv_A 435 Crystal Structure Of A Thermostable Amylase Variant 2e-23
1qpk_A418 Mutant (D193g) Maltotetraose-Forming Exo-Amylase In 4e-23
1qi4_A429 Mutant (e219g) Maltotetraose-forming Exo-amylase In 5e-23
1ud2_A 480 Crystal Structure Of Calcium-Free Alpha-Amylase Fro 8e-20
1ud3_A 480 Crystal Structure Of Amyk38 N289h Mutant Length = 4 9e-20
2gjp_A 485 Structure Of Bacillus Halmapalus Alpha-Amylase, Cry 5e-19
1w9x_A 481 Bacillus Halmapalus Alpha Amylase Length = 481 6e-19
3bh4_A 483 High Resolution Crystal Structure Of Bacillus Amylo 1e-18
1e3x_A 483 Native Structure Of Chimaeric Amylase From B. Amylo 8e-18
1wp6_A 485 Crystal Structure Of Maltohexaose-producing Amylase 9e-18
3bc9_A 599 Alpha-Amylase B In Complex With Acarbose Length = 5 3e-17
1vjs_A 483 Structure Of Alpha-Amylase Precursor Length = 483 4e-17
2die_A 485 Alkaline Alpha-Amylase Amyk From Bacillus Sp. Ksm-1 4e-17
1bli_A 483 Bacillus Licheniformis Alpha-Amylase Length = 483 2e-16
1ob0_A 483 Kinetic Stabilization Of Bacillus Licheniformis-Amy 2e-16
1hvx_A 515 Bacillus Stearothermophilus Alpha-Amylase Length = 8e-16
1lwh_A 441 Crystal Structure Of T. Maritima 4-Alpha-Glucanotra 2e-11
1sma_A 588 Crystal Structure Of A Maltogenic Amylase Length = 2e-10
1j0h_A 588 Crystal Structure Of Bacillus Stearothermophilus Ne 2e-10
1j0j_A 588 Crystal Structure Of Neopullulanase E357q Complex W 4e-10
1gvi_A 588 Thermus Maltogenic Amylase In Complex With Beta-Cd 1e-09
2guy_A 478 Orthorhombic Crystal Structure (Space Group P21212) 2e-09
2taa_A 478 Structure And Possible Catalytic Residues Of Taka-A 3e-09
1bpl_A189 Glycosyltransferase Length = 189 1e-08
1qho_A 686 Five-Domain Alpha-Amylase From Bacillus Stearotherm 3e-08
1pj9_A 686 Bacillus Circulans Strain 251 Loop Mutant 183-195 L 3e-08
1pez_A 686 Bacillus Circulans Strain 251 Mutant A230v Length = 3e-08
1tcm_A 686 Cyclodextrin Glycosyltransferase W616a Mutant From 5e-08
1cdg_A 686 Nucleotide Sequence And X-Ray Structure Of Cyclodex 6e-08
1cgw_A 686 Site Directed Mutations Of The Active Site Residue 6e-08
1cgx_A 686 Site Directed Mutations Of The Active Site Residue 7e-08
1ea9_C 583 Cyclomaltodextrinase Length = 583 8e-08
1cgv_A 686 Site Directed Mutations Of The Active Site Residue 1e-07
1kck_A 686 Bacillus Circulans Strain 251 Cyclodextrin Glycosyl 1e-07
1cgy_A 686 Site Directed Mutations Of The Active Site Residue 1e-07
1wza_A 488 Crystal Structure Of Alpha-Amylase From H.Orenii Le 1e-07
1dtu_A 686 Bacillus Circulans Strain 251 Cyclodextrin Glycosyl 1e-07
1cxl_A 686 Complex Between A Covalent Intermediate And Bacillu 1e-07
1bpl_B 294 Glycosyltransferase Length = 294 1e-07
1ot2_A 686 Bacillus Circulans Strain 251 Cyclodextrin Glycosyl 2e-07
4cgt_A 678 Deletion Mutant Delta(145-150), F151d Of Cyclodextr 2e-07
1cyg_A 680 Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgt 3e-07
1v3k_A 686 Crystal Structure Of F283y Mutant Cyclodextrin Glyc 3e-07
1cxk_A 686 Complex Between A Maltononaose Substrate And Bacill 4e-07
1d7f_A 686 Crystal Structure Of Asparagine 233-Replaced Cyclod 4e-07
1ot1_A 686 Bacillus Circulans Strain 251 Cyclodextrin Glycosyl 4e-07
1kcl_A 686 Bacillus Ciruclans Strain 251 Cyclodextrin Glycosyl 4e-07
1pam_A 686 Cyclodextrin Glucanotransferase Length = 686 5e-07
1v3j_A 686 Crystal Structure Of F283l Mutant Cyclodextrin Glyc 5e-07
1ukt_A 686 Crystal Structure Of Y100l Mutant Cyclodextrin Gluc 2e-06
1eo5_A 686 Bacillus Circulans Strain 251 Cyclodextrin Glycosyl 2e-06
1uks_A 686 Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN 2e-06
1cgt_A 684 Structure Of Cyclodextrin Glycosyltransferase Refin 4e-06
6cgt_A 684 Hoxa Complex Of Cyclodextrin Glycosyltransferase Mu 5e-06
2wc7_A 488 Crystal Structure Of Nostoc Punctiforme Debranching 8e-06
3gbd_A 558 Crystal Structure Of The Isomaltulose Synthase Smua 1e-05
8cgt_A 684 Structure Of Cyclodextrin Glycosyltransferase Compl 2e-05
2aaa_A 484 Calcium Binding In Alpha-Amylases: An X-Ray Diffrac 3e-05
1cgu_A 684 Catalytic Center Of Cyclodextrin Glycosyltransferas 3e-05
1m53_A 570 Crystal Structure Of Isomaltulose Synthase (Pali) F 4e-05
3dc0_A422 Crystal Structure Of Native Alpha-Amylase From Baci 1e-04
1jf5_A585 Crystal Structure Of Thermoactinomyces Vulgaris R-4 1e-04
4h2c_A 557 Trehalulose Synthase Mutb R284c Mutant Length = 557 1e-04
4gi6_A 557 Crystal Structure Of The Mutb F164l Mutant In Compl 1e-04
2pwe_A 556 Crystal Structure Of The Mutb E254q Mutant In Compl 1e-04
2pwg_A 556 Crystal Structure Of The Trehalulose Synthase Mutb 1e-04
1zja_A 557 Crystal Structure Of The Trehalulose Synthase Mutb 1e-04
4gin_A 584 Crystal Structure Of The Mutb R284c Mutant From Cry 1e-04
1uok_A 558 Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas 1e-04
1wzl_A585 Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T 2e-04
1wzm_A585 Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (t 2e-04
1wzk_A585 Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (T 2e-04
1bvz_A585 Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vul 3e-04
1jf6_A585 Crystal Structure Of Thermoactinomyces Vulgaris R-4 3e-04
2z1k_A 475 Crystal Structure Of Ttha1563 From Thermus Thermoph 3e-04
4aie_A 549 Structure Of Glucan-1,6-Alpha-Glucosidase From Lact 3e-04
2zid_A 543 Crystal Structure Of Dextran Glucosidase E236q Comp 4e-04
2zic_A 543 Crystal Structure Of Streptococcus Mutans Dextran G 4e-04
2wan_A 921 Pullulanase From Bacillus Acidopullulyticus Length 5e-04
2vnc_A 718 Crystal Structure Of Glycogen Debranching Enzyme Tr 7e-04
2ze0_A 555 Alpha-glucosidase Gsj Length = 555 7e-04
1bf2_A 750 Structure Of Pseudomonas Isoamylase Length = 750 7e-04
4gkl_A 422 Crystal Structure Of A Noncanonic Maltogenic Alpha- 7e-04
1ua7_A422 Crystal Structure Analysis Of Alpha-Amylase From Ba 7e-04
1bag_A425 Alpha-Amylase From Bacillus Subtilis Complexed With 7e-04
1vfm_A585 Crystal Structure Of Thermoactinomyces Vulgaris R-4 8e-04
1jl8_A585 Complex Of Alpha-Amylase Ii (Tva Ii) From Thermoact 8e-04
2pwf_A 556 Crystal Structure Of The Mutb D200a Mutant In Compl 9e-04
>pdb|1AVA|A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed Length = 403 Back     alignment and structure 
Iteration: 1

 Score =  466 bits (1200), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 220/319 (68%), Positives = 250/319 (78%), Gaps = 2/319 (0%)
Query: 25  LLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDA 84
           +LFQGFNWES    GGWYN L   + D++ AGITHVWLPP SQSVA QGYMPGRLYDLDA
Sbjct: 2   VLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLDA 61
Query: 85  SKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPS 144
           SKYG++A LKSLI A   KG+K +AD+VINHRTAE KDGRGIYCIFEGGT D RLDWGP 
Sbjct: 62  SKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGPH 121
Query: 145 FICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFV 204
            ICR D+ Y+DG GN DTG DF  APDIDHLN RVQKEL +W+NWLK +IGFDGWRFDF 
Sbjct: 122 MICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDFA 181
Query: 205 KGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGGA--V 262
           KGY+  + K+Y++ + P FAV E W SL+YG DGKP+ NQD HR  L +WV   GG    
Sbjct: 182 KGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGPA 241
Query: 263 AAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPS 322
             FDFTTKGIL  AV+GELWRL+ ++GK PG IG  P  AVTF+DNHDTGSTQ +WPFPS
Sbjct: 242 TTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQHMWPFPS 301
Query: 323 DKVMLGYAYILTHPGTPCI 341
           D+VM GYAYILTHPGTPCI
Sbjct: 302 DRVMQGYAYILTHPGTPCI 320
>pdb|3BSG|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant Length = 414 Back     alignment and structure
>pdb|1HT6|A Chain A, Crystal Structure At 1.5a Resolution Of The Barley Alpha- Amylase Isozyme 1 Length = 405 Back     alignment and structure
>pdb|2QPS|A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarbose Length = 405 Back     alignment and structure
>pdb|2QPU|A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose Length = 405 Back     alignment and structure
>pdb|1RP8|A Chain A, Crystal Structure Of Barley Alpha-Amylase Isozyme 1 (Amy1) Inactive Mutant D180a In Complex With Maltoheptaose Length = 405 Back     alignment and structure
>pdb|3BSH|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) Double Mutant Y105aY380A IN COMPLEX WITH INHIBITOR ACARBOSE Length = 414 Back     alignment and structure
>pdb|1MWO|A Chain A, Crystal Structure Analysis Of The Hyperthermostable Pyrocoocus Woesei Alpha-Amylase Length = 435 Back     alignment and structure
>pdb|1GCY|A Chain A, High Resolution Crystal Structure Of Maltotetraose-Forming Exo-Amylase Length = 527 Back     alignment and structure
>pdb|2AMG|A Chain A, Structure Of Hydrolase (Glycosidase) Length = 418 Back     alignment and structure
>pdb|1JDA|A Chain A, Maltotetraose-Forming Exo-Amylase Length = 429 Back     alignment and structure
>pdb|1QI3|A Chain A, Mutant (D193n) Maltotetraose-Forming Exo-Amylase In Complex With Maltotetraose Length = 429 Back     alignment and structure
>pdb|1QI5|A Chain A, Mutant (D294n) Maltotetraose-Forming Exo-Amylase In Complex With Maltotetraose Length = 429 Back     alignment and structure
>pdb|3QGV|A Chain A, Crystal Structure Of A Thermostable Amylase Variant Length = 435 Back     alignment and structure
>pdb|1QPK|A Chain A, Mutant (D193g) Maltotetraose-Forming Exo-Amylase In Complex With Maltotetraose Length = 418 Back     alignment and structure
>pdb|1QI4|A Chain A, Mutant (e219g) Maltotetraose-forming Exo-amylase In Complex With Maltotetraose Length = 429 Back     alignment and structure
>pdb|1UD2|A Chain A, Crystal Structure Of Calcium-Free Alpha-Amylase From Bacillus Sp. Strain Ksm-K38 (Amyk38) Length = 480 Back     alignment and structure
>pdb|1UD3|A Chain A, Crystal Structure Of Amyk38 N289h Mutant Length = 480 Back     alignment and structure
>pdb|2GJP|A Chain A, Structure Of Bacillus Halmapalus Alpha-Amylase, Crystallized With The Substrate Analogue Acarbose And Maltose Length = 485 Back     alignment and structure
>pdb|1W9X|A Chain A, Bacillus Halmapalus Alpha Amylase Length = 481 Back     alignment and structure
>pdb|3BH4|A Chain A, High Resolution Crystal Structure Of Bacillus Amyloliquefaciens Alpha-Amylase Length = 483 Back     alignment and structure
>pdb|1E3X|A Chain A, Native Structure Of Chimaeric Amylase From B. Amyloliquefaciens And B. Licheniformis At 1.92a Length = 483 Back     alignment and structure
>pdb|1WP6|A Chain A, Crystal Structure Of Maltohexaose-producing Amylase From Alkalophilic Bacillus Sp.707. Length = 485 Back     alignment and structure
>pdb|3BC9|A Chain A, Alpha-Amylase B In Complex With Acarbose Length = 599 Back     alignment and structure
>pdb|1VJS|A Chain A, Structure Of Alpha-Amylase Precursor Length = 483 Back     alignment and structure
>pdb|2DIE|A Chain A, Alkaline Alpha-Amylase Amyk From Bacillus Sp. Ksm-1378 Length = 485 Back     alignment and structure
>pdb|1BLI|A Chain A, Bacillus Licheniformis Alpha-Amylase Length = 483 Back     alignment and structure
>pdb|1OB0|A Chain A, Kinetic Stabilization Of Bacillus Licheniformis-Amylase Through Introduction Of Hydrophobic Residues At The Surface Length = 483 Back     alignment and structure
>pdb|1HVX|A Chain A, Bacillus Stearothermophilus Alpha-Amylase Length = 515 Back     alignment and structure
>pdb|1LWH|A Chain A, Crystal Structure Of T. Maritima 4-Alpha-Glucanotransferase Length = 441 Back     alignment and structure
>pdb|1SMA|A Chain A, Crystal Structure Of A Maltogenic Amylase Length = 588 Back     alignment and structure
>pdb|1J0H|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Neopullulanase Length = 588 Back     alignment and structure
>pdb|1J0J|A Chain A, Crystal Structure Of Neopullulanase E357q Complex With Maltotetraose Length = 588 Back     alignment and structure
>pdb|1GVI|A Chain A, Thermus Maltogenic Amylase In Complex With Beta-Cd Length = 588 Back     alignment and structure
>pdb|2GUY|A Chain A, Orthorhombic Crystal Structure (Space Group P21212) Of Aspergillus Niger Alpha-Amylase At 1.6 A Resolution Length = 478 Back     alignment and structure
>pdb|2TAA|A Chain A, Structure And Possible Catalytic Residues Of Taka-Amylase A Length = 478 Back     alignment and structure
>pdb|1BPL|A Chain A, Glycosyltransferase Length = 189 Back     alignment and structure
>pdb|1QHO|A Chain A, Five-Domain Alpha-Amylase From Bacillus Stearothermophilus, MaltoseACARBOSE COMPLEX Length = 686 Back     alignment and structure
>pdb|1PJ9|A Chain A, Bacillus Circulans Strain 251 Loop Mutant 183-195 Length = 686 Back     alignment and structure
>pdb|1PEZ|A Chain A, Bacillus Circulans Strain 251 Mutant A230v Length = 686 Back     alignment and structure
>pdb|1TCM|A Chain A, Cyclodextrin Glycosyltransferase W616a Mutant From Bacillus Circulans Strain 251 Length = 686 Back     alignment and structure
>pdb|1CDG|A Chain A, Nucleotide Sequence And X-Ray Structure Of Cyclodextrin Glycosyltransferase From Bacillus Circulans Strain 251 In A Maltose-Dependent Crystal Form Length = 686 Back     alignment and structure
>pdb|1CGW|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glycosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 Back     alignment and structure
>pdb|1CGX|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glyxosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 Back     alignment and structure
>pdb|1EA9|C Chain C, Cyclomaltodextrinase Length = 583 Back     alignment and structure
>pdb|1CGV|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glycosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 Back     alignment and structure
>pdb|1KCK|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyl Transferase Mutant N193g Length = 686 Back     alignment and structure
>pdb|1CGY|A Chain A, Site Directed Mutations Of The Active Site Residue Tyrosine 195 Of Cyclodextrin Glyxosyltransferase From Bacillus Circulans Strain 251 Affecting Activity And Product Specificity Length = 686 Back     alignment and structure
>pdb|1WZA|A Chain A, Crystal Structure Of Alpha-Amylase From H.Orenii Length = 488 Back     alignment and structure
>pdb|1DTU|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyltransferase: A Mutant Y89dS146P COMPLEXED TO AN Hexasaccharide Inhibitor Length = 686 Back     alignment and structure
>pdb|1CXL|A Chain A, Complex Between A Covalent Intermediate And Bacillus Circulans Strain 251 Cgtase E257q Length = 686 Back     alignment and structure
>pdb|1BPL|B Chain B, Glycosyltransferase Length = 294 Back     alignment and structure
>pdb|1OT2|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyl Transferase Mutant D135n Length = 686 Back     alignment and structure
>pdb|4CGT|A Chain A, Deletion Mutant Delta(145-150), F151d Of Cyclodextrin Glycosyltransferase Length = 678 Back     alignment and structure
>pdb|1CYG|A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase) Length = 680 Back     alignment and structure
>pdb|1V3K|A Chain A, Crystal Structure Of F283y Mutant Cyclodextrin Glycosyltransferase Length = 686 Back     alignment and structure
>pdb|1CXK|A Chain A, Complex Between A Maltononaose Substrate And Bacillus Circulans Strain 251 Cgtase E257qD229N Length = 686 Back     alignment and structure
>pdb|1D7F|A Chain A, Crystal Structure Of Asparagine 233-Replaced Cyclodextrin Glucanotransferase From Alkalophilic Bacillus Sp. 1011 Determined At 1.9 A Resolution Length = 686 Back     alignment and structure
>pdb|1OT1|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyl Transferase Mutant D135a Length = 686 Back     alignment and structure
>pdb|1KCL|A Chain A, Bacillus Ciruclans Strain 251 Cyclodextrin Glycosyl Transferase Mutant G179l Length = 686 Back     alignment and structure
>pdb|1PAM|A Chain A, Cyclodextrin Glucanotransferase Length = 686 Back     alignment and structure
>pdb|1V3J|A Chain A, Crystal Structure Of F283l Mutant Cyclodextrin Glycosyltransferase Length = 686 Back     alignment and structure
>pdb|1UKT|A Chain A, Crystal Structure Of Y100l Mutant Cyclodextrin Glucanotransferase Compexed With An Acarbose Length = 686 Back     alignment and structure
>pdb|1EO5|A Chain A, Bacillus Circulans Strain 251 Cyclodextrin Glycosyltransferase In Complex With Maltoheptaose Length = 686 Back     alignment and structure
>pdb|1UKS|A Chain A, Crystal Structure Of F183lF259L MUTANT CYCLODEXTRIN Glucanotransferase Complexed With A Pseudo-Maltotetraose Derived From Acarbose Length = 686 Back     alignment and structure
>pdb|1CGT|A Chain A, Structure Of Cyclodextrin Glycosyltransferase Refined At 2.0 Angstroms Resolution Length = 684 Back     alignment and structure
>pdb|6CGT|A Chain A, Hoxa Complex Of Cyclodextrin Glycosyltransferase Mutant Length = 684 Back     alignment and structure
>pdb|2WC7|A Chain A, Crystal Structure Of Nostoc Punctiforme Debranching Enzyme( Npde)(Acarbose Soaked) Length = 488 Back     alignment and structure
>pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 Back     alignment and structure
>pdb|8CGT|A Chain A, Structure Of Cyclodextrin Glycosyltransferase Complexed With A Thio-Maltohexaose Length = 684 Back     alignment and structure
>pdb|2AAA|A Chain A, Calcium Binding In Alpha-Amylases: An X-Ray Diffraction Study At 2.1 Angstroms Resolution Of Two Enzymes From Aspergillus Length = 484 Back     alignment and structure
>pdb|1CGU|A Chain A, Catalytic Center Of Cyclodextrin Glycosyltransferase Derived From X-Ray Structure Analysis Combined With Site- Directed Mutagenesis Length = 684 Back     alignment and structure
>pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 Back     alignment and structure
>pdb|3DC0|A Chain A, Crystal Structure Of Native Alpha-Amylase From Bacillus Sp. Kr-8104 Length = 422 Back     alignment and structure
>pdb|1JF5|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 2 Mutant F286a Length = 585 Back     alignment and structure
>pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 Back     alignment and structure
>pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 Back     alignment and structure
>pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 Back     alignment and structure
>pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 Back     alignment and structure
>pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 Back     alignment and structure
>pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 Back     alignment and structure
>pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 Back     alignment and structure
>pdb|1WZL|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt R469l Length = 585 Back     alignment and structure
>pdb|1WZM|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-amylase Ii (tva Ii) Mutatnt R469k Length = 585 Back     alignment and structure
>pdb|1WZK|A Chain A, Thermoactinomyces Vulgaris R-47 Alpha-Amylase Ii (Tva Ii) Mutatnt D465n Length = 585 Back     alignment and structure
>pdb|1BVZ|A Chain A, Alpha-Amylase Ii (Tvaii) From Thermoactinomyces Vulgaris R- 47 Length = 585 Back     alignment and structure
>pdb|1JF6|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase Mutant F286y Length = 585 Back     alignment and structure
>pdb|2Z1K|A Chain A, Crystal Structure Of Ttha1563 From Thermus Thermophilus Hb8 Length = 475 Back     alignment and structure
>pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 Back     alignment and structure
>pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 Back     alignment and structure
>pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 Back     alignment and structure
>pdb|2WAN|A Chain A, Pullulanase From Bacillus Acidopullulyticus Length = 921 Back     alignment and structure
>pdb|2VNC|A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus Length = 718 Back     alignment and structure
>pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 Back     alignment and structure
>pdb|1BF2|A Chain A, Structure Of Pseudomonas Isoamylase Length = 750 Back     alignment and structure
>pdb|4GKL|A Chain A, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase Amyb From Thermotoga Neapolitana Length = 422 Back     alignment and structure
>pdb|1UA7|A Chain A, Crystal Structure Analysis Of Alpha-Amylase From Bacillus Subtilis Complexed With Acarbose Length = 422 Back     alignment and structure
>pdb|1BAG|A Chain A, Alpha-Amylase From Bacillus Subtilis Complexed With Maltopentaose Length = 425 Back     alignment and structure
>pdb|1VFM|A Chain A, Crystal Structure Of Thermoactinomyces Vulgaris R-47 Alpha- Amylase 2ALPHA-Cyclodextrin Complex Length = 585 Back     alignment and structure
>pdb|1JL8|A Chain A, Complex Of Alpha-Amylase Ii (Tva Ii) From Thermoactinomyces Vulgaris R-47 With Beta-Cyclodextrin Based On A Co- Crystallization With Methyl Beta-Cyclodextrin Length = 585 Back     alignment and structure
>pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 1e-136
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 2e-89
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 1e-85
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 6e-84
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 9e-80
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 4e-78
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 2e-76
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 2e-63
1hx0_A 496 Alpha amylase (PPA); inhibitor, carbohydrate, panc 4e-39
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 7e-32
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 3e-26
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 2e-29
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 5e-29
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 9e-29
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 8e-28
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 2e-27
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 3e-27
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 2e-26
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 3e-26
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 3e-25
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 5e-24
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 2e-23
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 5e-23
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 2e-08
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 1e-22
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 1e-21
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 4e-20
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 4e-20
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 2e-19
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 4e-19
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 5e-19
3klk_A1039 Glucansucrase; native form, open conformation, mul 1e-13
3klk_A 1039 Glucansucrase; native form, open conformation, mul 6e-11
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 5e-11
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 2e-10
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 3e-09
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 3e-09
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 6e-09
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 2e-07
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 2e-06
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 3e-06
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 1e-05
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 1e-04
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 2e-04
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 2e-04
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 2e-04
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 2e-04
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 3e-04
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 5e-04
2dh2_A424 4F2 cell-surface antigen heavy chain; TIM-barrel, 6e-04
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 6e-04
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 Back     alignment and structure
 Score =  392 bits (1009), Expect = e-136
 Identities = 208/320 (65%), Positives = 248/320 (77%), Gaps = 3/320 (0%)

Query: 25  LLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDA 84
           +LFQGFNWES  ++GGWYN +   + D++ AG+THVWLPPPS SV+ +GYMPGRLYD+DA
Sbjct: 3   VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA 62

Query: 85  SKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPS 144
           SKYG+ A+LKSLI A   KG++ +AD+VINHR A+ KD RGIYCIFEGGTSD RLDWGP 
Sbjct: 63  SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH 122

Query: 145 FICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFV 204
            ICR D +YSDG  N DTG DF  APDIDHLN RVQ+EL +W+ WLK+++GFD WR DF 
Sbjct: 123 MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA 182

Query: 205 KGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGG---A 261
           +GY+P + KVY++ TSP  AV E WD+++ G DGKP+ +QD HR  L +WV   GG   A
Sbjct: 183 RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA 242

Query: 262 VAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFP 321
              FDFTTKGIL AAV+GELWRL D  GK PG +G  P  AVTF+DNHDTGSTQ +WPFP
Sbjct: 243 GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP 302

Query: 322 SDKVMLGYAYILTHPGTPCI 341
           SDKVM GYAYILTHPG PCI
Sbjct: 303 SDKVMQGYAYILTHPGIPCI 322
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>1hx0_A Alpha amylase (PPA); inhibitor, carbohydrate, pancreas, hydrolase; HET: GLC AC1 BGC MAL; 1.38A {Sus scrofa} SCOP: b.71.1.1 c.1.8.1 PDB: 1wo2_A* 1ua3_A* 1kxq_A 1kxt_A 1kxv_A 1jfh_A* 1vah_A* 1ppi_A* 3l2m_A* 3l2l_A* 1dhk_A* 1ose_A* 1pig_A* 1pif_A* 1bvn_P 3oli_A* 3old_A* 3olg_A* 3ole_A* 3ij8_A* ... Length = 496 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Length = 448 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Length = 471 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* Length = 1039 Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* Length = 1039 Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Length = 704 Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Length = 720 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 100.0
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 100.0
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 100.0
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 100.0
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 100.0
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 100.0
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 100.0
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 100.0
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 100.0
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 100.0
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 100.0
4aef_A645 Neopullulanase (alpha-amylase II); hydrolase, ther 100.0
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 100.0
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 100.0
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 100.0
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 100.0
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 100.0
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 100.0
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 100.0
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 100.0
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 100.0
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 100.0
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 100.0
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 100.0
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 100.0
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 100.0
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 100.0
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 100.0
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 100.0
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 100.0
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 100.0
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 100.0
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 100.0
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 100.0
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 100.0
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 100.0
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 100.0
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 100.0
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 100.0
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 100.0
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 100.0
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 100.0
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 100.0
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 100.0
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 100.0
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 100.0
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 100.0
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 100.0
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 100.0
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 100.0
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 100.0
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 100.0
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 100.0
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 100.0
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 100.0
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 100.0
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 100.0
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 100.0
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 100.0
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 100.0
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 100.0
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 100.0
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 100.0
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.95
3klk_A 1039 Glucansucrase; native form, open conformation, mul 99.93
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.9
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.89
3klk_A1039 Glucansucrase; native form, open conformation, mul 99.88
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.59
3mi6_A 745 Alpha-galactosidase; NESG, structural genomics, PS 98.6
2yfo_A720 Alpha-galactosidase-sucrose kinase agask; hydrolas 98.52
2xn2_A732 Alpha-galactosidase; hydrolase, glycosidase; HET: 98.25
1tz7_A 505 4-alpha-glucanotransferase; (beta, alpha)8- barrel 98.1
1zy9_A564 Alpha-galactosidase; TM1192, struc genomics, joint 98.06
1esw_A 500 Amylomaltase; (beta,alpha)8-barrel, glucanotransfe 98.01
1x1n_A 524 4-alpha-glucanotransferase; disproportionating enz 97.91
4fnq_A729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 97.69
2f2h_A 773 Putative family 31 glucosidase YICI; BETA8alpha8 b 97.49
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 97.49
3vmn_A 643 Dextranase; TIM barrel, immunoglobrin fold, greek- 97.43
4ba0_A 817 Alpha-glucosidase, putative, ADG31B; hydrolase; HE 97.13
3lpp_A 898 Sucrase-isomaltase; glycoside hydrolase family 31, 97.1
2g3m_A 693 Maltase, alpha-glucosidase; hydrolase, glycoside h 97.02
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 96.68
3l4y_A 875 Maltase-glucoamylase, intestinal; glycoside hydrol 96.67
3cc1_A433 BH1870 protein, putative alpha-N-acetylgalactosami 96.59
3nsx_A 666 Alpha-glucosidase; structural genomics, PSI-2, pro 96.49
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 96.17
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 96.16
2xvl_A 1020 Alpha-xylosidase, putative, XYL31A; hydrolase, gly 96.16
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 96.15
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 96.13
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 95.56
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 95.27
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 95.19
1x7f_A385 Outer surface protein; structural genomics, unknow 95.14
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 95.05
2p0o_A372 Hypothetical protein DUF871; structural genomics, 95.01
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 94.86
3gyc_A393 Putative glycoside hydrolase; YP_001304622.1, stru 94.77
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 94.66
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 94.64
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 94.61
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 94.45
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 94.44
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 94.28
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 94.26
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 94.25
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 94.15
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 94.1
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 94.02
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 93.95
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 93.89
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 93.88
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 93.87
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 93.83
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 93.72
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 93.69
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 93.47
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 93.45
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 93.4
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 93.17
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 93.11
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 93.04
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 92.94
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 92.92
3a24_A641 Alpha-galactosidase; glycoside hydrolase family 97 92.73
2aam_A309 Hypothetical protein TM1410; structural genomics, 92.51
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 92.45
1uas_A362 Alpha-galactosidase; TIM-barrel, beta-alpha-barrel 92.45
2ki0_A36 DS119; beta-alpha-beta, de novo protein; NMR {Synt 92.38
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 92.19
3ozo_A572 N-acetylglucosaminidase; beta-N-acetyl-D-hexosamin 92.12
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 92.09
3a21_A 614 Putative secreted alpha-galactosidase; beta-alpha- 92.05
2osx_A 481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 91.82
3a5v_A397 Alpha-galactosidase; beta/alpha barrel, N-glycosyl 91.58
2x2h_A 1027 Alpha-1,4-glucan lyase isozyme 1; anhydrofructose 91.58
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 91.57
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 91.56
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 91.56
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 91.46
4f9d_A618 Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; 91.27
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 91.07
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 90.8
2d73_A738 Alpha-glucosidase SUSB; glycoside hydrolase family 90.8
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 89.99
1szn_A417 Alpha-galactosidase; (beta/alpha)8 barrel,TWO doma 89.8
1jak_A512 Beta-N-acetylhexosaminidase; glycoside hydrolase, 89.7
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 89.44
2gjx_A507 Beta-hexosaminidase alpha chain; beta-hexosaminida 89.25
3eyp_A 469 Putative alpha-L-fucosidase; structural genomics, 89.13
2zxd_A455 Alpha-L-fucosidase, putative; TIM barrel, hydrolas 89.03
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 88.97
3rcn_A543 Beta-N-acetylhexosaminidase; structural genomics, 87.68
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 87.58
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 87.32
3ues_A 478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 87.14
3cz8_A319 Putative sporulation-specific glycosylase YDHD; st 86.71
2wvv_A450 Alpha-L-fucosidase; alpha-L-fucose, hydrolase, gly 86.0
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 85.8
1now_A507 Beta-hexosaminidase beta chain; (beta/alpha)8-barr 85.53
2cho_A 716 Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro 85.01
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 85.0
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 84.92
3gh5_A525 HEX1, beta-hexosaminidase; beta-N-acetylhexosamini 84.63
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 84.21
3top_A 908 Maltase-glucoamylase, intestinal; membrane, hydrol 84.16
4h41_A340 Putative alpha-L-fucosidase; hydrolase, carbohydra 83.67
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 83.58
3kzs_A463 Glycosyl hydrolase family 5; structural genomics, 83.46
1yht_A367 DSPB; beta barrel, hydrolase; 2.00A {Aggregatibact 82.31
3d3a_A 612 Beta-galactosidase; protein structure initiative I 82.22
3obe_A305 Sugar phosphate isomerase/epimerase; structural ge 81.97
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 80.21
3gza_A 443 Putative alpha-L-fucosidase; NP_812709.1, structur 80.13
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
Probab=100.00  E-value=4.8e-70  Score=521.72  Aligned_cols=326  Identities=64%  Similarity=1.210  Sum_probs=274.8

Q ss_pred             CceEEEeeecCCCCCCCCchHHHHhhhhhHHHcCCCEEEeCCCCCCCCCCCCCccccCCCCCCCCCCHHHHHHHHHHHHH
Q 018278           23 PALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDASKYGSQADLKSLIQAFRQ  102 (358)
Q Consensus        23 ~~v~~q~F~~~~~~~~~G~~~gl~~~L~yl~~LGv~~I~l~Pi~~~~~~~gY~~~d~~~id~~~~Gt~~d~~~Lv~~~H~  102 (358)
                      ++|++|+|+||++++++|||+||+++|+|||+||||+|||+||++++++|||+|.||++||+|+|||++||++||++||+
T Consensus         1 ~~v~~~~F~~d~~~d~~G~~~gi~~~ldyl~~lGv~~i~l~Pi~~~~~~~gY~~~d~~~id~~~~Gt~~d~~~lv~~~h~   80 (405)
T 1ht6_A            1 HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHG   80 (405)
T ss_dssp             CCCEEECCCTTGGGCTTCHHHHHHTTHHHHHHTTCCEEEECCCSCBSSTTSSSBCCTTCGGGCTTCCHHHHHHHHHHHHH
T ss_pred             CccEEEeEEcCCCCCCCcCHHHHHHHHHHHHHcCCCEEEeCCCccCCCCCCCCccccccCCCccCCCHHHHHHHHHHHHH
Confidence            47999999999999999999999999999999999999999999999999999999999988999999999999999999


Q ss_pred             cCCEEEEEeecccccccCCCCCcceeeccCCCCCCCCCCCCCcccCCCCccCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q 018278          103 KGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKE  182 (358)
Q Consensus       103 ~Gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dln~~n~~v~~~  182 (358)
                      +||+||+|+|+||++.+|+.+.+.|+.|.+..+..+.+|.....+.+...|.++.+++..++++..+||||++||+||++
T Consensus        81 ~Gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dln~~~p~v~~~  160 (405)
T 1ht6_A           81 KGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRE  160 (405)
T ss_dssp             TTCEEEEEECCSBCCCSEECTTSCEEECCCSSSSSTTCCCGGGBCTTCTTTCCSCSCCCSSCCCTTSCBBCTTCHHHHHH
T ss_pred             CCCEEEEEECcCcccCCCCCCCCCcccCCCCCcCCCCCCCCccccCCCCCcCCCCCcccCCCCcCcCCccCcCCHHHHHH
Confidence            99999999999999999876677788888766666677876544544456666666777788999999999999999999


Q ss_pred             HHHHHHHHHHhcCCCeEeeccCCCCCHHHHHHHHHhcCCCeEEEeccCCCCCCCCCCCCCCCCCchhhHHHHHHhcCC--
Q 018278          183 LSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGG--  260 (358)
Q Consensus       183 l~~~~~~w~~~~gvDGfR~D~a~~i~~~~~~~~~~~~~p~~~~gE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  260 (358)
                      |++++++|++++||||||+|+|++++.+||++++++.+|.+++||+|...++.+.+.++|+...+.+.+..|+...++  
T Consensus       161 i~~~~~~w~~~~gvDGfR~D~~~~~~~~f~~~~~~~~~p~~~igE~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~g~~~  240 (405)
T 1ht6_A          161 LKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAA  240 (405)
T ss_dssp             HHHHHHHHHHHHCCCEEEETTGGGSCHHHHHHHHHHHCCSCEEECCCCCCCBCTTSSBCSCCHHHHHHHHHHHHHHTGGG
T ss_pred             HHHHHHHHHhccCCCEEEEeccccCCHHHHHHHHHhhCCceEEEEeccCCcccCccccccccchhHHHHHHHHhccCccc
Confidence            999999999999999999999999999999999998889889999998755443344555432235677788876443  


Q ss_pred             -ceeeeccchHHHHHHHHcCchhhhhhcCCCCCCccCCCCCceeecccCCCCCcCcCCCCCCcchHHHHHHHHHcCCCee
Q 018278          261 -AVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGTP  339 (358)
Q Consensus       261 -~~~~~df~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~f~~nHD~~r~~~~~~~~~~~~~~a~a~l~~~pG~P  339 (358)
                       ...+|||++...+..++.++...+.+......+..+..|.+.++|++|||+.|+.+......++.++|++++||+||+|
T Consensus       241 ~~~~vfdf~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~p~~~~~fl~nHD~~r~~~~~~~~~~~~~~a~a~llt~pG~P  320 (405)
T 1ht6_A          241 SAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIP  320 (405)
T ss_dssp             SSEEEECHHHHHHHHHHTTTCGGGGSCTTSSCSSHHHHCGGGEEEESCCTTTSTTTCSSCCCGGGHHHHHHHHHHSSSEE
T ss_pred             ccceeechhhHHHHHHHHhhhHHHHHhhhcccchhhhcChhhhhhccCCcCCccccccccCcHHHHHHHHHHHHhCCCcc
Confidence             3445999998888888766666665433322222333567889999999999998877667788999999999999999


Q ss_pred             eeecCcccc
Q 018278          340 CIVISVTYP  348 (358)
Q Consensus       340 ~IyyGdE~G  348 (358)
                      +||||+|++
T Consensus       321 ~iy~G~e~~  329 (405)
T 1ht6_A          321 CIFYDHFFN  329 (405)
T ss_dssp             EEEHHHHHT
T ss_pred             eEEcCCCcC
Confidence            999999975
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>1tz7_A 4-alpha-glucanotransferase; (beta, alpha)8- barrel; 2.15A {Aquifex aeolicus} SCOP: c.1.8.1 Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>1esw_A Amylomaltase; (beta,alpha)8-barrel, glucanotransferase, alpha-amylase FAMI acarbose, transferase; HET: ACR; 1.90A {Thermus aquaticus} SCOP: c.1.8.1 PDB: 1cwy_A* 1fp8_A 1fp9_A 2owc_A* 2oww_A* 2owx_A* 2x1i_A* Back     alignment and structure
>1x1n_A 4-alpha-glucanotransferase; disproportionating enzyme, amylomaltase, D-enzyme; 1.80A {Solanum tuberosum} SCOP: c.1.8.1 Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* Back     alignment and structure
>4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* Back     alignment and structure
>3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Back     alignment and structure
>2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Back     alignment and structure
>3cc1_A BH1870 protein, putative alpha-N-acetylgalactosaminidase; structural genomic center for structural genomics, JCSG; HET: MSE PGE PG4 P33; 2.00A {Bacillus halodurans c-125} Back     alignment and structure
>3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>1uas_A Alpha-galactosidase; TIM-barrel, beta-alpha-barrel, greek KEY motif, hydrolase; HET: GLA; 1.50A {Oryza sativa} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2ki0_A DS119; beta-alpha-beta, de novo protein; NMR {Synthetic} Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>3ozo_A N-acetylglucosaminidase; beta-N-acetyl-D-hexosaminidase, hydrolase-hydrolase inhibito; HET: NGT; 2.00A {Ostrinia furnacalis} PDB: 3nsn_A* 3nsm_A* 3ozp_A* 3s6t_A* 3vtr_A* Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>3a5v_A Alpha-galactosidase; beta/alpha barrel, N-glycosylation, hydrolase; HET: MAN NAG BMA 1PG; 2.00A {Umbelopsis vinacea} Back     alignment and structure
>2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>4f9d_A Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; family 4 carbohydrate esterase, TIM barrel, hydrolase, deace carbohydrate/sugar binding; HET: MES; 1.90A {Escherichia coli} PDB: 4f9j_A* Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A* Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>1szn_A Alpha-galactosidase; (beta/alpha)8 barrel,TWO domains, glycoprotein, hydrolase; HET: NAG BMA MAN; 1.54A {Hypocrea jecorina} SCOP: b.71.1.1 c.1.8.1 PDB: 1t0o_A* Back     alignment and structure
>1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>2gjx_A Beta-hexosaminidase alpha chain; beta-hexosaminidase A, glycosidase, TAY-sachs disease, GM2 ganglisode, TIM barrel, hydrolase; HET: NAG BMA NDG; 2.80A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 2gk1_A* Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2zxd_A Alpha-L-fucosidase, putative; TIM barrel, hydrolase; HET: ZXD; 2.15A {Thermotoga maritima} PDB: 2zwy_A* 2zx5_A* 2zx6_A* 2zx7_A* 2zwz_A* 2zx9_A* 2zxa_A* 2zxb_A* 2zx8_A* 1hl9_A* 1hl8_A* 1odu_A* 2wsp_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>3rcn_A Beta-N-acetylhexosaminidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta half sandwich; HET: MSE; 2.51A {Arthrobacter aurescens} Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Back     alignment and structure
>2wvv_A Alpha-L-fucosidase; alpha-L-fucose, hydrolase, glycoside hydrolase family 29; 1.73A {Bacteroides thetaiotaomicron} PDB: 2xii_A* 2xib_A* 2wvv_B 2wvt_A* 2wvu_A* 2wvs_A* Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, HYDR; HET: NAG IFG; 2.20A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 1nou_A* 1np0_A* 2gjx_B* 3lmy_A* 1o7a_A* 2gk1_B* Back     alignment and structure
>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>3gh5_A HEX1, beta-hexosaminidase; beta-N-acetylhexosaminidase, glycosphingolipids, paenibacill GH20, hydrolase, structural genomics, NPPSFA; HET: NAG; 1.60A {Paenibacillus SP} PDB: 3gh4_A* 3gh7_A* 3sur_A* 3sus_A* 3sut_A* 3suu_A* 3suv_A* 3suw_A* Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* Back     alignment and structure
>4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1yht_A DSPB; beta barrel, hydrolase; 2.00A {Aggregatibacter actinomycetemcomitans} SCOP: c.1.8.6 Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>3gza_A Putative alpha-L-fucosidase; NP_812709.1, structural genomic center for structural genomics, JCSG; HET: MSE EPE; 1.60A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 358
d1ht6a2347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 2e-73
d1gcya2357 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m 4e-51
d1mxga2361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 7e-45
d2d3na2394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 6e-43
d1e43a2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera 8e-40
d1jaea2378 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea 3e-38
d1hvxa2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu 1e-35
d1ud2a2390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 9e-34
d1hx0a2403 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s 7e-32
d1g94a2354 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa 1e-29
d1j0ha3382 c.1.8.1 (A:124-505) Neopullulanase, central domain 1e-21
d1wzaa2409 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth 2e-20
d1wzla3382 c.1.8.1 (A:121-502) Maltogenic amylase, central do 1e-19
d1ua7a2344 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu 2e-19
d1ea9c3382 c.1.8.1 (C:122-503) Maltogenic amylase, central do 1e-18
d1iv8a2 653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 2e-18
d1m53a2 478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 7e-18
d2aaaa2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 3e-17
d1ji1a3432 c.1.8.1 (A:123-554) Maltogenic amylase, central do 4e-17
d1g5aa2 554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 5e-17
d2guya2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 3e-16
d1lwha2391 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Ther 9e-16
d1uoka2479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 1e-15
d1qhoa4407 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase 3e-15
d1h3ga3422 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d 1e-14
d3bmva4406 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase 2e-13
d1eh9a3400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 3e-13
d1bf2a3475 c.1.8.1 (A:163-637) Isoamylase, central domain {Ps 2e-12
d1m7xa3396 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz 2e-12
d2bhua3420 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro 7e-11
d1gjwa2 572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 7e-11
d1gjwa2572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 0.004
d1r7aa2 434 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac 2e-04
d2fhfa5 563 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella p 5e-04
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Plant alpha-amylase
species: Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]

 Score =  229 bits (584), Expect = 2e-73
 Identities = 208/320 (65%), Positives = 248/320 (77%), Gaps = 3/320 (0%)

Query: 25  LLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDA 84
           +LFQGFNWES  ++GGWYN +   + D++ AG+THVWLPPPS SV+ +GYMPGRLYD+DA
Sbjct: 3   VLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDA 62

Query: 85  SKYGSQADLKSLIQAFRQKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPS 144
           SKYG+ A+LKSLI A   KG++ +AD+VINHR A+ KD RGIYCIFEGGTSD RLDWGP 
Sbjct: 63  SKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPH 122

Query: 145 FICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQKELSDWMNWLKTEIGFDGWRFDFV 204
            ICR D +YSDG  N DTG DF  APDIDHLN RVQ+EL +W+ WLK+++GFD WR DF 
Sbjct: 123 MICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFA 182

Query: 205 KGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQAAGG---A 261
           +GY+P + KVY++ TSP  AV E WD+++ G DGKP+ +QD HR  L +WV   GG   A
Sbjct: 183 RGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASA 242

Query: 262 VAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFP 321
              FDFTTKGIL AAV+GELWRL D  GK PG +G  P  AVTF+DNHDTGSTQ +WPFP
Sbjct: 243 GMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFP 302

Query: 322 SDKVMLGYAYILTHPGTPCI 341
           SDKVM GYAYILTHPG PCI
Sbjct: 303 SDKVMQGYAYILTHPGIPCI 322
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Length = 382 Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Length = 432 Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Length = 391 Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Length = 563 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 100.0
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 100.0
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 100.0
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 100.0
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 100.0
d1m53a2478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 100.0
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1uoka2479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 100.0
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 100.0
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1g5aa2554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 100.0
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 100.0
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 100.0
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 100.0
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 100.0
d1r7aa2434 Sucrose phosphorylase {Bifidobacterium adolescenti 100.0
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 100.0
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 100.0
d1x1na1 523 Amylomaltase MalQ {Potato (Solanum tuberosum) [Tax 98.62
d1tz7a1 485 Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] 98.45
d1eswa_ 500 Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} 98.4
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 98.11
d2f2ha4338 Putative glucosidase YicI, domain 2 {Escherichia c 97.76
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 97.05
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 96.86
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 96.84
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 96.6
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 96.6
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 96.42
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 96.38
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 96.27
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 96.08
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 96.02
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 95.85
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 95.57
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 95.47
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 95.34
d1qbaa3443 Bacterial chitobiase (beta-N-acetylhexosaminidase) 95.19
d1nowa1353 beta-hexosaminidase B {Human (Homo sapiens) [TaxId 95.16
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 95.1
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 95.06
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 95.0
d1r46a2292 Melibiase {Human (Homo sapiens) [TaxId: 9606]} 94.86
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 94.36
d1yhta1344 Dispersin B, DspB {Actinobacillus actinomycetemcom 94.23
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 93.97
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 93.91
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 93.82
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 93.52
d2gjxa1362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 93.51
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 93.33
d1eoka_282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 93.05
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 92.98
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 92.56
d1hl9a2350 Putative alpha-L-fucosidase, catalytic domain {The 92.19
d1uasa2273 Melibiase {Rice (Oryza sativa) [TaxId: 4530]} 91.63
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 90.32
d2aama1285 Hypothetical protein TM1410 {Thermotoga maritima [ 89.67
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 88.48
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 87.73
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 85.0
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 84.23
d2hvma_273 Hevamine A (chitinase/lysozyme) {Para rubber tree 83.32
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 81.3
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Plant alpha-amylase
species: Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]

Probab=100.00  E-value=3.9e-67  Score=488.27  Aligned_cols=327  Identities=63%  Similarity=1.187  Sum_probs=266.3

Q ss_pred             CceEEEeeecCCCCCCCCchHHHHhhhhhHHHcCCCEEEeCCCCCCCCCCCCCccccCCCCCC-CCCCHHHHHHHHHHHH
Q 018278           23 PALLFQGFNWESSNKAGGWYNSLKNSIPDLSNAGITHVWLPPPSQSVAPQGYMPGRLYDLDAS-KYGSQADLKSLIQAFR  101 (358)
Q Consensus        23 ~~v~~q~F~~~~~~~~~G~~~gl~~~L~yl~~LGv~~I~l~Pi~~~~~~~gY~~~d~~~id~~-~~Gt~~d~~~Lv~~~H  101 (358)
                      .+|++|+|.|+++.+++|||++|++||||||+||||+|||+||++++++|||++.||++|+ | +|||++||++||++||
T Consensus         1 ~~~~~~~f~~~~~~~~~g~~~~i~~kLdyl~~lGv~~i~L~Pi~~~~~~~gY~~~d~~~id-~~~~G~~~~f~~lv~~~H   79 (347)
T d1ht6a2           1 HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDID-ASKYGNAAELKSLIGALH   79 (347)
T ss_dssp             CCCEEECCCTTGGGCTTCHHHHHHTTHHHHHHTTCCEEEECCCSCBSSTTSSSBCCTTCGG-GCTTCCHHHHHHHHHHHH
T ss_pred             CeeEEeccccCcCCCCCCCHHHHHHhHHHHHHcCCCEEEECCCCcCCCCCCCCccCcCcCC-cccCCCHHHHHHHHHHHh
Confidence            3799999999999999999999999999999999999999999999999999999999999 8 7999999999999999


Q ss_pred             HcCCEEEEEeecccccccCCCCCcceeeccCCCCCCCCCCCCCcccCCCCccCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q 018278          102 QKGIKCLADMVINHRTAERKDGRGIYCIFEGGTSDDRLDWGPSFICRGDKEYSDGQGNDDTGEDFQPAPDIDHLNPRVQK  181 (358)
Q Consensus       102 ~~Gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dln~~n~~v~~  181 (358)
                      ++||+||+|+|+||++..|++....+..+.+........|.....+.....+.+....+..+.++..+||||+.|++||+
T Consensus        80 ~~gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pdln~~n~~v~~  159 (347)
T d1ht6a2          80 GKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQR  159 (347)
T ss_dssp             HTTCEEEEEECCSBCCCSEECTTSCEEECCCSSSSSTTCCCGGGBCTTCTTTCCSCSCCCSSCCCTTSCBBCTTCHHHHH
T ss_pred             hcceEEeeeccccccCCCCcccccccccccCCCCCCCcCcCccccCCCcccccccccccccccccCCCCcccccchhhhh
Confidence            99999999999999999988655555555555555555555544444555555666777788899999999999999999


Q ss_pred             HHHHHHHHHHHhcCCCeEeeccCCCCCHHHHHHHHHhcCCCeEEEeccCCCCCCCCCCCCCCCCCchhhHHHHHH---hc
Q 018278          182 ELSDWMNWLKTEIGFDGWRFDFVKGYAPSITKVYMENTSPDFAVGEKWDSLSYGPDGKPDANQDGHRGALKDWVQ---AA  258 (358)
Q Consensus       182 ~l~~~~~~w~~~~gvDGfR~D~a~~i~~~~~~~~~~~~~p~~~~gE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~  258 (358)
                      ++++++++|++++||||||+|++++++.++|+.+.++.+..+..+|..............+......+....+..   ..
T Consensus       160 ~l~~~~~~wi~~~gvDGfR~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  239 (347)
T d1ht6a2         160 ELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGA  239 (347)
T ss_dssp             HHHHHHHHHHHHHCCCEEEETTGGGSCHHHHHHHHHHHCCSCEEECCCCCCCBCTTSSBCSCCHHHHHHHHHHHHHHTGG
T ss_pred             hhhhhhhhhcccCCcceEEEechhhcChHHHHHHHHhcccccchhhhcchhhccccccchhhhhcchhhhhhhhhhhCCc
Confidence            999999999988999999999999999999999998888888888887664433333333332222233333322   22


Q ss_pred             CCceeeeccchHHHHHHHHcCchhhhhhcCCCCCCccCCCCCceeecccCCCCCcCcCCCCCCcchHHHHHHHHHcCCCe
Q 018278          259 GGAVAAFDFTTKGILQAAVQGELWRLKDSNGKPPGFIGILPQNAVTFIDNHDTGSTQRLWPFPSDKVMLGYAYILTHPGT  338 (358)
Q Consensus       259 ~~~~~~~df~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~f~~nHD~~r~~~~~~~~~~~~~~a~a~l~~~pG~  338 (358)
                      ......+++.....+..++.++...+..............+..+++|++|||++|+.+......+++++|+|++||+|||
T Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~fl~nHD~~R~~s~~~~~~~~~~~a~a~llt~pGi  319 (347)
T d1ht6a2         240 ASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGI  319 (347)
T ss_dssp             GSSEEEECHHHHHHHHHHTTTCGGGGSCTTSSCSSHHHHCGGGEEEESCCTTTSTTTCSSCCCGGGHHHHHHHHHHSSSE
T ss_pred             cccchhhhcchhhHHHHhhccchHHHHHHhhhccccccCChhHeEEecCCCCccCcccccCCCHHHHHHHHHHHHHcCCc
Confidence            34566789988888888777776655554443333344467788999999999999999988888999999999999999


Q ss_pred             eeeecCccccCC
Q 018278          339 PCIVISVTYPLF  350 (358)
Q Consensus       339 P~IyyGdE~G~~  350 (358)
                      |+||||||++.+
T Consensus       320 P~IyyGD~~~~~  331 (347)
T d1ht6a2         320 PCIFYDHFFNWG  331 (347)
T ss_dssp             EEEEHHHHHTSS
T ss_pred             eEEEeCCCcCCC
Confidence            999999999654
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1qbaa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d1r46a2 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1hl9a2 c.1.8.11 (A:7-356) Putative alpha-L-fucosidase, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uasa2 c.1.8.1 (A:1-273) Melibiase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure