Citrus Sinensis ID: 018329

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MGSTSNCLLCFMLCTLLVSAVASRSRVSHQTTEADADRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDIYSIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHANITKLSYPYTTCR
ccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEccccccEEEEEEEEEccccccccEEEEEccccccccccHHHHHHHcccEEcccccccccccccHHHHccEEEEEccccccEEcccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHHccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHEcccccccccccccEEEEEEEEEccccEEEEEEEEcccHHHccccEEEEEcccccEcccccHHHHccccEEEcHHHccEEEccccHHHccEEEEEcccccccccEEccHHHHHcccHHHHHHHHHHHHHHHHHHcHHHcccEEEEEEEccHHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccccccccccccHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccHHHHHHcccccccccccccccHHHHHHHHHccHHHHHHHccccccccccccccc
MGSTSNCLLCFMLCTLLVSAVAsrsrvshqtteadadrvrdlpgqpkvefkhyagyvklrpndhKALFYWFFEaqkgvsskplvlwlnggpgcssiAYGAaqelgpflvggngsrlkfnKYSWNKAANMLFleapvgvgfsytnnsedlhklgdqvtanDSYAFLIGWFkrfpnfkshdfyiagesyaghyvPQLAELIHERNIRAGKDSFINLKGFmignavindptdtkglvdyAWSHAIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDiysiyspvcldsldgkappklmvaphlltqhdlwhrlpsgydpcaedyvmkFFNREDVQRALHANITklsypyttcr
MGSTSNCLLCFMLCTLLVSAVasrsrvshqtteadadrvrdlpgqpkvEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDIYSIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHanitklsypyttcr
MGSTSNCLLCFMLCTLLvsavasrsrvsHQTTEADADRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDIYSIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHANITKLSYPYTTCR
*****NCLLCFMLCTLLVSAVA************************KVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDIYSIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHANITKLSYPYT***
******C**CFMLCTLLVSAVASRSRV*********DRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDIYSIYSPVCLDSLD***************QHDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHANITKLSYPYTTCR
MGSTSNCLLCFMLCTLLVSAV***************DRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDIYSIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHANITKLSYPYTTCR
*GSTSNCLLCFMLCTLLVSAVASRSRV***TTEADADRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDIYSIYSPVCLDS************P*****HDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHANITKLSYPYTTCR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSTSNCLLCFMLCTLLVSAVASRSRVSHQTTEADADRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDIYSIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHANITKLSYPYTTCR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query358 2.2.26 [Sep-21-2011]
Q9LEY1 480 Serine carboxypeptidase-l yes no 0.969 0.722 0.624 1e-127
Q0WPR4 499 Serine carboxypeptidase-l no no 0.924 0.663 0.559 1e-115
Q9M099 465 Serine carboxypeptidase 2 no no 0.944 0.726 0.502 3e-95
Q4PSY2 463 Serine carboxypeptidase-l no no 0.913 0.706 0.492 3e-92
O04084 492 Serine carboxypeptidase-l no no 0.935 0.680 0.484 7e-92
Q9LSM9 478 Serine carboxypeptidase-l no no 0.885 0.663 0.515 2e-91
O23364 488 Putative serine carboxype no no 0.938 0.688 0.495 6e-91
Q1PF08 464 Serine carboxypeptidase-l no no 0.910 0.702 0.483 3e-89
Q8L9Y0 473 Serine carboxypeptidase-l no no 0.949 0.718 0.471 1e-86
O82229 454 Putative serine carboxype no no 0.877 0.691 0.470 7e-86
>sp|Q9LEY1|SCP35_ARATH Serine carboxypeptidase-like 35 OS=Arabidopsis thaliana GN=SCPL35 PE=2 SV=1 Back     alignment and function desciption
 Score =  455 bits (1170), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/357 (62%), Positives = 269/357 (75%), Gaps = 10/357 (2%)

Query: 11  FMLCTLLVSAVASRSRVSHQTTEADADRVRD-----LPGQPKVEFKHYAGYVKLRPND-H 64
           ++LC L++ A+A   +   + T + + R  D     LPGQP V FKHYAGYV L P    
Sbjct: 7   WLLCILVLPAIACGRKPEKKVTISSSGRKEDDLVTGLPGQPPVNFKHYAGYVNLGPEQKQ 66

Query: 65  KALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNKYSWN 124
           KALFYWFFEAQ+  S +PLVLWLNGGPGCSSIAYGAAQELGPFLV  NG +L +N +SWN
Sbjct: 67  KALFYWFFEAQQNSSRRPLVLWLNGGPGCSSIAYGAAQELGPFLVHDNGGKLTYNHFSWN 126

Query: 125 KAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAG 184
           K ANMLFLEAPVGVGFSYTNNS DL KLGD+VTA+DS AFLI WF +FP F+S +FYI+G
Sbjct: 127 KEANMLFLEAPVGVGFSYTNNSMDLQKLGDEVTASDSLAFLINWFMKFPEFRSSEFYISG 186

Query: 185 ESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIIS 244
           ESYAGHYVPQLAE+I++RN +  KDS INLKGFMIGNAVIN+ TD  GLVDYAWSHAIIS
Sbjct: 187 ESYAGHYVPQLAEVIYDRNKKVTKDSSINLKGFMIGNAVINEATDMAGLVDYAWSHAIIS 246

Query: 245 DKLYKDISKECDFGQSMIR--SNCNDHIRGFVEAYAEIDIYSIYSPVCLDSLDGKAP--P 300
           D+++  I   C F +        C ++ +GF++AY +IDIYSIY+PVCL SL   +P  P
Sbjct: 247 DEVHTSIHGSCSFEEDTTNKTEQCYNNFKGFMDAYNDIDIYSIYTPVCLSSLLSSSPRKP 306

Query: 301 KLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHANITKLSYPYTTC 357
           K++V+P LLT  DLW + P+GYDPC E Y   +FNR+DVQ ALHAN+T L YPY+ C
Sbjct: 307 KIVVSPRLLTFDDLWDKFPAGYDPCTESYAENYFNRKDVQVALHANVTNLPYPYSPC 363
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q0WPR4|SCP34_ARATH Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana GN=SCPL34 PE=2 SV=2 Back     alignment and function description
>sp|Q9M099|SCP24_ARATH Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1 Back     alignment and function description
>sp|Q4PSY2|SCP32_ARATH Serine carboxypeptidase-like 32 OS=Arabidopsis thaliana GN=SCPL32 PE=2 SV=1 Back     alignment and function description
>sp|O04084|SCP31_ARATH Serine carboxypeptidase-like 31 OS=Arabidopsis thaliana GN=SCPL31 PE=2 SV=2 Back     alignment and function description
>sp|Q9LSM9|SCP33_ARATH Serine carboxypeptidase-like 33 OS=Arabidopsis thaliana GN=SCPL33 PE=2 SV=2 Back     alignment and function description
>sp|O23364|SCP30_ARATH Putative serine carboxypeptidase-like 30 OS=Arabidopsis thaliana GN=SCPL30 PE=2 SV=2 Back     alignment and function description
>sp|Q1PF08|SCP22_ARATH Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1 Back     alignment and function description
>sp|Q8L9Y0|SCP25_ARATH Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2 Back     alignment and function description
>sp|O82229|SCP23_ARATH Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
224096538 474 predicted protein [Populus trichocarpa] 0.991 0.748 0.709 1e-149
359472738 518 PREDICTED: serine carboxypeptidase-like 0.994 0.687 0.689 1e-144
297737951 476 unnamed protein product [Vitis vinifera] 0.994 0.747 0.689 1e-143
297737953 471 unnamed protein product [Vitis vinifera] 0.972 0.738 0.680 1e-143
225423732 474 PREDICTED: serine carboxypeptidase-like 0.972 0.734 0.680 1e-143
356544386 472 PREDICTED: serine carboxypeptidase-like 0.974 0.739 0.650 1e-136
449464034 484 PREDICTED: serine carboxypeptidase-like 0.952 0.704 0.651 1e-133
449512752 484 PREDICTED: serine carboxypeptidase-like 0.952 0.704 0.648 1e-133
449512756 483 PREDICTED: serine carboxypeptidase-like 0.910 0.674 0.655 1e-127
15241571 480 serine carboxypeptidase-like 35 [Arabido 0.969 0.722 0.624 1e-125
>gi|224096538|ref|XP_002310649.1| predicted protein [Populus trichocarpa] gi|222853552|gb|EEE91099.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 254/358 (70%), Positives = 292/358 (81%), Gaps = 3/358 (0%)

Query: 1   MGSTSNCLLCFMLCTLLVSAVASRSRVSHQTTEADADRVRDLPGQPKVEFKHYAGYVKLR 60
           M + S  L CF++ T ++ A   R     +    +ADRV +LPGQP+V F+HYAGYVKL 
Sbjct: 1   MANLSKWLFCFLVSTTVIVAAVGREISDGEEARREADRVTNLPGQPQVRFQHYAGYVKLG 60

Query: 61  PNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGGNGSRLKFNK 120
           P + +ALFYWFFEA++  S KPLVLWLNGGPGCSSIAYGAAQELGPFLV GNG++L  NK
Sbjct: 61  PQNQRALFYWFFEAKEDASQKPLVLWLNGGPGCSSIAYGAAQELGPFLVRGNGTQLILNK 120

Query: 121 YSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDF 180
           YSWNKAANMLFLEAPVGVGFSYTNNSEDL+KLGD+VTA+DS+ FLI WFKRFPNFKSHDF
Sbjct: 121 YSWNKAANMLFLEAPVGVGFSYTNNSEDLYKLGDKVTADDSHTFLINWFKRFPNFKSHDF 180

Query: 181 YIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSH 240
           YIAGESYAGHYVPQLAELI+ERN  A K S+INLKGFMIGNAVIND TD+ G+VDYAWSH
Sbjct: 181 YIAGESYAGHYVPQLAELIYERNKGATKSSYINLKGFMIGNAVINDETDSAGIVDYAWSH 240

Query: 241 AIISDKLYKDISKECDFGQSMIRSNCNDHIRGFVEAYAEIDIYSIYSPVCLDSLDGKAPP 300
           AIISD+LY +I KECD  Q  + + C  H RGF EAY++IDIYSIY+PVCL     +   
Sbjct: 241 AIISDQLYHNI-KECDH-QGSVTNECVVHYRGFAEAYSDIDIYSIYTPVCLSEYSTRISS 298

Query: 301 KLMVAPHLLTQ-HDLWHRLPSGYDPCAEDYVMKFFNREDVQRALHANITKLSYPYTTC 357
           +L+VAP LL++ HDL HRLPSGYDPC EDY  KFFNREDVQ+ALHAN+TKLSYPYT C
Sbjct: 299 RLVVAPRLLSKLHDLVHRLPSGYDPCTEDYAEKFFNREDVQKALHANVTKLSYPYTPC 356

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359472738|ref|XP_002276960.2| PREDICTED: serine carboxypeptidase-like 35-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737951|emb|CBI27152.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737953|emb|CBI27154.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225423732|ref|XP_002278314.1| PREDICTED: serine carboxypeptidase-like 35-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356544386|ref|XP_003540633.1| PREDICTED: serine carboxypeptidase-like 35-like [Glycine max] Back     alignment and taxonomy information
>gi|449464034|ref|XP_004149734.1| PREDICTED: serine carboxypeptidase-like 35-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449512752|ref|XP_004164131.1| PREDICTED: serine carboxypeptidase-like 35-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449512756|ref|XP_004164132.1| PREDICTED: serine carboxypeptidase-like 35-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15241571|ref|NP_196443.1| serine carboxypeptidase-like 35 [Arabidopsis thaliana] gi|75334909|sp|Q9LEY1.1|SCP35_ARATH RecName: Full=Serine carboxypeptidase-like 35; Flags: Precursor gi|13877963|gb|AAK44059.1|AF370244_1 putative serine-type carboxypeptidase II [Arabidopsis thaliana] gi|8346563|emb|CAB93727.1| serine-type carboxypeptidase II-like protein [Arabidopsis thaliana] gi|17065642|gb|AAL33815.1| putative serine-type carboxypeptidase II [Arabidopsis thaliana] gi|332003892|gb|AED91275.1| serine carboxypeptidase-like 35 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
TAIR|locus:2181504 480 scpl35 "serine carboxypeptidas 0.896 0.668 0.665 9.8e-119
TAIR|locus:2166870 499 SCPL34 "serine carboxypeptidas 0.899 0.645 0.570 3.9e-108
TAIR|locus:2118706 465 BRS1 "BRI1 SUPPRESSOR 1" [Arab 0.944 0.726 0.497 4.6e-89
TAIR|locus:2086137 478 scpl33 "serine carboxypeptidas 0.868 0.650 0.525 2e-86
TAIR|locus:2008480 463 SCPL32 "serine carboxypeptidas 0.913 0.706 0.490 1.8e-85
TAIR|locus:2061436 464 scpl22 "serine carboxypeptidas 0.949 0.732 0.468 3.4e-84
TAIR|locus:2078598 473 scpl25 "serine carboxypeptidas 0.893 0.676 0.493 1.9e-83
TAIR|locus:2077422 459 SCPL27 "serine carboxypeptidas 0.935 0.729 0.471 2.5e-81
TAIR|locus:2039275 452 scpl26 "serine carboxypeptidas 0.865 0.685 0.472 6e-80
TAIR|locus:2087368 502 scpl40 "serine carboxypeptidas 0.829 0.591 0.489 1.6e-77
TAIR|locus:2181504 scpl35 "serine carboxypeptidase-like 35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1169 (416.6 bits), Expect = 9.8e-119, P = 9.8e-119
 Identities = 217/326 (66%), Positives = 254/326 (77%)

Query:    37 DRVRDLPGQPKVEFKHYAGYVKLRPND-HKALFYWFFEAQKGVSSKPLVLWLNGGPGCSS 95
             D V  LPGQP V FKHYAGYV L P    KALFYWFFEAQ+  S +PLVLWLNGGPGCSS
Sbjct:    38 DLVTGLPGQPPVNFKHYAGYVNLGPEQKQKALFYWFFEAQQNSSRRPLVLWLNGGPGCSS 97

Query:    96 IAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQ 155
             IAYGAAQELGPFLV  NG +L +N +SWNK ANMLFLEAPVGVGFSYTNNS DL KLGD+
Sbjct:    98 IAYGAAQELGPFLVHDNGGKLTYNHFSWNKEANMLFLEAPVGVGFSYTNNSMDLQKLGDE 157

Query:   156 VTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLK 215
             VTA+DS AFLI WF +FP F+S +FYI+GESYAGHYVPQLAE+I++RN +  KDS INLK
Sbjct:   158 VTASDSLAFLINWFMKFPEFRSSEFYISGESYAGHYVPQLAEVIYDRNKKVTKDSSINLK 217

Query:   216 GFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSN--CNDHIRGF 273
             GFMIGNAVIN+ TD  GLVDYAWSHAIISD+++  I   C F +        C ++ +GF
Sbjct:   218 GFMIGNAVINEATDMAGLVDYAWSHAIISDEVHTSIHGSCSFEEDTTNKTEQCYNNFKGF 277

Query:   274 VEAYAEIDIYSIYSPVCLDSLDGKAP--PKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVM 331
             ++AY +IDIYSIY+PVCL SL   +P  PK++V+P LLT  DLW + P+GYDPC E Y  
Sbjct:   278 MDAYNDIDIYSIYTPVCLSSLLSSSPRKPKIVVSPRLLTFDDLWDKFPAGYDPCTESYAE 337

Query:   332 KFFNREDVQRALHANITKLSYPYTTC 357
              +FNR+DVQ ALHAN+T L YPY+ C
Sbjct:   338 NYFNRKDVQVALHANVTNLPYPYSPC 363
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
TAIR|locus:2166870 SCPL34 "serine carboxypeptidase-like 34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118706 BRS1 "BRI1 SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086137 scpl33 "serine carboxypeptidase-like 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008480 SCPL32 "serine carboxypeptidase-like 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061436 scpl22 "serine carboxypeptidase-like 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078598 scpl25 "serine carboxypeptidase-like 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077422 SCPL27 "serine carboxypeptidase-like 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039275 scpl26 "serine carboxypeptidase-like 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087368 scpl40 "serine carboxypeptidase-like 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LEY1SCP35_ARATH3, ., 4, ., 1, 6, ., -0.62460.96920.7229yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.160.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
pfam00450 415 pfam00450, Peptidase_S10, Serine carboxypeptidase 1e-126
COG2939 498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 3e-42
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 1e-37
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 5e-37
PTZ00472 462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 3e-36
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 4e-20
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  368 bits (948), Expect = e-126
 Identities = 131/314 (41%), Positives = 180/314 (57%), Gaps = 25/314 (7%)

Query: 50  FKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLV 109
           FK Y+GY+ +  +  ++LFYWFFE++    + PLVLWLNGGPGCSS+  G  +ELGPF V
Sbjct: 9   FKQYSGYLTVDESAGRSLFYWFFESENNPENDPLVLWLNGGPGCSSL-GGLFEELGPFRV 67

Query: 110 GGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWF 169
             +G  L  N YSWNK AN+LFL+ PVGVGFSY+N + D  K  D+ TA D+Y FL  +F
Sbjct: 68  N-SGPTLYLNPYSWNKVANVLFLDQPVGVGFSYSNTTSDY-KTDDEETAKDNYEFLQKFF 125

Query: 170 KRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTD 229
           ++FP +K++ FYIAGESYAGHYVP LA+ I + N + G    INLKG +IGN + +    
Sbjct: 126 EKFPEYKNNPFYIAGESYAGHYVPALAQEILDGNKK-GTGPNINLKGVLIGNGLTDPAIQ 184

Query: 230 TKGLVDYAWSHAIISDKLYKDISKECDFGQSMI---RSNCN---DHIRGFVEAYAEIDIY 283
               + +A+ H +ISD+LY+ + K C           + C    +   G       I+ Y
Sbjct: 185 YNSYIPFAYYHGLISDELYESLKKACCGKYPDCDPANTKCLNLVEEASGCNAYNGGINPY 244

Query: 284 SIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRAL 343
           +IY+P C +S     P                     GYD   E YV K+ NR DV++AL
Sbjct: 245 NIYTPCCYNSSLSLNPSST--------------DSCGGYDCYDESYVEKYLNRPDVRKAL 290

Query: 344 HANITKLSYPYTTC 357
           HAN   +   ++ C
Sbjct: 291 HANKGSV-GEWSRC 303

Length = 415
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 358
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02209 437 serine carboxypeptidase 100.0
PLN03016 433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 100.0
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 100.0
PLN02213 319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
KOG1283 414 consensus Serine carboxypeptidases [Posttranslatio 100.0
TIGR03611257 RutD pyrimidine utilization protein D. This protei 98.38
PRK00870302 haloalkane dehalogenase; Provisional 98.19
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 98.18
PHA02857276 monoglyceride lipase; Provisional 98.13
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.13
PLN02824294 hydrolase, alpha/beta fold family protein 98.07
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 97.98
PRK10673255 acyl-CoA esterase; Provisional 97.96
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 97.92
PRK06489360 hypothetical protein; Provisional 97.89
PLN02298330 hydrolase, alpha/beta fold family protein 97.86
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 97.85
PRK03592295 haloalkane dehalogenase; Provisional 97.83
PLN02385349 hydrolase; alpha/beta fold family protein 97.81
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 97.79
PRK03204286 haloalkane dehalogenase; Provisional 97.74
PLN02652395 hydrolase; alpha/beta fold family protein 97.68
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.6
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.58
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 97.55
PLN02894402 hydrolase, alpha/beta fold family protein 97.54
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 97.53
PLN03084383 alpha/beta hydrolase fold protein; Provisional 97.49
PLN02679360 hydrolase, alpha/beta fold family protein 97.48
PRK05077414 frsA fermentation/respiration switch protein; Revi 97.47
PRK10749330 lysophospholipase L2; Provisional 97.45
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 97.4
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 97.36
PRK10349256 carboxylesterase BioH; Provisional 97.35
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 97.34
PLN02578354 hydrolase 97.29
PLN02211273 methyl indole-3-acetate methyltransferase 97.19
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 97.19
PLN02965255 Probable pheophorbidase 97.19
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 97.18
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 97.18
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 96.9
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 96.81
PRK08775343 homoserine O-acetyltransferase; Provisional 96.77
PRK05855 582 short chain dehydrogenase; Validated 96.76
COG2267298 PldB Lysophospholipase [Lipid metabolism] 96.75
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 96.73
PLN02442283 S-formylglutathione hydrolase 96.7
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 96.66
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 96.58
KOG1455313 consensus Lysophospholipase [Lipid transport and m 96.44
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 96.42
PRK10566249 esterase; Provisional 96.41
PLN02511388 hydrolase 96.4
KOG2564343 consensus Predicted acetyltransferases and hydrola 96.39
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 96.27
PRK10985324 putative hydrolase; Provisional 96.08
PRK07581339 hypothetical protein; Validated 96.03
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 95.98
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 95.85
PRK10115686 protease 2; Provisional 95.84
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 95.81
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 95.81
PRK00175379 metX homoserine O-acetyltransferase; Provisional 95.65
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 95.53
PRK10162318 acetyl esterase; Provisional 95.43
PLN00021313 chlorophyllase 95.32
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 95.23
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 94.72
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 94.67
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 94.63
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 94.44
COG4099387 Predicted peptidase [General function prediction o 94.2
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 93.76
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 93.51
PF10503220 Esterase_phd: Esterase PHB depolymerase 93.24
KOG1838409 consensus Alpha/beta hydrolase [General function p 92.83
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 92.74
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 92.55
PRK11460232 putative hydrolase; Provisional 92.47
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 92.14
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 91.64
COG0657312 Aes Esterase/lipase [Lipid metabolism] 91.6
KOG3975301 consensus Uncharacterized conserved protein [Funct 90.24
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 89.85
PLN02872395 triacylglycerol lipase 89.43
COG0400207 Predicted esterase [General function prediction on 89.32
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 88.74
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 87.83
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 87.82
PLN02454414 triacylglycerol lipase 87.72
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 87.49
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 87.15
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 86.89
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 86.28
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 86.19
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 84.44
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 84.29
PRK13604307 luxD acyl transferase; Provisional 83.78
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 83.72
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 82.5
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 80.86
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 80.83
PF10081289 Abhydrolase_9: Alpha/beta-hydrolase family; InterP 80.04
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=7.1e-91  Score=688.07  Aligned_cols=307  Identities=48%  Similarity=0.927  Sum_probs=275.0

Q ss_pred             cccccCceecCCCCCC-CCceEEEEEEEecCCCCceEEEEEEeccCCCCCCCeEEEECCCCChhhhhhhhhhhcCCeEEc
Q 018329           32 TEADADRVRDLPGQPK-VEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVG  110 (358)
Q Consensus        32 ~~~~~~~v~~lpg~~~-~~~~~ysGyl~v~~~~~~~lfywf~~s~~~~~~~pl~lwlnGGPG~Ss~~~g~~~e~GP~~~~  110 (358)
                      ..+++++|+.|||++. ++|++|||||+|+++.+++||||||||+++|++|||||||||||||||++ |+|.|+|||+++
T Consensus        23 ~~~~~~~I~~LPG~~~~~~f~~ysGYv~v~~~~~~~LFYwf~eS~~~P~~dPlvLWLnGGPGCSSl~-G~~~E~GPf~v~  101 (454)
T KOG1282|consen   23 HVDEADLIKSLPGQPGPLPFKQYSGYVTVNESEGRQLFYWFFESENNPETDPLVLWLNGGPGCSSLG-GLFEENGPFRVK  101 (454)
T ss_pred             ccchhhhhhcCCCCCCCCCcccccceEECCCCCCceEEEEEEEccCCCCCCCEEEEeCCCCCccchh-hhhhhcCCeEEc
Confidence            3458899999999985 89999999999998889999999999999999999999999999999996 999999999999


Q ss_pred             CCCCeeecCCCCcccccceeEeecCcccccccccCCCcccccCcHHHHHHHHHHHHHHHHHCCCCCCCCeEEeccccCCc
Q 018329          111 GNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGH  190 (358)
Q Consensus       111 ~~~~~l~~n~~sW~~~an~l~iDqP~G~GfSy~~~~~~~~~~~~~~~a~~~~~fl~~f~~~fp~~~~~~~yi~GeSYgG~  190 (358)
                      .||.+|..||||||+.||||||||||||||||+++..++.+ +|+.+|+|++.||++||++||||++|+|||+|||||||
T Consensus       102 ~~G~tL~~N~ySWnk~aNiLfLd~PvGvGFSYs~~~~~~~~-~D~~~A~d~~~FL~~wf~kfPey~~~~fyI~GESYAG~  180 (454)
T KOG1282|consen  102 YNGKTLYLNPYSWNKEANILFLDQPVGVGFSYSNTSSDYKT-GDDGTAKDNYEFLQKWFEKFPEYKSNDFYIAGESYAGH  180 (454)
T ss_pred             CCCCcceeCCccccccccEEEEecCCcCCccccCCCCcCcC-CcHHHHHHHHHHHHHHHHhChhhcCCCeEEecccccce
Confidence            99999999999999999999999999999999999888876 99999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHHhhccCCCceeeeeeeEeeccccCCCCCCcchhhhhhhcccCCHHHHHHHHhhccCCC------CCCch
Q 018329          191 YVPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQ------SMIRS  264 (358)
Q Consensus       191 yvp~la~~i~~~~~~~~~~~~inLkGi~igng~~d~~~q~~~~~~~~~~~gli~~~~~~~~~~~C~~~~------~~~~~  264 (358)
                      |||+||++|+++|+.. ..+.|||||++||||++|+..|..++++|++.||+|++++++.+++.|....      ...+.
T Consensus       181 YVP~La~~I~~~N~~~-~~~~iNLkG~~IGNg~td~~~~~~~~~~~a~~h~liSde~~~~l~~~C~~~~~~~~~~~~~~~  259 (454)
T KOG1282|consen  181 YVPALAQEILKGNKKC-CKPNINLKGYAIGNGLTDPEIDYNGRIPFAWGHGLISDELYESLKRACDFSSDNYANVDPSNT  259 (454)
T ss_pred             ehHHHHHHHHhccccc-cCCcccceEEEecCcccCccccccchhhhhhhcccCCHHHHHHHHHHhccCcccccccCCchh
Confidence            9999999999998753 3478999999999999999999999999999999999999999999998732      23467


Q ss_pred             hhHHHHhhHh-hhcCCCCccccccccCcCCCCCCCCCccccCCccccccccccCCCCCCCCCCcchHhhcCChHHHHHhh
Q 018329          265 NCNDHIRGFV-EAYAEIDIYSIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRAL  343 (358)
Q Consensus       265 ~C~~~~~~~~-~~~~~iN~YdI~~~~C~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~pC~~~~~~~YLN~pdVqkAL  343 (358)
                      +|.++++.+. ...++++.|+|+.+.|......     .    +       ......++++|.+++.++|||+|+||+||
T Consensus       260 ~C~~~~~~~~~~~~~~i~~y~i~~~~C~~~~~~-----~----~-------~~~~~~~~~~c~~~~~~~ylN~~~VrkAL  323 (454)
T KOG1282|consen  260 KCNKAVEEFDSKTTGDIDNYYILTPDCYPTSYE-----L----K-------KPTDCYGYDPCLSDYAEKYLNRPEVRKAL  323 (454)
T ss_pred             HHHHHHHHHHHHHhccCchhhhcchhhcccccc-----c----c-------ccccccccCCchhhhHHHhcCCHHHHHHh
Confidence            9999999998 5557999999999999752100     0    0       01112456899988779999999999999


Q ss_pred             CCCCCCCCCCcccCC
Q 018329          344 HANITKLSYPYTTCR  358 (358)
Q Consensus       344 hV~~~~~~~~W~~Cs  358 (358)
                      ||+.+..+ +|++||
T Consensus       324 h~~~~~~~-~W~~Cn  337 (454)
T KOG1282|consen  324 HANKTSIG-KWERCN  337 (454)
T ss_pred             CCCCCCCC-cccccC
Confidence            99986544 799997

>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF10081 Abhydrolase_9: Alpha/beta-hydrolase family; InterPro: IPR012037 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 2e-71
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 2e-71
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 3e-71
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 4e-71
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 2e-57
1ivy_A 452 Physiological Dimer Hpp Precursor Length = 452 3e-42
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 6e-42
1wpx_A 421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 3e-29
1cpy_A 421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 8e-28
1ac5_A 483 Crystal Structure Of Kex1(delta)p, A Prohormone-pro 3e-24
1bcr_B 160 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 6e-06
1wht_B 153 Structure Of The Complex Of L-Benzylsuccinate With 7e-06
3sc2_B 152 Refined Atomic Model Of Wheat Serine Carboxypeptida 7e-06
1whs_B 153 Structure Of The Complex Of L-Benzylsuccinate With 7e-06
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure 
Iteration: 1

 Score =  266 bits (679), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 130/257 (50%), Positives = 172/257 (66%), Gaps = 8/257 (3%)
Query: 36  ADRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSS 95
           ADR+  LPGQP V+F  Y+GY+ +     ++LFY   EA +     PLVLWLNGGPGCSS
Sbjct: 8   ADRIARLPGQPAVDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCSS 67
Query: 96  IAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQ 155
           +AYGA++ELG F V   G+ L  N+Y WNK AN+LFL++P GVGFSYTN S D++  GD 
Sbjct: 68  VAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGDN 127
Query: 156 VTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLK 215
            TA+DSYAFL  WF+RFP++K  DFYIAGESYAGHYVP+L++L+H       K+  INLK
Sbjct: 128 RTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRS-----KNPVINLK 182
Query: 216 GFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSN--CNDHIRGF 273
           GFM+GN +I+D  D  G  ++ W+H I+SD  Y+ + + C    S I  +  C+      
Sbjct: 183 GFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEAC-LHDSFIHPSPACDAATDVA 241
Query: 274 VEAYAEIDIYSIYSPVC 290
                 ID+YS+Y+PVC
Sbjct: 242 TAEQGNIDMYSLYTPVC 258
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure
>pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 Back     alignment and structure
>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 160 Back     alignment and structure
>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 152 Back     alignment and structure
>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 1e-134
1ivy_A 452 Human protective protein; carboxypeptidase, serine 1e-129
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 1e-128
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 1e-127
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 1e-117
1gxs_B 158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 3e-10
1whs_B 153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
 Score =  382 bits (982), Expect = e-134
 Identities = 128/256 (50%), Positives = 170/256 (66%), Gaps = 6/256 (2%)

Query: 36  ADRVRDLPGQPKVEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSS 95
           ADR+  LPGQP V+F  Y+GY+ +     ++LFY   EA +     PLVLWLNGGPGCSS
Sbjct: 3   ADRIARLPGQPAVDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCSS 62

Query: 96  IAYGAAQELGPFLVGGNGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQ 155
           +AYGA++ELG F V   G+ L  N+Y WNK AN+LFL++P GVGFSYTN S D++  GD 
Sbjct: 63  VAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGDN 122

Query: 156 VTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHYVPQLAELIHERNIRAGKDSFINLK 215
            TA+DSYAFL  WF+RFP++K  DFYIAGESYAGHYVP+L++L+H        +  INLK
Sbjct: 123 RTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRSK-----NPVINLK 177

Query: 216 GFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQSMIRSN-CNDHIRGFV 274
           GFM+GN +I+D  D  G  ++ W+H I+SD  Y+ + + C     +  S  C+       
Sbjct: 178 GFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPACDAATDVAT 237

Query: 275 EAYAEIDIYSIYSPVC 290
                ID+YS+Y+PVC
Sbjct: 238 AEQGNIDMYSLYTPVC 253
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
1ivy_A 452 Human protective protein; carboxypeptidase, serine 100.0
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.47
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.39
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 98.37
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.37
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.35
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.3
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.29
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.29
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.27
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.25
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 98.25
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.25
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 98.24
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 98.23
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.22
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.21
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.21
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.21
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.2
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 98.2
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 98.17
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.16
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.16
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.14
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.14
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.14
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.09
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.07
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.07
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.06
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 98.04
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 98.04
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 98.04
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.04
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.03
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 98.02
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 98.01
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.0
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.0
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 98.0
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 97.99
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 97.99
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 97.99
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 97.98
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 97.98
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 97.97
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 97.97
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 97.96
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 97.96
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 97.96
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.96
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 97.96
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 97.95
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 97.94
3h04_A275 Uncharacterized protein; protein with unknown func 97.93
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 97.93
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 97.92
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 97.91
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 97.89
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 97.88
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 97.86
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 97.86
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 97.85
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 97.82
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 97.8
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 97.8
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 97.78
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 97.77
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 97.77
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 97.75
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 97.75
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 97.74
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 97.73
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 97.72
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 97.72
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 97.72
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 97.71
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.71
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 97.69
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 97.67
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 97.67
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 97.66
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 97.65
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 97.64
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 97.64
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.64
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 97.64
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 97.62
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.62
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 97.61
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.6
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 97.59
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 96.75
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 97.58
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 97.57
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.53
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.51
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 97.5
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 97.49
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 97.49
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 97.49
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 97.47
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 97.47
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 97.45
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 97.45
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 97.43
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 97.43
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 97.42
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.4
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 97.4
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.39
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 97.38
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 97.38
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 97.37
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 97.36
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 97.35
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 97.34
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 97.34
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 97.33
1r3d_A264 Conserved hypothetical protein VC1974; structural 97.33
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.32
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 97.31
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 97.29
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.26
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.25
3ain_A323 303AA long hypothetical esterase; carboxylesterase 97.24
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.22
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.22
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 97.21
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 97.21
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 97.21
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 97.2
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 97.19
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 97.18
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.16
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 97.15
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 97.14
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.14
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.12
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 97.12
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 97.1
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 97.09
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 97.07
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.05
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.05
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 97.02
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 97.01
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 97.0
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.0
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 96.95
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 96.93
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 96.9
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 96.89
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 96.88
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 96.88
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 96.88
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 96.86
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 96.84
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 96.81
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 96.79
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 96.78
3bjr_A283 Putative carboxylesterase; structural genomics, jo 96.71
1vkh_A273 Putative serine hydrolase; structural genomics, jo 96.7
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 96.68
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 96.63
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 96.5
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 96.46
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 96.36
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 96.35
3tej_A329 Enterobactin synthase component F; nonribosomal pe 96.35
1kez_A300 Erythronolide synthase; polyketide synthase, modul 96.32
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 96.3
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 96.29
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 96.27
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 96.18
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 96.18
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 95.99
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 95.98
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 95.94
3nuz_A398 Putative acetyl xylan esterase; structural genomic 95.85
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 95.77
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 95.74
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 95.72
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 95.66
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 95.66
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 95.61
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 95.59
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 95.58
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 95.46
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 95.45
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 95.23
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 95.13
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 95.11
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 95.04
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 95.02
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 95.01
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 94.9
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 94.8
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 94.56
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 94.3
3d59_A383 Platelet-activating factor acetylhydrolase; secret 94.3
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 94.21
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 94.18
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 94.16
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 94.14
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 94.07
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 94.04
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 93.95
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 93.85
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 93.84
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 93.8
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 93.75
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 93.73
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 93.69
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 93.2
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 92.96
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 92.53
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 92.41
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 92.3
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 91.52
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 91.28
3lp5_A250 Putative cell surface hydrolase; structural genom 89.68
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 88.47
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 88.43
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 88.29
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 88.21
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 88.11
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 87.84
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 87.82
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 86.73
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 86.47
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 86.12
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 85.45
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 85.37
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 85.05
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 84.68
4f21_A246 Carboxylesterase/phospholipase family protein; str 84.14
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 83.81
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 82.54
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 80.53
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 80.51
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
Probab=100.00  E-value=1e-82  Score=602.88  Aligned_cols=282  Identities=35%  Similarity=0.728  Sum_probs=227.3

Q ss_pred             ccccCceecCCCCCC-CCceEEEEEEEecCCCCceEEEEEEeccCCCCCCCeEEEECCCCChhhhhhhhhhhcCCeEEcC
Q 018329           33 EADADRVRDLPGQPK-VEFKHYAGYVKLRPNDHKALFYWFFEAQKGVSSKPLVLWLNGGPGCSSIAYGAAQELGPFLVGG  111 (358)
Q Consensus        33 ~~~~~~v~~lpg~~~-~~~~~ysGyl~v~~~~~~~lfywf~~s~~~~~~~pl~lwlnGGPG~Ss~~~g~~~e~GP~~~~~  111 (358)
                      +++.|+|++|||++. +++++|||||++++  +++||||||||+++|+++||||||||||||||+ +|+|+|+|||+++.
T Consensus         3 ap~~d~V~~LPG~~~~~~~~~ysGyv~v~~--~~~lFywf~es~~~p~~~Pl~lWlnGGPGcSS~-~g~~~E~GP~~~~~   79 (300)
T 4az3_A            3 APDQDEIQRLPGLAKQPSFRQYSGYLKGSG--SKHLHYWFVESQKDPENSPVVLWLNGGPGCSSL-DGLLTEHGPFLVQP   79 (300)
T ss_dssp             CCGGGBCCCCTTBSSCCSSCEEEEEEECST--TEEEEEEEECCSSCTTTSCEEEEECCTTTBCTH-HHHHHTTSSEEECT
T ss_pred             CCCcCccccCcCcCCCCCcceeeeeeecCC--CCeEEEEEEEcCCCCCCCCEEEEECCCCcHHHH-HHHHhcCCCceecC
Confidence            457899999999984 89999999999974  689999999999999999999999999999999 69999999999999


Q ss_pred             CCCeeecCCCCcccccceeEeecCcccccccccCCCcccccCcHHHHHHHHHHHHHHHHHCCCCCCCCeEEeccccCCcc
Q 018329          112 NGSRLKFNKYSWNKAANMLFLEAPVGVGFSYTNNSEDLHKLGDQVTANDSYAFLIGWFKRFPNFKSHDFYIAGESYAGHY  191 (358)
Q Consensus       112 ~~~~l~~n~~sW~~~an~l~iDqP~G~GfSy~~~~~~~~~~~~~~~a~~~~~fl~~f~~~fp~~~~~~~yi~GeSYgG~y  191 (358)
                      ++.+++.|||||++.|||||||||+||||||+.+.. +.+ +++++|+|++.||++||++||+|++++|||+||||||||
T Consensus        80 ~~~~l~~N~~sW~~~an~lfiD~PvGtGfSy~~~~~-~~~-~~~~~a~d~~~fl~~f~~~fp~~~~~~~yi~GESY~G~y  157 (300)
T 4az3_A           80 DGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKF-YAT-NDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIY  157 (300)
T ss_dssp             TSSCEEECTTCGGGSSEEEEECCSTTSTTCEETTCC-CCC-BHHHHHHHHHHHHHHHHHHCGGGTTSCEEEEEETTHHHH
T ss_pred             CCccccccCccHHhhhcchhhcCCCcccccccCCCc-ccc-cchhhHHHHHHHHHHHHHhChhhcCCceEEEecCCceee
Confidence            988999999999999999999999999999987653 444 889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhccCCCceeeeeeeEeeccccCCCCCCcchhhhhhhcccCCHHHHHHHHhhccCCC-----CCCchhh
Q 018329          192 VPQLAELIHERNIRAGKDSFINLKGFMIGNAVINDPTDTKGLVDYAWSHAIISDKLYKDISKECDFGQ-----SMIRSNC  266 (358)
Q Consensus       192 vp~la~~i~~~~~~~~~~~~inLkGi~igng~~d~~~q~~~~~~~~~~~gli~~~~~~~~~~~C~~~~-----~~~~~~C  266 (358)
                      ||.||.+|++++       +||||||+|||||+||..|..++++|+|+||+|++++++.+++.|....     ...+.+|
T Consensus       158 vP~~a~~i~~~~-------~inLkG~~iGNg~~d~~~~~~~~~~fa~~~gli~~~~~~~~~~~c~~~~~~~~~~~~~~~C  230 (300)
T 4az3_A          158 IPTLAVLVMQDP-------SMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLEC  230 (300)
T ss_dssp             HHHHHHHHTTCT-------TSCEEEEEEESCCSBHHHHHHHHHHHHHHTTSSCHHHHHHHHHHTEETTEECCSSCCCHHH
T ss_pred             HHHHHHHHHhCC-------CcccccceecCCccCHHHhcchhHHHHhhcCcCCHHHHHHHHHHHHHhhccCcCCCCcHHH
Confidence            999999998754       4999999999999999999999999999999999999999999886421     2456789


Q ss_pred             HHHHhhHhhhc--CCCCccccccccCcCCCCCCCCCccccCCccccccccccCCCCCCCCCCcchHhhcCChHHHHHhhC
Q 018329          267 NDHIRGFVEAY--AEIDIYSIYSPVCLDSLDGKAPPKLMVAPHLLTQHDLWHRLPSGYDPCAEDYVMKFFNREDVQRALH  344 (358)
Q Consensus       267 ~~~~~~~~~~~--~~iN~YdI~~~~C~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~pC~~~~~~~YLN~pdVqkALh  344 (358)
                      ..+++.+.+.+  .++|+||||.+ |.......                    ..-..++|...++..|||+++||+|||
T Consensus       231 ~~~~~~~~~~~~~~~~N~YdI~~~-C~~~~~~~--------------------~~y~~~~~~~~~l~~y~nr~dV~~alh  289 (300)
T 4az3_A          231 VTNLQEVARIVGNSGLNIYNLYAP-CAGGVPSH--------------------FRYEKDTVVVQDLGNIFTRLPLKRMWH  289 (300)
T ss_dssp             HHHHHHHHHHHHSSSCCTTCTTSC-CTTCCC-------------------------------------------------
T ss_pred             HHHHHHHHHHhccCCCChhhccCc-CCCCCCcc--------------------ccccCChhHHHHHhCcCChHHHHHHhC
Confidence            99999988766  57999999998 86532110                    001124777778889999999999999


Q ss_pred             CCC
Q 018329          345 ANI  347 (358)
Q Consensus       345 V~~  347 (358)
                      ++-
T Consensus       290 a~~  292 (300)
T 4az3_A          290 QAL  292 (300)
T ss_dssp             ---
T ss_pred             cch
Confidence            975
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 358
g1wht.1 409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 3e-91
g1gxs.1 425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 2e-84
d1ivya_ 452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 3e-83
d1ac5a_ 483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 8e-76
d1wpxa1 421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 9e-70
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 100.0
g1gxs.1 425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.84
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.59
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.48
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.43
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.38
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.26
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.25
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.24
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.22
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 98.15
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.13
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.0
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 97.99
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.95
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.94
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 97.91
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 97.9
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 97.89
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 97.78
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 97.73
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 97.69
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.61
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.6
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.54
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 97.48
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 97.44
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 97.4
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 97.37
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.35
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 97.22
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 97.2
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 97.12
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 97.0
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 96.9
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 96.71
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 96.63
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 96.37
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 96.31
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 96.04
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 95.9
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 95.61
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 95.53
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 95.5
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 95.49
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 95.36
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 95.23
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 95.12
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 95.1
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.07
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 94.96
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 94.81
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 94.79
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 94.28
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 94.12
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 93.9
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 93.38
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 93.32
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 93.17
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 93.12
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 93.03
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 92.96
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 92.53
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 92.14
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 91.39
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 89.73
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 89.69
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 89.44
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 89.28
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 89.0
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 87.88
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 87.06
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 86.25
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 84.95
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 84.48
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 82.13
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 81.75
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 81.5
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 80.7
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure