Citrus Sinensis ID: 018519

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----

MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLKNFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWKGVLTAEDARIAVQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWDASLPRPVPRL

ccccccHHHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccEEEcccccccccEEcHHHHHcccccHHHHHHHHHHHHccccEEEcccccccHHHHHHccccccEEEEcccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHcccccEEEEEcccHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHccccEEEcHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEcccccccccccccc

cccEEEHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEEEcccccccEEEEcccccccEEEccccHcccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHccccEEEEEEccHHccccHHHHHccccccccccHHHHHccccccccccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccEEEccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHEccccccccccccccc

MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFsrilfrprilidvskidmnttvlgfkismpimiaptamqkmahpegeyATARAASAAGTIMtlsswstssveevastgpgirfFQLYVYKDRNVVAQLVRRAERAGFKAIALtvdtprlgrreadiknrftlppfltlknfqgldlgkmdeandSGLAAYVAGQIdrslswkgvltaEDARIAVQAGAAGIIvsnhgarqldyvpATIMALEEVVKATqgripvfldggvrrgTDVFKALALgasgifigrpVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVtewdaslprpvprl

MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFrprilidvskidMNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRaeragfkaialtvdtprlgrreadiknrftlppfltlkNFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWKGVLTAEDARIAVQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATqgripvfldggvrRGTDVFKALAlgasgifigRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHivtewdaslprpvprl

MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMNTTVLGFKISMPIMIAPTAMQKMAHPEGEYataraasaaGTIMTLSSWSTSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLKNFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWKGVLTAEDariavqagaagiivSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWDASLPRPVPRL

******VMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMNTTVLGFKISMPIMIAPTAM*****************AAGTIMTLSSWSTSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLKNFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWKGVLTAEDARIAVQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWD**********

*GEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLKNFQGLDLGKM**ANDSGLAAYVAGQIDRSLSWKGVLTAEDARIAVQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWDASL*******

MGEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLS***********STGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLKNFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWKGVLTAEDARIAVQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWDASLPRPVPRL

*GEITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMNTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLKNFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWKGVLTAEDARIAVQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTE************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		354	2.2.26 [Sep-21-2011]
Q9LRR9		367	Peroxisomal (S)-2-hydroxy	yes	no	0.988	0.953	0.866	1e-180
P05414		369	Peroxisomal (S)-2-hydroxy	N/A	no	0.994	0.953	0.847	1e-178
Q9LRS0		367	Peroxisomal (S)-2-hydroxy	yes	no	0.988	0.953	0.850	1e-177
O49506		368	Peroxisomal (S)-2-hydroxy	no	no	0.966	0.929	0.824	1e-173
Q10CE4		369	Peroxisomal (S)-2-hydroxy	yes	no	0.997	0.956	0.818	1e-171
B8AKX6		369	Peroxisomal (S)-2-hydroxy	N/A	no	0.997	0.956	0.818	1e-171
Q6YT73		369	Peroxisomal (S)-2-hydroxy	no	no	0.971	0.932	0.825	1e-169
B8B7C5		369	Peroxisomal (S)-2-hydroxy	N/A	no	0.971	0.932	0.825	1e-169
Q7FAS1		367	Peroxisomal (S)-2-hydroxy	no	no	0.971	0.937	0.780	1e-160
B8AUI3		367	Peroxisomal (S)-2-hydroxy	N/A	no	0.971	0.937	0.780	1e-160

>sp\|Q9LRR9\|GLO1_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Arabidopsis thaliana GN=GLO1 PE=1 SV=1	Back alignment and function desciption

 Score =  632 bits (1629), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 319/368 (86%), Positives = 338/368 (91%), Gaps = 18/368 (4%)

Query: 3   EITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMN 62
           EITNV EY+AIAK+KLPKMV+DYYASGAEDQWTLQENRNAF+RILFRPRILIDVSKIDM 
Sbjct: 2   EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT 61

Query: 63  TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGP 122
           TTVLGFKISMPIM+APTAMQKMAHP+GEYATARAASAAGTIMTLSSW+TSSVEEVASTGP
Sbjct: 62  TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 121

Query: 123 GIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 182
           GIRFFQLYVYK+RNVV QLVRRAERAGFKAIALTVDTPRLGRRE+DIKNRFTLPP LTLK
Sbjct: 122 GIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTLK 181

Query: 183 NFQGLDLGKMDEANDSGLAAYVAGQIDRSLSW----------------KGVLTAEDARIA 226
           NF+GLDLGKMDEANDSGLA+YVAGQIDR+LSW                KGVLT EDARIA
Sbjct: 182 NFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARIA 241

Query: 227 VQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG 286
           +QAGAAGIIVSNHGARQLDYVPATI ALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG
Sbjct: 242 IQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG 301

Query: 287 ASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWDAS 346
           ASGIFIGRPVV+SLAAEGE GVR+VL+MLR+EFEL MALSGCRSLKEI+R+HI TEWD  
Sbjct: 302 ASGIFIGRPVVFSLAAEGEAGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDT- 360

Query: 347 LPRPVPRL 354
            PRP  RL
Sbjct: 361 -PRPSARL 367

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 5

>sp\|P05414\|GOX_SPIOL Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1	Back alignment and function description

>sp\|Q9LRS0\|GLO2_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Arabidopsis thaliana GN=GLO2 PE=1 SV=1	Back alignment and function description

>sp\|O49506\|GLO5_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Arabidopsis thaliana GN=GLO5 PE=1 SV=1	Back alignment and function description

>sp\|Q10CE4\|GLO1_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. japonica GN=GLO1 PE=1 SV=1	Back alignment and function description

>sp\|B8AKX6\|GLO1_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. indica GN=GLO1 PE=3 SV=1	Back alignment and function description

>sp\|Q6YT73\|GLO5_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. japonica GN=GLO5 PE=2 SV=1	Back alignment and function description

>sp\|B8B7C5\|GLO5_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. indica GN=GLO5 PE=3 SV=1	Back alignment and function description

>sp\|Q7FAS1\|GLO3_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. japonica GN=GLO3 PE=2 SV=1	Back alignment and function description

>sp\|B8AUI3\|GLO3_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. indica GN=GLO3 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		354
147789493		371	hypothetical protein VITISV_005886 [Viti	0.994	0.948	0.870	0.0
189418957		369	glycolate oxidase [Mikania micrantha]	0.991	0.951	0.863	0.0
323650489		370	glycolate oxidase [Mangifera indica]	1.0	0.956	0.878	0.0
297790174		369	hypothetical protein ARALYDRAFT_333142 [	0.994	0.953	0.880	0.0
304368145		371	glycolate oxidase [Nicotiana benthamiana	0.994	0.948	0.873	0.0
225462096		371	PREDICTED: peroxisomal (S)-2-hydroxy-aci	0.994	0.948	0.872	1e-180
224117076		369	predicted protein [Populus trichocarpa]	0.994	0.953	0.872	1e-180
224121620		369	predicted protein [Populus trichocarpa]	0.994	0.953	0.875	1e-180
366984550		367	glycolate oxidase [Gossypium hirsutum]	0.988	0.953	0.872	1e-180
359806771		371	peroxisomal (S)-2-hydroxy-acid oxidase G	0.994	0.948	0.870	1e-179

>gi\|147789493\|emb\|CAN67413.1\| hypothetical protein VITISV_005886 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/370 (87%), Positives = 341/370 (92%), Gaps = 18/370 (4%)

Query: 3   EITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMN 62
           EITNV EYEAIAK+KLPKMVFDYYASGAEDQWTL +NR+AFS+ILFRPRILIDVSKIDM 
Sbjct: 2   EITNVTEYEAIAKQKLPKMVFDYYASGAEDQWTLYQNRHAFSQILFRPRILIDVSKIDMT 61

Query: 63  TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGP 122
           TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASA GTIMTLSSW+TSSVEEVASTGP
Sbjct: 62  TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASATGTIMTLSSWATSSVEEVASTGP 121

Query: 123 GIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 182
           GIRFFQLYVYKDR+VVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK
Sbjct: 122 GIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 181

Query: 183 NFQGLDLGKMDEANDSGLAAYVAGQIDRSLSW----------------KGVLTAEDARIA 226
           NF+GLDLGKMD+A+DSGLA+YVAGQIDR+LSW                KGVLTAED R+A
Sbjct: 182 NFEGLDLGKMDKADDSGLASYVAGQIDRTLSWKDVKWLQTITNLPILVKGVLTAEDTRLA 241

Query: 227 VQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG 286
           +QAGAAGIIVSNHGARQLDYVPATIMALEEVVKA QGR+PVFLDGGVRRGTDVFKALALG
Sbjct: 242 IQAGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRVPVFLDGGVRRGTDVFKALALG 301

Query: 287 ASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWDAS 346
           ASGIFIGRPVV+SLAAEGE GVR+VL+MLREEFEL MALSGCRSLKEITRDHIVTEW+  
Sbjct: 302 ASGIFIGRPVVFSLAAEGEAGVRKVLQMLREEFELTMALSGCRSLKEITRDHIVTEWEVP 361

Query: 347 LP--RPVPRL 354
            P  RP+PRL
Sbjct: 362 HPGSRPLPRL 371

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|189418957\|gb\|ACD93720.1\| glycolate oxidase [Mikania micrantha]	Back alignment and taxonomy information

>gi\|323650489\|gb\|ADX97325.1\| glycolate oxidase [Mangifera indica]	Back alignment and taxonomy information

>gi|297790174|ref|XP_002862992.1| hypothetical protein ARALYDRAFT_333142 [Arabidopsis lyrata subsp. lyrata] gi|297839705|ref|XP_002887734.1| hypothetical protein ARALYDRAFT_895734 [Arabidopsis lyrata subsp. lyrata] gi|297308786|gb|EFH39251.1| hypothetical protein ARALYDRAFT_333142 [Arabidopsis lyrata subsp. lyrata] gi|297333575|gb|EFH63993.1| hypothetical protein ARALYDRAFT_895734 [Arabidopsis lyrata subsp. lyrata]

Back alignment and taxonomy information

>gi\|304368145\|gb\|ADM26718.1\| glycolate oxidase [Nicotiana benthamiana]	Back alignment and taxonomy information

>gi\|225462096\|ref\|XP_002277249.1\| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Vitis vinifera] gi\|296086772\|emb\|CBI32921.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224117076\|ref\|XP_002317470.1\| predicted protein [Populus trichocarpa] gi\|118489504\|gb\|ABK96554.1\| unknown [Populus trichocarpa x Populus deltoides] gi\|222860535\|gb\|EEE98082.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224121620\|ref\|XP_002330746.1\| predicted protein [Populus trichocarpa] gi\|118486606\|gb\|ABK95141.1\| unknown [Populus trichocarpa] gi\|222872522\|gb\|EEF09653.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|366984550\|gb\|AEX09184.1\| glycolate oxidase [Gossypium hirsutum]	Back alignment and taxonomy information

>gi\|359806771\|ref\|NP_001241302.1\| peroxisomal (S)-2-hydroxy-acid oxidase GLO1-like [Glycine max] gi\|167961875\|dbj\|BAG09382.1\| peroxisomal glycolate oxidase [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		354
TAIR\|locus:2091642		367	GOX1 "glycolate oxidase 1" [Ar	0.988	0.953	0.807	6e-151
UNIPROTKB\|B8AKX6		369	GLO1 "Peroxisomal (S)-2-hydrox	0.997	0.956	0.764	2.8e-144
UNIPROTKB\|Q10CE4		369	GLO1 "Peroxisomal (S)-2-hydrox	0.997	0.956	0.764	2.8e-144
UNIPROTKB\|B8B7C5		369	GLO5 "Peroxisomal (S)-2-hydrox	0.971	0.932	0.772	3.3e-143
UNIPROTKB\|Q6YT73		369	GLO5 "Peroxisomal (S)-2-hydrox	0.971	0.932	0.772	3.3e-143
TAIR\|locus:2124499		368	GOX3 "glycolate oxidase 3" [Ar	0.966	0.929	0.768	9.9e-142
UNIPROTKB\|B8AUI3		367	GLO3 "Peroxisomal (S)-2-hydrox	0.963	0.929	0.731	5.4e-134
UNIPROTKB\|Q7FAS1		367	GLO3 "Peroxisomal (S)-2-hydrox	0.963	0.929	0.731	5.4e-134
UNIPROTKB\|Q01KC2		368	GLO2 "Peroxisomal (S)-2-hydrox	0.971	0.934	0.633	3e-117
UNIPROTKB\|Q7XPR4		368	GLO2 "Peroxisomal (S)-2-hydrox	0.971	0.934	0.633	3e-117

TAIR\|locus:2091642 GOX1 "glycolate oxidase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1473 (523.6 bits), Expect = 6.0e-151, P = 6.0e-151
 Identities = 297/368 (80%), Positives = 315/368 (85%)

Query:     3 EITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMN 62
             EITNV EY+AIAK+KLPKMV+DYYASGAEDQWTLQENRNAF+RILFRPRILIDVSKIDM 
Sbjct:     2 EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT 61

Query:    63 TTVLGFKISMPIMIAPTAMQKMAHPEGEYXXXXXXXXXGTIMTLSSWSTSSVEEVASTGP 122
             TTVLGFKISMPIM+APTAMQKMAHP+GEY         GTIMTLSSW+TSSVEEVASTGP
Sbjct:    62 TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 121

Query:   123 GIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 182
             GIRFFQLYVYK+RNVV QLVRRAERAGFKAIALTVDTPRLGRRE+DIKNRFTLPP LTLK
Sbjct:   122 GIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTLK 181

Query:   183 NFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWK----------------GVLTAEDXXXX 226
             NF+GLDLGKMDEANDSGLA+YVAGQIDR+LSWK                GVLT ED    
Sbjct:   182 NFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARIA 241

Query:   227 XXXXXXXXXXSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG 286
                       SNHGARQLDYVPATI ALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG
Sbjct:   242 IQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG 301

Query:   287 ASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWDAS 346
             ASGIFIGRPVV+SLAAEGE GVR+VL+MLR+EFEL MALSGCRSLKEI+R+HI TEWD  
Sbjct:   302 ASGIFIGRPVVFSLAAEGEAGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDT- 360

Query:   347 LPRPVPRL 354
              PRP  RL
Sbjct:   361 -PRPSARL 367

GO:0003824 "catalytic activity" evidence=IEA

GO:0008891 "glycolate oxidase activity" evidence=ISS;IMP

GO:0010181 "FMN binding" evidence=IEA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0005634 "nucleus" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

GO:0022626 "cytosolic ribosome" evidence=IDA

GO:0016020 "membrane" evidence=IDA

GO:0005777 "peroxisome" evidence=IDA

GO:0048046 "apoplast" evidence=IDA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0005829 "cytosol" evidence=RCA

GO:0009506 "plasmodesma" evidence=IDA

GO:0042742 "defense response to bacterium" evidence=IMP

GO:0050665 "hydrogen peroxide biosynthetic process" evidence=IMP

UNIPROTKB\|B8AKX6 GLO1 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO1" [Oryza sativa Indica Group (taxid:39946)]	Back alignment and assigned GO terms

UNIPROTKB\|Q10CE4 GLO1 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO1" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|B8B7C5 GLO5 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO5" [Oryza sativa Indica Group (taxid:39946)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6YT73 GLO5 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO5" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2124499 GOX3 "glycolate oxidase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|B8AUI3 GLO3 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO3" [Oryza sativa Indica Group (taxid:39946)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7FAS1 GLO3 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO3" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|Q01KC2 GLO2 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO2" [Oryza sativa Indica Group (taxid:39946)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7XPR4 GLO2 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO2" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
B8B8K5	GLO4_ORYSI	1, ., 1, ., 3, ., 1, 5	0.5718	0.9519	0.9207	N/A	no
Q54E41	HAOX_DICDI	1, ., 1, ., 3, ., 1, 5	0.4931	0.9519	0.8685	yes	no
Q9LRR9	GLO1_ARATH	1, ., 1, ., 3, ., 1, 5	0.8668	0.9887	0.9536	yes	no
B7MFG9	LLDD_ECO45	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
Q01KC2	GLO2_ORYSI	1, ., 1, ., 3, ., 1, 5	0.6805	0.9717	0.9347	N/A	no
B7M492	LLDD_ECO8A	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
P20932	MDLB_PSEPU	1, ., 1, ., 9, 9, ., 3, 1	0.3626	0.9519	0.8575	yes	no
B7L725	LLDD_ECO55	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
Q87G18	LLDD_VIBPA	1, ., 1, ., 2, ., 3	0.3475	0.9519	0.8891	yes	no
B8AUI3	GLO3_ORYSI	1, ., 1, ., 3, ., 1, 5	0.7805	0.9717	0.9373	N/A	no
Q3YVX0	LLDD_SHISS	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
B7NER0	LLDD_ECOLU	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
A7IMB0	LLDD_XANP2	1, ., 1, ., 2, ., 3	0.3540	0.9774	0.8917	yes	no
Q1R4Z0	LLDD_ECOUT	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
A7MNF6	LLDD_CROS8	1, ., 1, ., 2, ., 3	0.3636	0.9519	0.8403	yes	no
B8B7C5	GLO5_ORYSI	1, ., 1, ., 3, ., 1, 5	0.825	0.9717	0.9322	N/A	no
Q6YT73	GLO5_ORYSJ	1, ., 1, ., 3, ., 1, 5	0.825	0.9717	0.9322	no	no
B7LTL2	LLDD_ESCF3	1, ., 1, ., 2, ., 3	0.3518	0.9632	0.8611	yes	no
Q0SYD1	LLDD_SHIF8	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
B1LK44	LLDD_ECOSM	1, ., 1, ., 2, ., 3	0.3535	0.9491	0.8484	yes	no
A8A670	LLDD_ECOHS	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
O49506	GLO5_ARATH	1, ., 1, ., 3, ., 1, 5	0.8240	0.9661	0.9293	no	no
Q10CE4	GLO1_ORYSJ	1, ., 1, ., 3, ., 1, 5	0.8189	0.9971	0.9566	yes	no
A7ZTF9	LLDD_ECO24	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
B1IZI5	LLDD_ECOLC	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
Q9LRS0	GLO2_ARATH	1, ., 1, ., 3, ., 1, 5	0.8505	0.9887	0.9536	yes	no
B6I3I4	LLDD_ECOSE	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
B8AKX6	GLO1_ORYSI	1, ., 1, ., 3, ., 1, 5	0.8189	0.9971	0.9566	N/A	no
Q83PP7	LLDD_SHIFL	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
A1AHE2	LLDD_ECOK1	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
Q9UJM8	HAOX1_HUMAN	1, ., 1, ., 3, ., 1, 5	0.56	0.9322	0.8918	yes	no
Q7FAS1	GLO3_ORYSJ	1, ., 1, ., 3, ., 1, 5	0.7805	0.9717	0.9373	no	no
Q6DAY3	LLDD_ERWCT	1, ., 1, ., 2, ., 3	0.3636	0.9519	0.8730	yes	no
P05414	GOX_SPIOL	1, ., 1, ., 3, ., 1, 5	0.8478	0.9943	0.9539	N/A	no
Q3ZBW2	HAOX2_BOVIN	1, ., 1, ., 3, ., 1, 5	0.4390	0.9293	0.9320	yes	no
Q9WU19	HAOX1_MOUSE	1, ., 1, ., 3, ., 1, 5	0.5439	0.9406	0.9	yes	no
B2U5C2	LLDD_SHIB3	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
Q329P9	LLDD_SHIDS	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no
B5YWA7	LLDD_ECO5E	1, ., 1, ., 2, ., 3	0.3506	0.9661	0.8636	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.3	0.998
3rd Layer	1.1.3.15	0.994

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		354
PLN02493		367	PLN02493, PLN02493, probable peroxisomal (S)-2-hyd	0.0
PLN02979		366	PLN02979, PLN02979, glycolate oxidase	0.0
PLN02535		364	PLN02535, PLN02535, glycolate oxidase	1e-177
cd02809		299	cd02809, alpha_hydroxyacid_oxid_FMN, Family of hom	1e-157
pfam01070		302	pfam01070, FMN_dh, FMN-dependent dehydrogenase	1e-156
cd02922		344	cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-b	1e-127
COG1304		360	COG1304, idi, Isopentenyl diphosphate isomerase (B	1e-117
cd04737		351	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN	1e-110
cd03332		383	cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO)	1e-108
cd04736		361	cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-li	4e-95
PRK11197		381	PRK11197, lldD, L-lactate dehydrogenase; Provision	2e-82
TIGR02708		367	TIGR02708, L_lactate_ox, L-lactate oxidase	4e-81
TIGR03966		385	TIGR03966, actino_HemFlav, heme/flavin dehydrogena	1e-73
TIGR02151		333	TIGR02151, IPP_isom_2, isopentenyl-diphosphate del	8e-23
PRK05437		352	PRK05437, PRK05437, isopentenyl pyrophosphate isom	1e-14
cd02811		326	cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimeth	7e-12
cd02808		392	cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-b	1e-08
cd04722		200	cd04722, TIM_phosphate_binding, TIM barrel protein	2e-08
cd04730		236	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD	2e-07
cd00381		325	cd00381, IMPDH, IMPDH: The catalytic domain of the	6e-05
COG2070		336	COG2070, COG2070, Dioxygenases related to 2-nitrop	8e-05
PRK05567		486	PRK05567, PRK05567, inosine 5'-monophosphate dehyd	2e-04
TIGR01304		369	TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family	2e-04
COG0069		485	COG0069, GltB, Glutamate synthase domain 2 [Amino	2e-04
TIGR01302		450	TIGR01302, IMP_dehydrog, inosine-5'-monophosphate	2e-04
pfam03060		329	pfam03060, NMO, Nitronate monooxygenase	6e-04
pfam01645		367	pfam01645, Glu_synthase, Conserved region in gluta	7e-04
COG0042		323	COG0042, COG0042, tRNA-dihydrouridine synthase [Tr	7e-04
PRK08649		368	PRK08649, PRK08649, inosine 5-monophosphate dehydr	8e-04
pfam00478		467	pfam00478, IMPDH, IMP dehydrogenase / GMP reductas	0.001
PLN02826		409	PLN02826, PLN02826, dihydroorotate dehydrogenase	0.001
PRK05437		352	PRK05437, PRK05437, isopentenyl pyrophosphate isom	0.002
cd02801		231	cd02801, DUS_like_FMN, Dihydrouridine synthase-lik	0.002
PTZ00314		495	PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd	0.002

>gnl\|CDD\|166134 PLN02493, PLN02493, probable peroxisomal (S)-2-hydroxy-acid oxidase	Back alignment and domain information

 Score =  611 bits (1576), Expect = 0.0
 Identities = 319/368 (86%), Positives = 338/368 (91%), Gaps = 18/368 (4%)

Query: 3   EITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMN 62
           EITNV EY+AIAK+KLPKMV+DYYASGAEDQWTLQENRNAF+RILFRPRILIDVSKIDM 
Sbjct: 2   EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMT 61

Query: 63  TTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGP 122
           TTVLGFKISMPIM+APTAMQKMAHP+GEYATARAASAAGTIMTLSSW+TSSVEEVASTGP
Sbjct: 62  TTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGP 121

Query: 123 GIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLTLK 182
           GIRFFQLYVYK+RNVV QLVRRAERAGFKAIALTVDTPRLGRRE+DIKNRFTLPP LTLK
Sbjct: 122 GIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTLK 181

Query: 183 NFQGLDLGKMDEANDSGLAAYVAGQIDRSLSW----------------KGVLTAEDARIA 226
           NF+GLDLGKMDEANDSGLA+YVAGQIDR+LSW                KGVLT EDARIA
Sbjct: 182 NFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARIA 241

Query: 227 VQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG 286
           +QAGAAGIIVSNHGARQLDYVPATI ALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG
Sbjct: 242 IQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALG 301

Query: 287 ASGIFIGRPVVYSLAAEGEKGVRRVLEMLREEFELAMALSGCRSLKEITRDHIVTEWDAS 346
           ASGIFIGRPVV+SLAAEGE GVR+VL+MLR+EFEL MALSGCRSLKEI+R+HI TEWD  
Sbjct: 302 ASGIFIGRPVVFSLAAEGEAGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDT- 360

Query: 347 LPRPVPRL 354
            PRP  RL
Sbjct: 361 -PRPSARL 367

Length = 367

>gnl\|CDD\|166620 PLN02979, PLN02979, glycolate oxidase	Back alignment and domain information

>gnl\|CDD\|215294 PLN02535, PLN02535, glycolate oxidase	Back alignment and domain information

>gnl\|CDD\|239203 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>gnl\|CDD\|216281 pfam01070, FMN_dh, FMN-dependent dehydrogenase	Back alignment and domain information

>gnl\|CDD\|239238 cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|224223 COG1304, idi, Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|240088 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|239448 cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|240087 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|183033 PRK11197, lldD, L-lactate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|131755 TIGR02708, L_lactate_ox, L-lactate oxidase	Back alignment and domain information

>gnl\|CDD\|188481 TIGR03966, actino_HemFlav, heme/flavin dehydrogenase, mycofactocin system	Back alignment and domain information

>gnl\|CDD\|233750 TIGR02151, IPP_isom_2, isopentenyl-diphosphate delta-isomerase, type 2	Back alignment and domain information

>gnl\|CDD\|235465 PRK05437, PRK05437, isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>gnl\|CDD\|239205 cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|239202 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>gnl\|CDD\|240081 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>gnl\|CDD\|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|224981 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|233351 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein	Back alignment and domain information

>gnl\|CDD\|223147 COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|217344 pfam03060, NMO, Nitronate monooxygenase	Back alignment and domain information

>gnl\|CDD\|110632 pfam01645, Glu_synthase, Conserved region in glutamate synthase	Back alignment and domain information

>gnl\|CDD\|223120 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|236322 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain	Back alignment and domain information

>gnl\|CDD\|178421 PLN02826, PLN02826, dihydroorotate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|235465 PRK05437, PRK05437, isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>gnl\|CDD\|239200 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		354
KOG0538		363	consensus Glycolate oxidase [Energy production and	100.0
PLN02493		367	probable peroxisomal (S)-2-hydroxy-acid oxidase	100.0
PRK11197		381	lldD L-lactate dehydrogenase; Provisional	100.0
PLN02535		364	glycolate oxidase	100.0
TIGR02708		367	L_lactate_ox L-lactate oxidase. Members of this pr	100.0
cd04736		361	MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin	100.0
cd03332		383	LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin	100.0
cd04737		351	LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d	100.0
PF01070		356	FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR	100.0
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom	100.0
PLN02979		366	glycolate oxidase	100.0
COG1304		360	idi Isopentenyl diphosphate isomerase (BS_ypgA, MT	100.0
cd02809		299	alpha_hydroxyacid_oxid_FMN Family of homologous FM	100.0
cd02811		326	IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di	100.0
PRK05437		352	isopentenyl pyrophosphate isomerase; Provisional	100.0
TIGR02151		333	IPP_isom_2 isopentenyl-diphosphate delta-isomerase	100.0
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	99.96
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	99.96
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	99.95
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	99.94
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	99.94
cd02808		392	GltS_FMN Glutamate synthase (GltS) FMN-binding dom	99.93
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	99.93
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	99.91
COG0042		323	tRNA-dihydrouridine synthase [Translation, ribosom	99.9
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	99.9
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	99.89
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	99.89
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	99.87
PRK10550		312	tRNA-dihydrouridine synthase C; Provisional	99.87
TIGR00742		318	yjbN tRNA dihydrouridine synthase A. Members of th	99.87
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	99.86
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	99.85
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	99.84
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	99.84
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	99.83
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	99.83
PF01645		368	Glu_synthase: Conserved region in glutamate syntha	99.83
PF01207		309	Dus: Dihydrouridine synthase (Dus); InterPro: IPR0	99.83
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	99.82
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	99.82
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	99.81
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	99.8
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	99.8
PRK11815		333	tRNA-dihydrouridine synthase A; Provisional	99.8
PLN02826		409	dihydroorotate dehydrogenase	99.8
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	99.79
PLN02274		505	inosine-5'-monophosphate dehydrogenase	99.78
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	99.78
COG0069		485	GltB Glutamate synthase domain 2 [Amino acid trans	99.76
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	99.76
PRK02506		310	dihydroorotate dehydrogenase 1A; Reviewed	99.75
cd02911		233	arch_FMN Archeal FMN-binding domain. This family o	99.73
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	99.72
PF03060		330	NMO: Nitronate monooxygenase; InterPro: IPR004136	99.72
COG0167		310	PyrD Dihydroorotate dehydrogenase [Nucleotide tran	99.71
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	99.71
cd04738		327	DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl	99.71
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	99.71
PRK11750		1485	gltB glutamate synthase subunit alpha; Provisional	99.71
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	99.69
cd04741		294	DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c	99.69
KOG2335		358	consensus tRNA-dihydrouridine synthase [Translatio	99.69
cd04743		320	NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma	99.58
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	99.57
COG2070		336	Dioxygenases related to 2-nitropropane dioxygenase	99.57
cd04742		418	NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom	99.57
KOG2550		503	consensus IMP dehydrogenase/GMP reductase [Nucleot	99.55
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	99.55
TIGR01036		335	pyrD_sub2 dihydroorotate dehydrogenase, subfamily	99.55
PF01180		295	DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP	99.53
TIGR02814		444	pfaD_fam PfaD family protein. The protein PfaD is	99.51
KOG1436		398	consensus Dihydroorotate dehydrogenase [Nucleotide	99.47
KOG2333		614	consensus Uncharacterized conserved protein [Gener	99.36
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	99.16
PRK13523		337	NADPH dehydrogenase NamA; Provisional	99.08
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	99.02
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	99.0
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	99.0
cd04734		343	OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN	98.99
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	98.92
cd02933		338	OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind	98.86
COG3010		229	NanE Putative N-acetylmannosamine-6-phosphate epim	98.83
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	98.83
PRK04180		293	pyridoxal biosynthesis lyase PdxS; Provisional	98.8
cd02930		353	DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin	98.78
cd02931		382	ER_like_FMN Enoate reductase (ER)-like FMN-binding	98.77
cd04727		283	pdxS PdxS is a subunit of the pyridoxal 5'-phospha	98.76
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	98.75
cd04747		361	OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN	98.71
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	98.68
cd04735		353	OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN	98.68
PRK10605		362	N-ethylmaleimide reductase; Provisional	98.64
cd02929		370	TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH)	98.62
PRK14024		241	phosphoribosyl isomerase A; Provisional	98.6
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	98.59
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	98.58
COG1902		363	NemA NADH:flavin oxidoreductases, Old Yellow Enzym	98.58
KOG1799		471	consensus Dihydropyrimidine dehydrogenase [Nucleot	98.56
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	98.56
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	98.55
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	98.53
cd04733		338	OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN	98.52
cd04728		248	ThiG Thiazole synthase (ThiG) is the tetrameric en	98.48
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	98.46
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	98.45
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	98.44
PRK00208		250	thiG thiazole synthase; Reviewed	98.43
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	98.42
PF00724		341	Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox	98.41
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	98.4
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	98.39
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	98.37
KOG2334		477	consensus tRNA-dihydrouridine synthase [Translatio	98.37
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	98.36
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	98.35
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	98.34
KOG0399		2142	consensus Glutamate synthase [Amino acid transport	98.34
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	98.33
PRK07695		201	transcriptional regulator TenI; Provisional	98.33
PF05690		247	ThiG: Thiazole biosynthesis protein ThiG; InterPro	98.2
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	98.19
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	98.18
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	98.17
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	98.15
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	98.15
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	98.12
PRK00043		212	thiE thiamine-phosphate pyrophosphorylase; Reviewe	98.11
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	98.06
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	98.05
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	98.02
PF00218		254	IGPS: Indole-3-glycerol phosphate synthase; InterP	98.02
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	98.01
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	98.0
CHL00162		267	thiG thiamin biosynthesis protein G; Validated	97.97
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	97.96
COG0134		254	TrpC Indole-3-glycerol phosphate synthase [Amino a	97.95
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	97.93
PLN02591		250	tryptophan synthase	97.92
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	97.92
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	97.91
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	97.9
cd00958		235	DhnA Class I fructose-1,6-bisphosphate (FBP) aldol	97.89
PRK07028		430	bifunctional hexulose-6-phosphate synthase/ribonuc	97.89
cd00564		196	TMP_TenI Thiamine monophosphate synthase (TMP synt	97.87
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	97.87
PRK06806		281	fructose-bisphosphate aldolase; Provisional	97.85
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.85
PLN02334		229	ribulose-phosphate 3-epimerase	97.83
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	97.79
PRK07226		267	fructose-bisphosphate aldolase; Provisional	97.76
TIGR00734		221	hisAF_rel hisA/hisF family protein. This alignment	97.75
cd00959		203	DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of	97.74
PRK13802		695	bifunctional indole-3-glycerol phosphate synthase/	97.73
PRK06801		286	hypothetical protein; Provisional	97.71
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.7
TIGR00693		196	thiE thiamine-phosphate pyrophosphorylase. This mo	97.69
PRK00507		221	deoxyribose-phosphate aldolase; Provisional	97.67
PRK13307		391	bifunctional formaldehyde-activating enzyme/3-hexu	97.66
COG2022		262	ThiG Uncharacterized enzyme of thiazole biosynthes	97.64
PRK14024		241	phosphoribosyl isomerase A; Provisional	97.63
PRK09427		454	bifunctional indole-3-glycerol phosphate synthase/	97.63
PRK07315		293	fructose-bisphosphate aldolase; Provisional	97.62
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	97.61
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	97.61
TIGR00126		211	deoC deoxyribose-phosphate aldolase. Deoxyribose-p	97.61
cd00956		211	Transaldolase_FSA Transaldolase-like fructose-6-ph	97.59
TIGR01859		282	fruc_bis_ald_ fructose-1,6-bisphosphate aldolase,	97.58
PRK02615		347	thiamine-phosphate pyrophosphorylase; Provisional	97.58
COG0800		211	Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca	97.57
PRK11840		326	bifunctional sulfur carrier protein/thiazole synth	97.57
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.55
PF01791		236	DeoC: DeoC/LacD family aldolase; InterPro: IPR0029	97.55
PLN02460		338	indole-3-glycerol-phosphate synthase	97.55
COG0269		217	SgbH 3-hexulose-6-phosphate synthase and related p	97.54
PF01081		196	Aldolase: KDPG and KHG aldolase; InterPro: IPR0008	97.53
PRK05848		273	nicotinate-nucleotide pyrophosphorylase; Provision	97.53
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.51
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	97.51
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	97.49
TIGR00875		213	fsa_talC_mipB fructose-6-phosphate aldolase, TalC/	97.49
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	97.46
PRK07998		283	gatY putative fructose-1,6-bisphosphate aldolase;	97.45
PRK06512		221	thiamine-phosphate pyrophosphorylase; Provisional	97.43
cd00947		276	TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a	97.4
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	97.4
PRK08185		283	hypothetical protein; Provisional	97.39
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	97.39
PRK07709		285	fructose-bisphosphate aldolase; Provisional	97.38
PRK04128		228	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.38
PRK05742		277	nicotinate-nucleotide pyrophosphorylase; Provision	97.38
TIGR00259		257	thylakoid_BtpA membrane complex biogenesis protein	97.37
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	97.34
PRK07428		288	nicotinate-nucleotide pyrophosphorylase; Provision	97.33
cd00429		211	RPE Ribulose-5-phosphate 3-epimerase (RPE). This e	97.33
PRK12737		284	gatY tagatose-bisphosphate aldolase; Reviewed	97.31
TIGR00167		288	cbbA ketose-bisphosphate aldolases. fructose-bisph	97.3
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.3
PRK05835		307	fructose-bisphosphate aldolase; Provisional	97.29
PLN02411		391	12-oxophytodienoate reductase	97.28
TIGR01858		282	tag_bisphos_ald class II aldolase, tagatose bispho	97.26
PF02581		180	TMP-TENI: Thiamine monophosphate synthase/TENI; In	97.26
PRK04169		232	geranylgeranylglyceryl phosphate synthase-like pro	97.25
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	97.25
PRK01362		214	putative translaldolase; Provisional	97.24
PF01081		196	Aldolase: KDPG and KHG aldolase; InterPro: IPR0008	97.22
cd00405		203	PRAI Phosphoribosylanthranilate isomerase (PRAI) c	97.22
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	97.22
PRK12738		286	kbaY tagatose-bisphosphate aldolase; Reviewed	97.21
PRK04302		223	triosephosphate isomerase; Provisional	97.21
PF00290		259	Trp_syntA: Tryptophan synthase alpha chain; InterP	97.21
PRK09195		284	gatY tagatose-bisphosphate aldolase; Reviewed	97.2
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	97.2
cd01572		268	QPRTase Quinolinate phosphoribosyl transferase (QA	97.2
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	97.18
TIGR00078		265	nadC nicotinate-nucleotide pyrophosphorylase. Syno	97.17
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	97.16
PRK08385		278	nicotinate-nucleotide pyrophosphorylase; Provision	97.16
PRK08610		286	fructose-bisphosphate aldolase; Reviewed	97.16
COG0214		296	SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta	97.15
PRK08072		277	nicotinate-nucleotide pyrophosphorylase; Provision	97.14
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.13
KOG1606		296	consensus Stationary phase-induced protein, SOR/SN	97.12
cd02812		219	PcrB_like PcrB_like proteins. One member of this f	97.12
COG0352		211	ThiE Thiamine monophosphate synthase [Coenzyme met	97.12
PF01116		287	F_bP_aldolase: Fructose-bisphosphate aldolase clas	97.09
PRK12857		284	fructose-1,6-bisphosphate aldolase; Reviewed	97.05
PRK12656		222	fructose-6-phosphate aldolase; Reviewed	97.05
PRK12653		220	fructose-6-phosphate aldolase; Reviewed	97.02
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	97.01
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	97.01
PRK05581		220	ribulose-phosphate 3-epimerase; Validated	97.0
PRK12655		220	fructose-6-phosphate aldolase; Reviewed	96.96
PRK08883		220	ribulose-phosphate 3-epimerase; Provisional	96.95
TIGR01949		258	AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep	96.95
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.94
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	96.93
PRK11750		1485	gltB glutamate synthase subunit alpha; Provisional	96.93
PRK04128		228	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.88
cd01573		272	modD_like ModD; Quinolinate phosphoribosyl transfe	96.86
cd01568		269	QPRTase_NadC Quinolinate phosphoribosyl transferas	96.83
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	96.82
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.82
TIGR01768		223	GGGP-family geranylgeranylglyceryl phosphate synth	96.78
PRK12376		236	putative translaldolase; Provisional	96.77
PLN02617		538	imidazole glycerol phosphate synthase hisHF	96.76
PRK08227		264	autoinducer 2 aldolase; Validated	96.75
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	96.66
PTZ00170		228	D-ribulose-5-phosphate 3-epimerase; Provisional	96.63
PF03437		254	BtpA: BtpA family; InterPro: IPR005137 Photosystem	96.63
PRK03512		211	thiamine-phosphate pyrophosphorylase; Provisional	96.61
PF04898		287	Glu_syn_central: Glutamate synthase central domain	96.6
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	96.57
PRK09196		347	fructose-1,6-bisphosphate aldolase; Reviewed	96.54
TIGR01521		347	FruBisAldo_II_B fructose-bisphosphate aldolase, cl	96.54
PF01884		230	PcrB: PcrB family; InterPro: IPR008205 This entry	96.54
PF04481		242	DUF561: Protein of unknown function (DUF561); Inte	96.47
PLN02898		502	HMP-P kinase/thiamin-monophosphate pyrophosphoryla	96.46
PRK12290		437	thiE thiamine-phosphate pyrophosphorylase; Reviewe	96.46
COG0274		228	DeoC Deoxyribose-phosphate aldolase [Nucleotide tr	96.44
PF01729		169	QRPTase_C: Quinolinate phosphoribosyl transferase,	96.44
PRK08999		312	hypothetical protein; Provisional	96.42
PRK07084		321	fructose-bisphosphate aldolase; Provisional	96.36
PRK13399		347	fructose-1,6-bisphosphate aldolase; Provisional	96.35
KOG4201		289	consensus Anthranilate synthase component II [Amin	96.35
PRK13397		250	3-deoxy-7-phosphoheptulonate synthase; Provisional	96.34
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	96.28
PLN02417		280	dihydrodipicolinate synthase	96.27
PRK13306		216	ulaD 3-keto-L-gulonate-6-phosphate decarboxylase;	96.27
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	96.26
PRK09250		348	fructose-bisphosphate aldolase; Provisional	96.26
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	96.26
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	96.24
TIGR02134		236	transald_staph transaldolase. This small family of	96.19
PRK06559		290	nicotinate-nucleotide pyrophosphorylase; Provision	96.19
PRK09722		229	allulose-6-phosphate 3-epimerase; Provisional	96.18
TIGR02313		294	HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac	96.13
PRK06106		281	nicotinate-nucleotide pyrophosphorylase; Provision	96.12
PLN02617		538	imidazole glycerol phosphate synthase hisHF	96.11
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	96.08
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	96.02
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	95.98
cd04735		353	OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN	95.97
PRK06852		304	aldolase; Validated	95.95
PRK06978		294	nicotinate-nucleotide pyrophosphorylase; Provision	95.95
cd00408		281	DHDPS-like Dihydrodipicolinate synthase family. A	95.9
PLN02716		308	nicotinate-nucleotide diphosphorylase (carboxylati	95.89
cd00952		309	CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate	95.89
PRK06543		281	nicotinate-nucleotide pyrophosphorylase; Provision	95.89
PRK03620		303	5-dehydro-4-deoxyglucarate dehydratase; Provisiona	95.88
COG4981		717	Enoyl reductase domain of yeast-type FAS1 [Lipid m	95.88
PRK08745		223	ribulose-phosphate 3-epimerase; Provisional	95.88
cd00951		289	KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also	95.87
PRK07896		289	nicotinate-nucleotide pyrophosphorylase; Provision	95.87
PRK09016		296	quinolinate phosphoribosyltransferase; Validated	95.84
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	95.83
PRK12595		360	bifunctional 3-deoxy-7-phosphoheptulonate synthase	95.82
PF05690		247	ThiG: Thiazole biosynthesis protein ThiG; InterPro	95.57
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	95.55
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	95.53
TIGR00734		221	hisAF_rel hisA/hisF family protein. This alignment	95.52
PLN02858		1378	fructose-bisphosphate aldolase	95.5
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	95.49
TIGR03249		296	KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh	95.49
PRK09427		454	bifunctional indole-3-glycerol phosphate synthase/	95.48
cd04733		338	OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN	95.47
cd04728		248	ThiG Thiazole synthase (ThiG) is the tetrameric en	95.44
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	95.43
PRK08091		228	ribulose-phosphate 3-epimerase; Validated	95.42
cd00954		288	NAL N-Acetylneuraminic acid aldolase, also called	95.38
TIGR00683		290	nanA N-acetylneuraminate lyase. N-acetylneuraminat	95.36
PLN02274		505	inosine-5'-monophosphate dehydrogenase	95.36
TIGR00674		285	dapA dihydrodipicolinate synthase. Dihydrodipicoli	95.34
PRK09517		755	multifunctional thiamine-phosphate pyrophosphoryla	95.3
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	95.27
PRK13813		215	orotidine 5'-phosphate decarboxylase; Provisional	95.26
TIGR01334		277	modD putative molybdenum utilization protein ModD.	95.26
PRK04147		293	N-acetylneuraminate lyase; Provisional	95.25
cd00950		284	DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke	95.22
PRK00208		250	thiG thiazole synthase; Reviewed	95.19
PRK06096		284	molybdenum transport protein ModD; Provisional	95.15
TIGR02319		294	CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos	95.11
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	95.01
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	94.98
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	94.97
PRK05283		257	deoxyribose-phosphate aldolase; Provisional	94.97
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	94.94
PRK14057		254	epimerase; Provisional	94.91
PF00701		289	DHDPS: Dihydrodipicolinate synthetase family; Inte	94.85
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	94.85
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	94.69
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	94.64
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	94.62
PRK03170		292	dihydrodipicolinate synthase; Provisional	94.6
TIGR02320		285	PEP_mutase phosphoenolpyruvate phosphomutase. A cl	94.54
PRK00230		230	orotidine 5'-phosphate decarboxylase; Reviewed	94.4
CHL00162		267	thiG thiamin biosynthesis protein G; Validated	94.35
COG1830		265	FbaB DhnA-type fructose-1,6-bisphosphate aldolase	94.33
COG0036		220	Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate	94.31
PF04309		175	G3P_antiterm: Glycerol-3-phosphate responsive anti	94.22
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	94.19
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	93.97
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	93.9
PRK08673		335	3-deoxy-7-phosphoheptulonate synthase; Reviewed	93.87
PF09370		268	TIM-br_sig_trns: TIM-barrel signal transduction pr	93.86
COG2022		262	ThiG Uncharacterized enzyme of thiazole biosynthes	93.82
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	93.81
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	93.77
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	93.74
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	93.63
TIGR02317		285	prpB methylisocitrate lyase. Members of this famil	93.63
PRK08005		210	epimerase; Validated	93.57
COG0157		280	NadC Nicotinate-nucleotide pyrophosphorylase [Coen	93.53
PRK13398		266	3-deoxy-7-phosphoheptulonate synthase; Provisional	93.49
PLN02591		250	tryptophan synthase	93.27
PRK13396		352	3-deoxy-7-phosphoheptulonate synthase; Provisional	93.0
PRK11840		326	bifunctional sulfur carrier protein/thiazole synth	92.97
TIGR01361		260	DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate	92.86
COG1646		240	Predicted phosphate-binding enzymes, TIM-barrel fo	92.76
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	92.71
cd03319		316	L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat	92.65
COG2876		286	AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (	92.5
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom	92.37
PRK11320		292	prpB 2-methylisocitrate lyase; Provisional	92.36
PF00834		201	Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam	92.36
PF03932		201	CutC: CutC family; InterPro: IPR005627 Copper tran	92.32
PRK12858		340	tagatose 1,6-diphosphate aldolase; Reviewed	92.31
cd02809		299	alpha_hydroxyacid_oxid_FMN Family of homologous FM	92.3
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	92.28
cd00377		243	ICL_PEPM Members of the ICL/PEPM enzyme family cat	92.24
cd00408		281	DHDPS-like Dihydrodipicolinate synthase family. A	92.09
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	92.08
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	92.02
cd01571		302	NAPRTase_B Nicotinate phosphoribosyltransferase (N	91.97
PF03932		201	CutC: CutC family; InterPro: IPR005627 Copper tran	91.94
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	91.82
PRK11572		248	copper homeostasis protein CutC; Provisional	91.63
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	91.59
cd00953		279	KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas	91.46
cd00950		284	DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke	91.38
cd00439		252	Transaldolase Transaldolase. Enzymes found in the	91.34
COG0434		263	SgcQ Predicted TIM-barrel enzyme [General function	91.07
cd06556		240	ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup	90.95
cd00516		281	PRTase_typeII Phosphoribosyltransferase (PRTase) t	90.91
TIGR00259		257	thylakoid_BtpA membrane complex biogenesis protein	90.91
PF00218		254	IGPS: Indole-3-glycerol phosphate synthase; InterP	90.86
COG3142		241	CutC Uncharacterized protein involved in copper re	90.78
COG0434		263	SgcQ Predicted TIM-barrel enzyme [General function	90.67
TIGR02708		367	L_lactate_ox L-lactate oxidase. Members of this pr	90.37
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	90.21
cd04727		283	pdxS PdxS is a subunit of the pyridoxal 5'-phospha	90.18
KOG2335		358	consensus tRNA-dihydrouridine synthase [Translatio	89.88
COG1954		181	GlpP Glycerol-3-phosphate responsive antiterminato	89.86
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	89.84
TIGR01362		258	KDO8P_synth 3-deoxy-8-phosphooctulonate synthase.	89.78
PLN02411		391	12-oxophytodienoate reductase	89.76
PRK11320		292	prpB 2-methylisocitrate lyase; Provisional	89.63
COG3010		229	NanE Putative N-acetylmannosamine-6-phosphate epim	89.62
COG0167		310	PyrD Dihydroorotate dehydrogenase [Nucleotide tran	89.61
TIGR02317		285	prpB methylisocitrate lyase. Members of this famil	89.49
PRK11572		248	copper homeostasis protein CutC; Provisional	89.48
PLN02493		367	probable peroxisomal (S)-2-hydroxy-acid oxidase	89.32
PRK12457		281	2-dehydro-3-deoxyphosphooctonate aldolase; Provisi	89.21
TIGR03569		329	NeuB_NnaB N-acetylneuraminate synthase. This famil	89.05
PRK09197		350	fructose-bisphosphate aldolase; Provisional	89.04
cd04741		294	DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c	89.03
cd00377		243	ICL_PEPM Members of the ICL/PEPM enzyme family cat	88.8
PLN02535		364	glycolate oxidase	88.78
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	88.72
COG0191		286	Fba Fructose/tagatose bisphosphate aldolase [Carbo	88.64
COG2513		289	PrpB PEP phosphonomutase and related enzymes [Carb	88.51
PRK02227		238	hypothetical protein; Provisional	88.15
TIGR02313		294	HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac	88.05
COG0135		208	TrpF Phosphoribosylanthranilate isomerase [Amino a	87.97
TIGR03249		296	KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh	87.74
COG2513		289	PrpB PEP phosphonomutase and related enzymes [Carb	87.74
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	87.67
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	87.61
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	87.42
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	87.41
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	87.27
TIGR03569		329	NeuB_NnaB N-acetylneuraminate synthase. This famil	86.88
TIGR01520		357	FruBisAldo_II_A fructose-bisphosphate aldolase, cl	86.86
cd00946		345	FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis	86.75
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	86.7
PRK05198		264	2-dehydro-3-deoxyphosphooctonate aldolase; Provisi	86.65
cd00405		203	PRAI Phosphoribosylanthranilate isomerase (PRAI) c	86.61
PF03437		254	BtpA: BtpA family; InterPro: IPR005137 Photosystem	86.37
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	86.24
cd03316		357	MR_like Mandelate racemase (MR)-like subfamily of	86.19
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	86.13
PF00290		259	Trp_syntA: Tryptophan synthase alpha chain; InterP	86.0
COG2185		143	Sbm Methylmalonyl-CoA mutase, C-terminal domain/su	85.96
COG0176		239	MipB Transaldolase [Carbohydrate transport and met	85.86
PF04476		235	DUF556: Protein of unknown function (DUF556); Inte	85.76
cd04738		327	DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl	85.7
COG2185		143	Sbm Methylmalonyl-CoA mutase, C-terminal domain/su	85.69
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	85.48
cd00453		340	FTBP_aldolase_II Fructose/tagarose-bisphosphate al	85.48
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	85.37
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	85.3
TIGR03239		249	GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co	85.24
PF01207		309	Dus: Dihydrouridine synthase (Dus); InterPro: IPR0	85.24
TIGR02321		290	Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f	85.14
TIGR00640		132	acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal	85.1
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	85.07
PRK10558		256	alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro	85.0
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	84.99
PTZ00411		333	transaldolase-like protein; Provisional	84.76
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	84.76
PRK15063		428	isocitrate lyase; Provisional	84.72
PRK10550		312	tRNA-dihydrouridine synthase C; Provisional	84.72
PLN02424		332	ketopantoate hydroxymethyltransferase	84.68
PF00701		289	DHDPS: Dihydrodipicolinate synthetase family; Inte	84.24
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	84.08
cd02931		382	ER_like_FMN Enoate reductase (ER)-like FMN-binding	83.98
PRK03170		292	dihydrodipicolinate synthase; Provisional	83.94
cd04736		361	MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin	83.91
PRK10128		267	2-keto-3-deoxy-L-rhamnonate aldolase; Provisional	83.89
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	83.81
TIGR03586		327	PseI pseudaminic acid synthase.	83.77
PRK13305		218	sgbH 3-keto-L-gulonate-6-phosphate decarboxylase;	83.71
PLN02460		338	indole-3-glycerol-phosphate synthase	83.36
cd03332		383	LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin	83.1
cd06557		254	KPHMT-like Ketopantoate hydroxymethyltransferase (	83.02
COG2089		347	SpsE Sialic acid synthase [Cell envelope biogenesi	82.82
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	82.79
TIGR02319		294	CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos	82.51
COG0800		211	Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca	82.45
PF13714		238	PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB	82.27
PLN02826		409	dihydroorotate dehydrogenase	82.22
cd02911		233	arch_FMN Archeal FMN-binding domain. This family o	81.78
PLN02979		366	glycolate oxidase	81.76
PF13714		238	PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB	81.61
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	81.5
TIGR00674		285	dapA dihydrodipicolinate synthase. Dihydrodipicoli	81.39
cd00957		313	Transaldolase_TalAB Transaldolases including both	81.33
PRK11197		381	lldD L-lactate dehydrogenase; Provisional	81.31
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	80.97
COG0516		170	GuaB IMP dehydrogenase/GMP reductase [Nucleotide t	80.83
COG1411		229	Uncharacterized protein related to proFAR isomeras	80.8
COG0042		323	tRNA-dihydrouridine synthase [Translation, ribosom	80.78
TIGR02320		285	PEP_mutase phosphoenolpyruvate phosphomutase. A cl	80.62
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	80.57
TIGR02311		249	HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola	80.53
cd03315		265	MLE_like Muconate lactonizing enzyme (MLE) like su	80.51
TIGR02321		290	Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f	80.48
TIGR01232		325	lacD tagatose 1,6-diphosphate aldolase. This famil	80.28

>KOG0538 consensus Glycolate oxidase [Energy production and conversion]	Back alignment and domain information

Probab=100.00  E-value=6e-87  Score=610.52  Aligned_cols=337  Identities=76%  Similarity=1.163  Sum_probs=320.1

Q ss_pred             CCChHHHHHHHHHhCCccccccccCCccchHHHHHhHhhcccceeeccccCCCCCCccceeEcCeeeccceEeccccccc
Q 018519            4 ITNVMEYEAIAKEKLPKMVFDYYASGAEDQWTLQENRNAFSRILFRPRILIDVSKIDMNTTVLGFKISMPIMIAPTAMQK   83 (354)
Q Consensus         4 ~~~~~d~~~~A~~~l~~~~~~y~~~ga~~~~t~~~N~~~~~~i~l~pr~l~~~~~vd~st~l~g~~l~~Pi~iAPm~~~~   83 (354)
                      ++|++|||+.|+++||+.+|+||.|||+|+.|++.|+++|.||.|+||+|+|++.+|+||+++|++++.||+|||++++.
T Consensus         1 lv~~~dfe~~A~~~L~K~a~dyy~sgA~d~~Tl~~N~~AF~ri~~rPr~L~dVs~iD~sTtvlG~~i~~Pi~iapTa~qk   80 (363)
T KOG0538|consen    1 LVNVDDFEALAKQQLPKMAYDYYESGAEDQETLDENINAFRRILFRPRILRDVSKIDTSTTVLGQKISAPIMIAPTAMQK   80 (363)
T ss_pred             CccHHHHHHHHHHhhhHHHHHHHhcCCcchhhHHHHHHHHHhhhccchhheecccccccceeccccccceeEEcchHHHh
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCChhhHHHHHHHHHcCCcEEecCCCCCCHHHHHhhCC-CceEEEEeecCChHHHHHHHHHHHHcCCCEEEEecCCCCC
Q 018519           84 MAHPEGEYATARAASAAGTIMTLSSWSTSSVEEVASTGP-GIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRL  162 (354)
Q Consensus        84 l~~~~~e~~la~aa~~~G~~~~~s~~~~~~~eei~~~~~-~~~~~QLy~~~d~~~~~~~~~~a~~~G~~ai~i~vd~p~~  162 (354)
                      ++|||||.+.|++|.++|++|++|+++++|+|||.+++| +..|||||.++|++++.++++|||++||++|++|+|+|..
T Consensus        81 ma~pdGE~~taraa~~~~~~~i~Ss~at~S~EdI~~aap~~~rwfQLYvykdr~It~~Lv~raEk~GfkAlvlTvDtP~l  160 (363)
T KOG0538|consen   81 MAHPDGELATARAAQAAGTIMILSSWATCSVEDIASAAPPGIRWFQLYVYKDRDITEQLVKRAEKAGFKALVLTVDTPRL  160 (363)
T ss_pred             ccCCcccHHHHHHHHhcCCcEEEechhcCCHHHHHhhCCCCcEEEEEEecCchHHHHHHHHHHHHcCceEEEEEeccccc
Confidence            999999999999999999999999999999999999886 8999999999999999999999999999999999999999


Q ss_pred             CchhHHhhhccCCCCcCccccccCCccCcCcccchhhHHHHHhhhcCCccccc----------------ccCCHHHHHHH
Q 018519          163 GRREADIKNRFTLPPFLTLKNFQGLDLGKMDEANDSGLAAYVAGQIDRSLSWK----------------GVLTAEDARIA  226 (354)
Q Consensus       163 g~r~~~~r~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~----------------Gi~~~~~a~~~  226 (354)
                      |+|+.|++|+|.+|..++.++++........+....++..++....+|.+.|+                ||++.|||+.|
T Consensus       161 G~R~~D~~n~f~lp~~l~lknfe~~~~~~v~~~~~sg~~~~~~~~id~Sl~W~Di~wLr~~T~LPIvvKGilt~eDA~~A  240 (363)
T KOG0538|consen  161 GRRESDIKNKFSLPKNLTLKNFEGLKLTEVEEAGDSGLAAYVSSQIDPSLSWKDIKWLRSITKLPIVVKGVLTGEDARKA  240 (363)
T ss_pred             cCchhhhhhcccCCcccccccccccccccCCcccchhhhhhhhcCCCCCCChhhhHHHHhcCcCCeEEEeecccHHHHHH
Confidence            99999999999999999888887765433333344457777777788888886                99999999999


Q ss_pred             HHhCCCEEEEecCCcCCCCCCcChHHHHHHHHHHhcCCccEEEcCCCCCHHHHHHHHHcCcCEEEEcHHHHHHHhhcCHH
Q 018519          227 VQAGAAGIIVSNHGARQLDYVPATIMALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVYSLAAEGEK  306 (354)
Q Consensus       227 ~~~G~d~I~vs~~gg~~~~~~~~~~~~l~~i~~~~~~~i~vi~~GGi~~g~dv~kalalGAd~V~igr~~l~~~~~~G~~  306 (354)
                      .++|+++|+||||||||+|..++++++|+|+.+++.+++||+.|||||+|.||+|||||||.+|++|||++|+++++|+.
T Consensus       241 ve~G~~GIIVSNHGgRQlD~vpAtI~~L~Evv~aV~~ri~V~lDGGVR~G~DVlKALALGAk~VfiGRP~v~gLA~~Ge~  320 (363)
T KOG0538|consen  241 VEAGVAGIIVSNHGGRQLDYVPATIEALPEVVKAVEGRIPVFLDGGVRRGTDVLKALALGAKGVFIGRPIVWGLAAKGEA  320 (363)
T ss_pred             HHhCCceEEEeCCCccccCcccchHHHHHHHHHHhcCceEEEEecCcccchHHHHHHhcccceEEecCchheeeccccch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhCCCChhhhccccee
Q 018519          307 GVRRVLEMLREEFELAMALSGCRSLKEITRDHIV  340 (354)
Q Consensus       307 gv~~~l~~l~~el~~~m~~~G~~~i~~l~~~~l~  340 (354)
                      ||+++++.|++|++.+|++.||.|++|+++..+.
T Consensus       321 GV~~vl~iL~~efe~tmaLsGc~sv~ei~~~~v~  354 (363)
T KOG0538|consen  321 GVKKVLDILRDEFELTMALSGCRSVKEITRNHVL  354 (363)
T ss_pred             hHHHHHHHHHHHHHHHHHHhCCCchhhhCcccee
Confidence            9999999999999999999999999999988544

>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase	Back alignment and domain information

>PRK11197 lldD L-lactate dehydrogenase; Provisional	Back alignment and domain information

>PLN02535 glycolate oxidase	Back alignment and domain information

>TIGR02708 L_lactate_ox L-lactate oxidase	Back alignment and domain information

>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related	Back alignment and domain information

>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>PLN02979 glycolate oxidase	Back alignment and domain information

>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism]	Back alignment and domain information

>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain	Back alignment and domain information

>PRK05437 isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>PRK10550 tRNA-dihydrouridine synthase C; Provisional	Back alignment and domain information

>TIGR00742 yjbN tRNA dihydrouridine synthase A	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots []	Back alignment and domain information

>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK11815 tRNA-dihydrouridine synthase A; Provisional	Back alignment and domain information

>PLN02826 dihydroorotate dehydrogenase	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed	Back alignment and domain information

>cd02911 arch_FMN Archeal FMN-binding domain	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1	Back alignment and domain information

>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>PRK11750 gltB glutamate synthase subunit alpha; Provisional	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain	Back alignment and domain information

>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS)	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD	Back alignment and domain information

>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2	Back alignment and domain information

>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway	Back alignment and domain information

>TIGR02814 pfaD_fam PfaD family protein	Back alignment and domain information

>KOG1436 consensus Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG2333 consensus Uncharacterized conserved protein [General function prediction only]	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>PRK13523 NADPH dehydrogenase NamA; Provisional	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional	Back alignment and domain information

>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain	Back alignment and domain information

>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain	Back alignment and domain information

>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4	Back alignment and domain information

>PRK10605 N-ethylmaleimide reductase; Provisional	Back alignment and domain information

>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]	Back alignment and domain information

>KOG1799 consensus Dihydropyrimidine dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2	Back alignment and domain information

>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>PRK00208 thiG thiazole synthase; Reviewed	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside []	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>PRK07695 transcriptional regulator TenI; Provisional	Back alignment and domain information

>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>CHL00162 thiG thiamin biosynthesis protein G; Validated	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea	Back alignment and domain information

>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated	Back alignment and domain information

>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK06806 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>PLN02334 ribulose-phosphate 3-epimerase	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK07226 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR00734 hisAF_rel hisA/hisF family protein	Back alignment and domain information

>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family	Back alignment and domain information

>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional	Back alignment and domain information

>PRK06801 hypothetical protein; Provisional	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR00693 thiE thiamine-phosphate pyrophosphorylase	Back alignment and domain information

>PRK00507 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional	Back alignment and domain information

>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional	Back alignment and domain information

>PRK07315 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>TIGR00126 deoC deoxyribose-phosphate aldolase	Back alignment and domain information

>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases	Back alignment and domain information

>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist	Back alignment and domain information

>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism	Back alignment and domain information

>PLN02460 indole-3-glycerol-phosphate synthase	Back alignment and domain information

>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4	Back alignment and domain information

>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>PRK08185 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>PRK07709 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE)	Back alignment and domain information

>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR00167 cbbA ketose-bisphosphate aldolases	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK05835 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PLN02411 12-oxophytodienoate reductase	Back alignment and domain information

>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family	Back alignment and domain information

>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2	Back alignment and domain information

>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>PRK01362 putative translaldolase; Provisional	Back alignment and domain information

>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4	Back alignment and domain information

>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP)	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK04302 triosephosphate isomerase; Provisional	Back alignment and domain information

>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4	Back alignment and domain information

>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK08610 fructose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism]	Back alignment and domain information

>cd02812 PcrB_like PcrB_like proteins	Back alignment and domain information

>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism]	Back alignment and domain information

>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate	Back alignment and domain information

>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK12656 fructose-6-phosphate aldolase; Reviewed	Back alignment and domain information

>PRK12653 fructose-6-phosphate aldolase; Reviewed	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05581 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>PRK12655 fructose-6-phosphate aldolase; Reviewed	Back alignment and domain information

>PRK08883 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>PRK11750 gltB glutamate synthase subunit alpha; Provisional	Back alignment and domain information

>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport	Back alignment and domain information

>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein	Back alignment and domain information

>PRK12376 putative translaldolase; Provisional	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>PRK08227 autoinducer 2 aldolase; Validated	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane	Back alignment and domain information

>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>PF04898 Glu_syn_central: Glutamate synthase central domain; InterPro: IPR006982 Glutamate synthase (GltS)1 is a key enzyme in the early stages of the assimilation of ammonia in bacteria, yeasts, and plants	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype	Back alignment and domain information

>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P)	Back alignment and domain information

>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae	Back alignment and domain information

>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase	Back alignment and domain information

>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2	Back alignment and domain information

>PRK08999 hypothetical protein; Provisional	Back alignment and domain information

>PRK07084 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional	Back alignment and domain information

>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>PLN02417 dihydrodipicolinate synthase	Back alignment and domain information

>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>PRK09250 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>TIGR02134 transald_staph transaldolase	Back alignment and domain information

>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK09722 allulose-6-phosphate 3-epimerase; Provisional	Back alignment and domain information

>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	Back alignment and domain information

>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4	Back alignment and domain information

>PRK06852 aldolase; Validated	Back alignment and domain information

>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>cd00408 DHDPS-like Dihydrodipicolinate synthase family	Back alignment and domain information

>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating)	Back alignment and domain information

>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA)	Back alignment and domain information

>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional	Back alignment and domain information

>COG4981 Enoyl reductase domain of yeast-type FAS1 [Lipid metabolism]	Back alignment and domain information

>PRK08745 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases	Back alignment and domain information

>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK09016 quinolinate phosphoribosyltransferase; Validated	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed	Back alignment and domain information

>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>TIGR00734 hisAF_rel hisA/hisF family protein	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase	Back alignment and domain information

>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional	Back alignment and domain information

>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2	Back alignment and domain information

>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>PRK08091 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid)	Back alignment and domain information

>TIGR00683 nanA N-acetylneuraminate lyase	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>TIGR00674 dapA dihydrodipicolinate synthase	Back alignment and domain information

>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional	Back alignment and domain information

>TIGR01334 modD putative molybdenum utilization protein ModD	Back alignment and domain information

>PRK04147 N-acetylneuraminate lyase; Provisional	Back alignment and domain information

>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis	Back alignment and domain information

>PRK00208 thiG thiazole synthase; Reviewed	Back alignment and domain information

>PRK06096 molybdenum transport protein ModD; Provisional	Back alignment and domain information

>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK05283 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK14057 epimerase; Provisional	Back alignment and domain information

>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>PRK03170 dihydrodipicolinate synthase; Provisional	Back alignment and domain information

>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase	Back alignment and domain information

>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed	Back alignment and domain information

>CHL00162 thiG thiamin biosynthesis protein G; Validated	Back alignment and domain information

>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed	Back alignment and domain information

>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART)	Back alignment and domain information

>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR02317 prpB methylisocitrate lyase	Back alignment and domain information

>PRK08005 epimerase; Validated	Back alignment and domain information

>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism]	Back alignment and domain information

>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional	Back alignment and domain information

>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only]	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides	Back alignment and domain information

>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]	Back alignment and domain information

>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>PRK11320 prpB 2-methylisocitrate lyase; Provisional	Back alignment and domain information

>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5	Back alignment and domain information

>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF	Back alignment and domain information

>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed	Back alignment and domain information

>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage	Back alignment and domain information

>cd00408 DHDPS-like Dihydrodipicolinate synthase family	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B	Back alignment and domain information

>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>PRK11572 copper homeostasis protein CutC; Provisional	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea	Back alignment and domain information

>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis	Back alignment and domain information

>cd00439 Transaldolase Transaldolase	Back alignment and domain information

>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only]	Back alignment and domain information

>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds	Back alignment and domain information

>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD	Back alignment and domain information

>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family	Back alignment and domain information

>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4	Back alignment and domain information

>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only]	Back alignment and domain information

>TIGR02708 L_lactate_ox L-lactate oxidase	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa	Back alignment and domain information

>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription]	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase	Back alignment and domain information

>PLN02411 12-oxophytodienoate reductase	Back alignment and domain information

>PRK11320 prpB 2-methylisocitrate lyase; Provisional	Back alignment and domain information

>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR02317 prpB methylisocitrate lyase	Back alignment and domain information

>PRK11572 copper homeostasis protein CutC; Provisional	Back alignment and domain information

>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase	Back alignment and domain information

>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase	Back alignment and domain information

>PRK09197 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain	Back alignment and domain information

>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage	Back alignment and domain information

>PLN02535 glycolate oxidase	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK02227 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	Back alignment and domain information

>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase	Back alignment and domain information

>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase	Back alignment and domain information

>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E	Back alignment and domain information

>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP)	Back alignment and domain information

>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4	Back alignment and domain information

>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism]	Back alignment and domain information

>COG0176 MipB Transaldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised	Back alignment and domain information

>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2	Back alignment and domain information

>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism]	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase	Back alignment and domain information

>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA	Back alignment and domain information

>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase	Back alignment and domain information

>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>PTZ00411 transaldolase-like protein; Provisional	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>PRK15063 isocitrate lyase; Provisional	Back alignment and domain information

>PRK10550 tRNA-dihydrouridine synthase C; Provisional	Back alignment and domain information

>PLN02424 ketopantoate hydroxymethyltransferase	Back alignment and domain information

>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain	Back alignment and domain information

>PRK03170 dihydrodipicolinate synthase; Provisional	Back alignment and domain information

>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>TIGR03586 PseI pseudaminic acid synthase	Back alignment and domain information

>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional	Back alignment and domain information

>PLN02460 indole-3-glycerol-phosphate synthase	Back alignment and domain information

>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway	Back alignment and domain information

>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase	Back alignment and domain information

>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B	Back alignment and domain information

>PLN02826 dihydroorotate dehydrogenase	Back alignment and domain information

>cd02911 arch_FMN Archeal FMN-binding domain	Back alignment and domain information

>PLN02979 glycolate oxidase	Back alignment and domain information

>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>TIGR00674 dapA dihydrodipicolinate synthase	Back alignment and domain information

>cd00957 Transaldolase_TalAB Transaldolases including both TalA and TalB	Back alignment and domain information

>PRK11197 lldD L-lactate dehydrogenase; Provisional	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>COG0516 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only]	Back alignment and domain information

>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	Back alignment and domain information

>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily	Back alignment and domain information

>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase	Back alignment and domain information

>TIGR01232 lacD tagatose 1,6-diphosphate aldolase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		354
1gox_A		370	Refined Structure Of Spinach Glycolate Oxidase At 2		1e-170
1gyl_A		369	Involvement Of Tyr24 And Trp108 In Substrate Bindin		1e-170
1al7_A		359	Three-Dimensional Structures Of Glycolate Oxidase W		1e-169
2rdt_A		387	Crystal Structure Of Human Glycolate Oxidase (Go) I		9e-98
2w0u_A		370	Crystal Structure Of Human Glycolate Oxidase In Com		1e-97
2nzl_A		392	Crystal Structure Of Human Hydroxyacid Oxidase 1 Le		1e-97
2cdh_0		226	Architecture Of The Thermomyces Lanuginosus Fungal		2e-89
2a7n_A		380	Crystal Structure Of The G81a Mutant Of The Active		2e-68
1tb3_A		352	Crystal Structure Analysis Of Recombinant Rat Kidne		2e-68
1huv_A		380	Crystal Structure Of A Soluble Mutant Of The Membra		4e-68
3sgz_A		352	High Resolution Crystal Structure Of Rat Long Chain		2e-66
1qcw_A		410	Flavocytochrome B2, Arg289lys Mutant Length = 410		6e-60
1fcb_A		511	Molecular Structure Of Flavocytochrome B2 At 2.4 An		3e-59
1ltd_A		506	The 2.6 Angstroms Refined Structure Of The Escheric		3e-59
1kbj_A		412	Crystallographic Study Of The Recombinant Flavin-Bi		4e-59
1ldc_A		511	X-Ray Structure Of Two Complexes Of The Y143f Flavo		1e-58
1sze_A		511	L230a Mutant Flavocytochrome B2 With Benzoylformate		2e-58
2oz0_A		511	Mechanistic And Structural Studies Of H373q Flavocy		3e-58
1szf_A		511	A198g:l230a Mutant Flavocytochrome B2 With Pyruvate		5e-58
2du2_A		374	Crystal Structure Analysis Of The L-Lactate Oxidase		9e-45
2j6x_A		374	The Crystal Structure Of Lactate Oxidase Length = 3		1e-44
2nli_A		368	Crystal Structure Of The Complex Between L-Lactate		1e-44
1p0k_A		349	Ipp:dmapp Isomerase Type Ii Apo Structure Length =		5e-04

>pdb|1GOX|A Chain A, Refined Structure Of Spinach Glycolate Oxidase At 2 Angstroms Resolution Length = 370