Citrus Sinensis ID: 018291

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MERNEAATKNKTTSLKKLDLYPVQNLTERNEATKNVTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVGKHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSWEILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGFRGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLSPNELSMAEKFRLAFVERDTRLAPKRAKNARQHQRRAEREWMETSTSAKAIALASKATKSLSSRK
ccHHHHHHHHHHccccccccccccccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHcccccHHcccccccccHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEcccccccHHHHHHHHHccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccc
ccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHcccccHEccccccccHHHHHHHHHHcHcccEEEcccccHccHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHcccHHHcccccHHHHcHHHHcccHHHHHEEEcccccHHHHHHHHHHccEEEEcccccccccccccccHHHcccccccHHHHHHccccccEccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccc
merneaatknkttslkkldlypvqnlternEATKNVTAFLKNlqfnsrlphekskppslvSLCLGIVGKHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSweildisgsdvsdfGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHsletlrcggsprsnhAARRCLGIlkpklndvegdsWEELVNTdighgaqslrwfvwpnidkdsiemmstecpriivnpkpspfgfrgfevpreafpditlddpfvndidpsawavprfasmgistsllspnelSMAEKFRLAFVERDTRLAPKRAKNARQHQRRAEREWMETSTSAKAIALASKAtkslssrk
merneaatknkttslkkldlypvqnlterneATKNVTAFLKNLQFNsrlphekskppSLVSLCLGIVGKHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSWEILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGIlkpklndveGDSWEELVNTDighgaqslrwFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGFRGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLSPNELSMAEKFRLAFVerdtrlapkraknarqhqrraerewmetstsaKAIALaskatkslssrk
MERNEAATKNKTTSLKKLDLYPVQNLTERNEATKNVTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVGKHLEDIIGDLDEIAINFPVDikiaiasiarrrkllaDDVIMSLADSSWEILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGFRGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLSPNELSMAEKFRLAFVERDTRLAPKRAKNARQHQRRAEREWMEtstsakaialaskatkslssRK
*******************LYPV***********NVTAFLKNLQF*************LVSLCLGIVGKHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSWEILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGFRGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLS*****MAEKFRLAFV*************************************************
************TSLKKLDLYPVQNL*****ATKNVTAFLKNLQF***********PSLVSLCLGIVGKHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSWEILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGFRGFEVPREAFPDITLDDPFVNDIDPSAWAV*******************MAEKFRLAFVERD*************************STSAKAIALASK**K******
***********TTSLKKLDLYPVQNLTERNEATKNVTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVGKHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSWEILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGFRGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLSPNELSMAEKFRLAFVERDTRLA***********************SAKAIALA***********
**************LKKLDLYPV******************************SKPPSLVSLCLGIVGKHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSWEILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGFRGFEVPREAFPDITLDDPFVNDIDPSAWAVPR*************NELSMAEKFRLAFVERDTRLAPKRAKNAR*HQ***EREWMETSTSAKAIALASKA********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERNEAATKNKTTSLKKLDLYPVQNLTERNEATKNVTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVGKHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSWEILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGFRGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLSPNELSMAEKFRLAFVERDTRLAPKRAKNARQHQRRAEREWMETSTSAKAIALASKATKSLSSRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
225460963347 PREDICTED: uncharacterized protein LOC10 0.949 0.979 0.667 1e-131
449444052367 PREDICTED: uncharacterized protein LOC10 0.871 0.850 0.689 1e-122
356553046351 PREDICTED: uncharacterized protein LOC10 0.972 0.991 0.631 1e-121
363806726351 uncharacterized protein LOC100797026 [Gl 0.972 0.991 0.625 1e-119
357494547355 hypothetical protein MTR_5g092970 [Medic 0.893 0.901 0.647 1e-115
224116614355 predicted protein [Populus trichocarpa] 0.969 0.977 0.602 1e-113
30687441343 uncharacterized protein [Arabidopsis tha 0.921 0.962 0.619 1e-110
297799294342 hypothetical protein ARALYDRAFT_492098 [ 0.918 0.961 0.619 1e-108
255583615266 conserved hypothetical protein [Ricinus 0.737 0.992 0.723 1e-104
343172605314 hypothetical protein, partial [Silene la 0.865 0.987 0.645 1e-103
>gi|225460963|ref|XP_002279971.1| PREDICTED: uncharacterized protein LOC100248711 [Vitis vinifera] gi|297737440|emb|CBI26641.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/349 (66%), Positives = 276/349 (79%), Gaps = 9/349 (2%)

Query: 9   KNKTTSLKKLDLYPVQNLTERNEATKNVTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVG 68
           K+ TTS +KL L P+         +K+  + +     +SR P EK+KPPSL SLCLG+VG
Sbjct: 7   KSLTTSFQKLHLSPI---------SKSKPSVIPPTFQSSRSPIEKTKPPSLESLCLGVVG 57

Query: 69  KHLEDIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSWEILDISGSDVSD 128
           KH EDIIGDL EIA+NFP D K+A+A+IARRR+LL DDVI+SLA+SSWEILDISGSDVSD
Sbjct: 58  KHFEDIIGDLGEIAVNFPADTKMAMAAIARRRQLLNDDVIISLAESSWEILDISGSDVSD 117

Query: 129 FGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGI 188
           FGL KVA+ CK L+AVDIS C ++TAAGVSE + HCHSLETLRCGG PRS+H AR+CLGI
Sbjct: 118 FGLAKVAERCKVLRAVDISRCSKVTAAGVSELVWHCHSLETLRCGGCPRSDHTARQCLGI 177

Query: 189 LKPKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPF 248
            KPKLND+EG+SWEEL  T+I HGA+SLRW VWP ID +S+E  + ECPRIIVNPKPSPF
Sbjct: 178 FKPKLNDIEGESWEELDPTEIAHGAESLRWLVWPKIDNNSLESFAAECPRIIVNPKPSPF 237

Query: 249 GFRGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLSPNELSMAEKFRLAF 308
           GFRG +VP EA P++ LD+P V DIDP  WAV  F +   + S  S  EL +AEKFRLAF
Sbjct: 238 GFRGVKVPVEALPNVALDEPIVKDIDPRTWAVSGFTARPTAPSSPSSTELPIAEKFRLAF 297

Query: 309 VERDTRLAPKRAKNARQHQRRAEREWMETSTSAKAIALASKATKSLSSR 357
           VERD+RLAPKRAKNARQH RRAEREW+ TST AKA+ALAS+A+KSL  R
Sbjct: 298 VERDSRLAPKRAKNARQHLRRAEREWVMTSTRAKALALASQASKSLHGR 346

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449444052|ref|XP_004139789.1| PREDICTED: uncharacterized protein LOC101203553 [Cucumis sativus] gi|449518907|ref|XP_004166477.1| PREDICTED: uncharacterized LOC101203553 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553046|ref|XP_003544869.1| PREDICTED: uncharacterized protein LOC100784617 [Glycine max] Back     alignment and taxonomy information
>gi|363806726|ref|NP_001242271.1| uncharacterized protein LOC100797026 [Glycine max] gi|255639475|gb|ACU20032.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357494547|ref|XP_003617562.1| hypothetical protein MTR_5g092970 [Medicago truncatula] gi|355518897|gb|AET00521.1| hypothetical protein MTR_5g092970 [Medicago truncatula] gi|388520841|gb|AFK48482.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224116614|ref|XP_002317347.1| predicted protein [Populus trichocarpa] gi|222860412|gb|EEE97959.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30687441|ref|NP_194428.2| uncharacterized protein [Arabidopsis thaliana] gi|63003790|gb|AAY25424.1| At4g26980 [Arabidopsis thaliana] gi|90093278|gb|ABD85152.1| At4g26980 [Arabidopsis thaliana] gi|110737995|dbj|BAF00933.1| hypothetical protein [Arabidopsis thaliana] gi|332659880|gb|AEE85280.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297799294|ref|XP_002867531.1| hypothetical protein ARALYDRAFT_492098 [Arabidopsis lyrata subsp. lyrata] gi|297313367|gb|EFH43790.1| hypothetical protein ARALYDRAFT_492098 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255583615|ref|XP_002532563.1| conserved hypothetical protein [Ricinus communis] gi|223527718|gb|EEF29824.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|343172605|gb|AEL99006.1| hypothetical protein, partial [Silene latifolia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
TAIR|locus:2116307343 AT4G26980 "AT4G26980" [Arabido 0.868 0.906 0.590 2.2e-96
TAIR|locus:2116307 AT4G26980 "AT4G26980" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 958 (342.3 bits), Expect = 2.2e-96, P = 2.2e-96
 Identities = 192/325 (59%), Positives = 232/325 (71%)

Query:    14 SLKKLDLYPVQNLTERNEATKN---VTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVGKH 70
             SLK LDL    N T R    +N   V+A++ +    SR+   KSKPPSLVS CLG++GKH
Sbjct:     8 SLKNLDL----N-TNRGRGPENKILVSAYVSS----SRMSPLKSKPPSLVSSCLGVIGKH 58

Query:    71 LEDIIGDLDEIAINFPVDXXXXXXXXXXXXXXXXDDVIMSLADSSWEILDISGSDVSDFG 130
             LED+I  L EI++ FP D                DDVI+ LADSSWEILD+SGSDV++FG
Sbjct:    59 LEDMIRCLAEISVIFPADIKMSIAAIARRKKLLDDDVIICLADSSWEILDVSGSDVTNFG 118

Query:   131 LVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILK 190
             L KVA++CKSL+AVDIS C++I++ GV E + HC SLETLRCGG P S   ARR L I K
Sbjct:   119 LAKVAEICKSLRAVDISRCNKISSMGVLELVQHCRSLETLRCGGCPSSESTARRSLSIFK 178

Query:   191 PKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDSIEMMSTECPRIIVNPKPSPFGF 250
             P L++VEG++WEE+  ++IGHG QSLRW VWP IDKDS+EM+S+ECPRI+VNPKPS   +
Sbjct:   179 PNLSNVEGETWEEIDTSEIGHGGQSLRWLVWPRIDKDSLEMLSSECPRIVVNPKPSLVAY 238

Query:   251 RGFEVPREAFPDITLDDPFVNDIDPSAWAVPRFASMGISTSLLSPNELSMAEKFRLAFVE 310
             R  EVPREA PD+ LD+PFV DIDP  W V         TS    NELS+AEKFRLAF E
Sbjct:   239 RADEVPREALPDVALDEPFVKDIDPKTWVVTGVVQK--PTSFPLSNELSIAEKFRLAFAE 296

Query:   311 RDTRLAPKRAKNARQHQRRAEREWM 335
             RD R+APKRAKNARQ QRRAER+WM
Sbjct:   297 RDARMAPKRAKNARQRQRRAERDWM 321


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.134   0.406    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      358       322   0.00085  116 3  11 22  0.40    34
                                                     33  0.45    37


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  621 (66 KB)
  Total size of DFA:  237 KB (2128 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  23.79u 0.08s 23.87t   Elapsed:  00:00:01
  Total cpu time:  23.79u 0.08s 23.87t   Elapsed:  00:00:01
  Start:  Sat May 11 05:33:50 2013   End:  Sat May 11 05:33:51 2013
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009644 "response to high light intensity" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 3e-05
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information 
 Score = 44.2 bits (105), Expect = 3e-05
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 126 VSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCG 173
           + D GL+ +AQ C +L+ +D+  C+ IT +G+     +C  L+T+  G
Sbjct: 65  IDDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPKLQTINLG 112

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 358
KOG4341483 consensus F-box protein containing LRR [General fu 99.72
KOG4341483 consensus F-box protein containing LRR [General fu 99.65
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.56
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.27
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.99
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.94
KOG3864221 consensus Uncharacterized conserved protein [Funct 98.37
KOG3864221 consensus Uncharacterized conserved protein [Funct 98.24
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.09
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 97.98
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.82
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.7
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 97.64
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.49
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.41
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.31
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.01
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.56
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.47
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.45
KOG4308 478 consensus LRR-containing protein [Function unknown 96.23
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 96.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.6
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 95.51
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.43
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 95.42
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.36
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.9
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.64
KOG1259490 consensus Nischarin, modulator of integrin alpha5 93.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 93.48
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 92.83
PRK15386 426 type III secretion protein GogB; Provisional 92.83
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 92.66
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 92.54
KOG4308478 consensus LRR-containing protein [Function unknown 92.34
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.0
KOG2123 388 consensus Uncharacterized conserved protein [Funct 91.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 90.81
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 88.98
PLN03150623 hypothetical protein; Provisional 87.16
PLN03150623 hypothetical protein; Provisional 87.1
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 86.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 86.33
KOG2982 418 consensus Uncharacterized conserved protein [Funct 86.16
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 86.05
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 85.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 83.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 83.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 83.01
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 82.66
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 81.65
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information 
Probab=99.72  E-value=1.5e-18  Score=171.50  Aligned_cols=171  Identities=17%  Similarity=0.322  Sum_probs=145.6

Q ss_pred             CCCHHHHHHhhc--cCccEEEeeCC-CCChHHHHHHHHhCCCCCEEeecCCCCCCHHHHHHHHhCCCCCceEEccCCCCC
Q 018291          102 LLADDVIMSLAD--SSWEILDISGS-DVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRS  178 (358)
Q Consensus       102 ~ltD~~L~~l~~--~~L~~L~Ls~c-~ItD~gL~~la~~C~~L~~LdLs~C~~ITD~gl~~La~~Cp~L~~L~L~gC~~I  178 (358)
                      .+.|..+..++.  |++++|++.|| +|||..+..++..|++|++|+|..|..+||..++.+++.||+|++|++++|+.|
T Consensus       150 ~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~qi  229 (483)
T KOG4341|consen  150 AVGDSSLRTFASNCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCPQI  229 (483)
T ss_pred             cCCcchhhHHhhhCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCchh
Confidence            477888888877  89999999999 999999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHhhCCCCcEEeCC--------------------------Cc-cccchhh--hhcccccccccc---cccCCH
Q 018291          179 NHAARRCLGILKPKLNDVEGD--------------------------SW-EELVNTD--IGHGAQSLRWFV---WPNIDK  226 (358)
Q Consensus       179 tD~~l~~L~~~cp~L~~L~ls--------------------------~~-~~~d~~~--i~~~~~sL~~L~---C~~ITd  226 (358)
                      ++.+++++.+.|..|+.+...                          .| .++|.++  +..+|..|+.|.   |.++||
T Consensus       230 ~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~~d  309 (483)
T KOG4341|consen  230 SGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTDITD  309 (483)
T ss_pred             hcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCCCch
Confidence            888887777777665444222                          33 2344443  467788888887   999999


Q ss_pred             HHHHHHHhcCCCceecCCCCceeecCCC-CCccccccccCCCccccccccccc
Q 018291          227 DSIEMMSTECPRIIVNPKPSPFGFRGFE-VPREAFPDITLDDPFVNDIDPSAW  278 (358)
Q Consensus       227 ~~l~~L~~~Cp~L~~~p~~~~l~l~gC~-~s~eal~~~~l~~~~~~~~~~~~W  278 (358)
                      ..+.++..+|++|++      +-+.+|. ++..++..+.-.++.+++++.+.-
T Consensus       310 ~~l~aLg~~~~~L~~------l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~  356 (483)
T KOG4341|consen  310 EVLWALGQHCHNLQV------LELSGCQQFSDRGFTMLGRNCPHLERLDLEEC  356 (483)
T ss_pred             HHHHHHhcCCCceEE------EeccccchhhhhhhhhhhcCChhhhhhccccc
Confidence            999999999999999      9999999 999999999999999999888754

>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-09
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-06
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
 Score = 56.9 bits (137), Expect = 4e-09
 Identities = 35/184 (19%), Positives = 77/184 (41%), Gaps = 22/184 (11%)

Query: 13  TSLKKLDLYPVQNLTERNEATKNVTAFLKNLQFNSRLPHEKSKPPSLVSLCLGIVGKHLE 72
             L+ + +Y V ++T  NE+ +++  +LKNL  + RL         L+     I    L+
Sbjct: 378 QELEYMAVY-VSDIT--NESLESIGTYLKNLC-DFRL--------VLLDREERITDLPLD 425

Query: 73  DIIGDLDEIAINFPVDIKIAIASIARRRKLLADDVIMSLADSSW--EILDISGSDVSDFG 130
           + +     + I      K+   +   R+  L D  +  +   S     + +     SD G
Sbjct: 426 NGVR---SLLIGCK---KLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEG 479

Query: 131 LVKVAQMCKSLKAVDISCCDRITAAGVSEFLLHCHSLETLRCGGSPRSNHAARRCLGILK 190
           L++ ++ C +L+ +++  C   +   ++  +    SL  L   G  R++   +  + + +
Sbjct: 480 LMEFSRGCPNLQKLEMRGC-CFSERAIAAAVTKLPSLRYLWVQGY-RASMTGQDLMQMAR 537

Query: 191 PKLN 194
           P  N
Sbjct: 538 PYWN 541
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.64
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.6
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.6
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.59
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.59
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.59
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.25
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.2
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.14
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.11
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.97
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.56
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.54
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.5
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.3
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.15
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.15
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.09
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.02
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.02
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.99
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.99
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.94
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.91
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.9
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 97.89
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.87
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.82
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.76
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.76
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.76
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.75
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.74
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 97.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.72
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.72
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.7
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.64
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.63
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.62
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.58
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.55
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.55
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.55
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.54
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.53
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.5
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.47
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.46
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.46
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.46
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.44
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 97.4
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.4
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.4
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.39
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 97.38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.36
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 97.35
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.35
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.35
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.31
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.3
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 97.29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.26
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.25
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 97.22
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.12
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.1
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 97.07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 96.99
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 96.92
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 96.9
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 96.87
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 96.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 96.84
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.75
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.65
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.63
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 96.6
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 96.57
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 96.45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 96.2
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.1
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.0
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 95.94
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 95.91
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.9
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 95.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 95.71
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 95.64
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 95.57
3e6j_A229 Variable lymphocyte receptor diversity region; var 95.44
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 95.37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 95.3
1w8a_A192 SLIT protein; signaling protein, secreted protein, 95.25
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 95.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.21
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 94.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 93.72
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 93.53
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 93.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 92.55
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 90.42
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 89.56
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 86.45
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 86.35
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 86.16
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
Probab=99.73  E-value=2.8e-18  Score=153.39  Aligned_cols=106  Identities=10%  Similarity=0.141  Sum_probs=94.2

Q ss_pred             cCccEEEeeCCCCChHHHHHHHHhCCCCCEEeecCCCCCCHHHHHHHHhC---CCCCceEEccCCCCCcHHHHHHHHhhC
Q 018291          114 SSWEILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSEFLLH---CHSLETLRCGGSPRSNHAARRCLGILK  190 (358)
Q Consensus       114 ~~L~~L~Ls~c~ItD~gL~~la~~C~~L~~LdLs~C~~ITD~gl~~La~~---Cp~L~~L~L~gC~~ItD~~l~~L~~~c  190 (358)
                      ..|++|||++|.|||.|+..+ ..|++|++|+|++|.+|||.|+..|+..   |++|++|+|++|.+|||.|+.+|+ .|
T Consensus        61 ~~L~~LDLs~~~Itd~GL~~L-~~~~~L~~L~L~~C~~ItD~gL~~L~~~~~~~~~L~~L~Ls~C~~ITD~Gl~~L~-~~  138 (176)
T 3e4g_A           61 YKIQAIDATDSCIMSIGFDHM-EGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALH-HF  138 (176)
T ss_dssp             CCEEEEEEESCCCCGGGGGGG-TTCSCCCEEEEESCTTCCHHHHHHHHTCHHHHHHCCEEEEESCTTCCHHHHHHGG-GC
T ss_pred             ceEeEEeCcCCCccHHHHHHh-cCCCCCCEEEeCCCCccCHHHHHHHHhcccccCCCCEEEcCCCCcCCHHHHHHHh-cC
Confidence            469999999999999999998 5899999999999999999999999974   789999999999999999999998 58


Q ss_pred             CCCcEEeCCCccccchhhhhcccccccccccccCCHHH--HHHHHhcCCCcee
Q 018291          191 PKLNDVEGDSWEELVNTDIGHGAQSLRWFVWPNIDKDS--IEMMSTECPRIIV  241 (358)
Q Consensus       191 p~L~~L~ls~~~~~d~~~i~~~~~sL~~L~C~~ITd~~--l~~L~~~Cp~L~~  241 (358)
                      |+|++|++++                    |++|||.+  +..+...-|++++
T Consensus       139 ~~L~~L~L~~--------------------c~~Itd~gl~~~~L~~~lP~l~V  171 (176)
T 3e4g_A          139 RNLKYLFLSD--------------------LPGVKEKEKIVQAFKTSLPSLEL  171 (176)
T ss_dssp             TTCCEEEEES--------------------CTTCCCHHHHHHHHHHHCTTCEE
T ss_pred             CCCCEEECCC--------------------CCCCCchHHHHHHHHHHCCCcEE
Confidence            9999999865                    78888866  4566667777765
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 358
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 41.5 bits (95), Expect = 1e-04
 Identities = 13/57 (22%), Positives = 24/57 (42%), Gaps = 4/57 (7%)

Query: 117 EILDISGSDVSDFGLVKVAQMCKSLKAVDISCCDRITAAGV---SEFLLHCHSLETL 170
           + LDI   ++SD    ++  + +  + V +  C  +T A     S  L    +L  L
Sbjct: 5   QSLDIQCEELSDARWAELLPLLQQCQVVRLDDC-GLTEARCKDISSALRVNPALAEL 60
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.84
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.82
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.17
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.04
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.03
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.99
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.99
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.97
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.69
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.69
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.09
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.02
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.9
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.68
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.51
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.47
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.23
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.15
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.09
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 96.91
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 96.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.26
d1p9ag_266 von Willebrand factor binding domain of glycoprote 96.21
d1p9ag_266 von Willebrand factor binding domain of glycoprote 95.85
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 94.98
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 94.95
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 94.45
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 93.96
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 93.95
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 93.54
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 93.5
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 92.75
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 91.09
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 89.89
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 87.24
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 86.74
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=6.7e-21  Score=177.93  Aligned_cols=161  Identities=19%  Similarity=0.221  Sum_probs=138.1

Q ss_pred             CCCHHHHHHhhc-cCccEEEeeCC-CCChHHHHHHHHhCCCCCEEeecCCCCCCHHHHHH-HHhCCCCCceEEccCC-CC
Q 018291          102 LLADDVIMSLAD-SSWEILDISGS-DVSDFGLVKVAQMCKSLKAVDISCCDRITAAGVSE-FLLHCHSLETLRCGGS-PR  177 (358)
Q Consensus       102 ~ltD~~L~~l~~-~~L~~L~Ls~c-~ItD~gL~~la~~C~~L~~LdLs~C~~ITD~gl~~-La~~Cp~L~~L~L~gC-~~  177 (358)
                      .++|..+..+++ ++|++|+|++| .|||.|+..++..|++|++|+|++|.++||.++.. ++..|++|+.|+++|| ..
T Consensus        82 ~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~  161 (284)
T d2astb2          82 RLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKN  161 (284)
T ss_dssp             BCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGG
T ss_pred             CCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhccccccccccccccccchhhhcccccccchhhhcccccc
Confidence            488999999988 99999999999 99999999999999999999999999999999865 5567899999999998 46


Q ss_pred             CcHHHHHHHHhhCCCCcEEeCCCcc-ccchhhh-hcccccccccc---cccCCHHHHHHHHhcCCCceecCCCCceeecC
Q 018291          178 SNHAARRCLGILKPKLNDVEGDSWE-ELVNTDI-GHGAQSLRWFV---WPNIDKDSIEMMSTECPRIIVNPKPSPFGFRG  252 (358)
Q Consensus       178 ItD~~l~~L~~~cp~L~~L~ls~~~-~~d~~~i-~~~~~sL~~L~---C~~ITd~~l~~L~~~Cp~L~~~p~~~~l~l~g  252 (358)
                      ++|.++..++.+||+|++|+++++. ++|.++. -..+++|++|+   |.+|||+++..++ +||+|+.      +++.|
T Consensus       162 i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~~L~L~~C~~i~~~~l~~L~-~~~~L~~------L~l~~  234 (284)
T d2astb2         162 LQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELG-EIPTLKT------LQVFG  234 (284)
T ss_dssp             SCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCCGGGGGGGG-GCTTCCE------EECTT
T ss_pred             cccccccccccccccccccccccccCCCchhhhhhcccCcCCEEECCCCCCCChHHHHHHh-cCCCCCE------EeeeC
Confidence            9999999999999999999998865 5555542 23578899887   9999999998875 6999999      99999


Q ss_pred             CCCCccccccccCCCccc
Q 018291          253 FEVPREAFPDITLDDPFV  270 (358)
Q Consensus       253 C~~s~eal~~~~l~~~~~  270 (358)
                      | ++.++++.+.-.+|.+
T Consensus       235 ~-~~d~~l~~l~~~lp~L  251 (284)
T d2astb2         235 I-VPDGTLQLLKEALPHL  251 (284)
T ss_dssp             S-SCTTCHHHHHHHSTTS
T ss_pred             C-CCHHHHHHHHHhCccc
Confidence            9 7777766655444443
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure