Citrus Sinensis ID: 018557

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MNSHRVQGSTIVSIPLHLANAISQQLHHFLPSKYCCTSSPRVWNRCCSAQNKMENQDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLCSNEAQ
cccccEEEEEEEEEccccHHHHHHHcccccccccccccccccccccccHHHHcccccccccEEEccHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccHHHHccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccccccEEEEEEEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEEEcccccccHHHHHccccEEEEccccHHHHHHHHHHHHccccc
ccccEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEccHHHHHHHHHHHHHcccccEEEEEcccccHHccccccccccccHHHHccccHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHcccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccccccEEEEEEEEEEccccEEEEccccEEEEEcccccHccccHHHHHHcccccccccHHHHHcccccEEEEEcccccccccccccHccEEEEEEccccHHHHHHHHHHHccEEEEcccccHHHHHHHHHHHHcccc
mnshrvqgstIVSIPLHLANAISQQlhhflpskycctssprvwnrccsaqnkmenqdlskftikgdpqsLQNKISQIRMAGPSKLQVIADFDGTLTRYfingsrgqsshgllqqgnpeydAKRQALYEyyhplefsptvpleekTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLeerdipvlIFSAGLADIIEEVLRQKVHksfknvkivsnrmvfdkdghlvsfkgktihslnknehaldmaaplhehfgdtdgpnydnasvknrTNVLLLGDhigdlgmsdglkyETRISVGFlndniennldnYRNAFDIVYLNDAPMWEVVELVSQLCSNEAQ
MNSHRVQGSTIVSIPLHLANAISQQLHHFLPSKYCCTSSPRVWNRCCSAQNKMENQDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQkvhksfknvkivsnrmvfdkdgHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLCSNEAQ
MNSHRVQGSTIVSIPLHLANAISQQLHHFLPSKYCCTSSPRVWNRCCSAQNKMENQDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLCSNEAQ
*********TIVSIPLHLANAISQQLHHFLPSKYCCTSSPRVWNRCCSA*********************************SKLQVIADFDGTLTRYFING******************AKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHF*******YDNASVKNRTNVLLLGDHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLC*****
****R***STIVSIPLHLANAISQQLHHFLPSKYCC**************************IKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLCSN***
*********TIVSIPLHLANAISQQLHHFLPSKYCCTSSPRVWNRCCSAQNKMENQDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLCSNEAQ
*NSHRVQGSTIVSIPLHLANAISQQLHHFLPSKYCCTSS**************ENQDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLCSN***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSHRVQGSTIVSIPLHLANAISQQLHHFLPSKYCCTSSPRVWNRCCSAQNKMENQDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLCSNEAQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query354 2.2.26 [Sep-21-2011]
Q7SYN4286 Cytosolic 5'-nucleotidase no no 0.728 0.902 0.371 3e-45
Q5ZKF6289 Cytosolic 5'-nucleotidase yes no 0.754 0.923 0.369 9e-45
Q5ZID6331 Cytosolic 5'-nucleotidase no no 0.725 0.776 0.381 1e-44
Q6AYP7292 Cytosolic 5'-nucleotidase yes no 0.723 0.876 0.368 2e-44
Q3UFY7292 Cytosolic 5'-nucleotidase yes no 0.723 0.876 0.364 4e-44
Q7ZWS2290 Cytosolic 5'-nucleotidase N/A no 0.782 0.955 0.389 6e-44
Q9D020331 Cytosolic 5'-nucleotidase no no 0.745 0.797 0.375 7e-44
Q2TAG6290 Cytosolic 5'-nucleotidase N/A no 0.782 0.955 0.389 2e-43
Q969T7292 Cytosolic 5'-nucleotidase yes no 0.768 0.931 0.365 4e-43
Q9H0P0336 Cytosolic 5'-nucleotidase no no 0.728 0.767 0.357 2e-42
>sp|Q7SYN4|5NT3_DANRE Cytosolic 5'-nucleotidase 3 OS=Danio rerio GN=nt5c3 PE=2 SV=2 Back     alignment and function desciption
 Score =  182 bits (463), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/277 (37%), Positives = 160/277 (57%), Gaps = 19/277 (6%)

Query: 66  DPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQA 125
           DP+ ++  I  +   G SKLQ+I DFD TL+R+ +NG R  S H ++       D  R+ 
Sbjct: 14  DPERVEQIICGLIKGGASKLQIITDFDMTLSRFAVNGKRCPSCHNIIDNSKLVTDDCRKK 73

Query: 126 LY---EYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRD 182
           L    E Y+P+E  P + +EEK   M EW+ K+H LL+E  L  D + ++V  + ++ ++
Sbjct: 74  LVHLKETYYPIEIDPHLTMEEKYPFMVEWYFKSHTLLVEQRLEKDKLPEAVRESDVSLKE 133

Query: 183 GVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSF 242
           G  + F+ L +  +PV IFSAGL D++EE++RQ       NVK+VSN M FD +G L  F
Sbjct: 134 GYEQFFDRLHQHSVPVFIFSAGLGDVLEEIIRQ-AGVYHPNVKVVSNFMDFDDNGVLKGF 192

Query: 243 KGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHIGDLGMSDGL 302
           KG+ IH  NK++ AL       E+F            +K+  N++LLGD +GDL M+DG+
Sbjct: 193 KGELIHVYNKHDGALRNT----EYF----------KQLKDNGNIILLGDSLGDLTMADGV 238

Query: 303 -KYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPM 338
              E  + +G+LND +E  L+ Y ++++IV   D  +
Sbjct: 239 PNVENILKIGYLNDKVEELLEKYMDSYNIVLARDETL 275
Can act both as nucleotidase and as phosphotransferase.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 5
>sp|Q5ZKF6|5NT3L_CHICK Cytosolic 5'-nucleotidase III-like protein OS=Gallus gallus GN=NT5C3L PE=2 SV=1 Back     alignment and function description
>sp|Q5ZID6|5NT3_CHICK Cytosolic 5'-nucleotidase III OS=Gallus gallus GN=NT5C3 PE=1 SV=3 Back     alignment and function description
>sp|Q6AYP7|5NT3L_RAT Cytosolic 5'-nucleotidase III-like protein OS=Rattus norvegicus GN=Nt5c3l PE=2 SV=1 Back     alignment and function description
>sp|Q3UFY7|5NT3L_MOUSE Cytosolic 5'-nucleotidase III-like protein OS=Mus musculus GN=Nt5c3l PE=2 SV=2 Back     alignment and function description
>sp|Q7ZWS2|5N3LA_XENLA Cytosolic 5'-nucleotidase III-like protein A OS=Xenopus laevis GN=nt5c3l-a PE=2 SV=2 Back     alignment and function description
>sp|Q9D020|5NT3_MOUSE Cytosolic 5'-nucleotidase 3 OS=Mus musculus GN=Nt5c3 PE=1 SV=4 Back     alignment and function description
>sp|Q2TAG6|5N3LB_XENLA Cytosolic 5'-nucleotidase III-like protein B OS=Xenopus laevis GN=nt5c3l-b PE=2 SV=1 Back     alignment and function description
>sp|Q969T7|5NT3L_HUMAN Cytosolic 5'-nucleotidase III-like protein OS=Homo sapiens GN=NT5C3L PE=1 SV=3 Back     alignment and function description
>sp|Q9H0P0|5NT3_HUMAN Cytosolic 5'-nucleotidase 3 OS=Homo sapiens GN=NT5C3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
225463727346 PREDICTED: cytosolic 5'-nucleotidase 3 [ 0.901 0.921 0.739 1e-141
356576391346 PREDICTED: cytosolic 5'-nucleotidase 3-l 0.960 0.982 0.683 1e-138
147777087289 hypothetical protein VITISV_015731 [Viti 0.757 0.927 0.805 1e-130
357442777295 Cytosolic 5'-nucleotidase III-like prote 0.807 0.969 0.783 1e-130
449434528343 PREDICTED: cytosolic 5'-nucleotidase 3-l 0.937 0.967 0.664 1e-128
224113371285 predicted protein [Populus trichocarpa] 0.788 0.978 0.835 1e-128
255546813299 Cytosolic 5'-nucleotidase III, putative 0.833 0.986 0.762 1e-126
413933585353 cytosolic 5-nucleotidase III [Zea mays] 0.884 0.886 0.685 1e-124
194703152350 unknown [Zea mays] 0.884 0.894 0.685 1e-124
226496569353 LOC100284093 [Zea mays] gi|195625198|gb| 0.884 0.886 0.682 1e-124
>gi|225463727|ref|XP_002264488.1| PREDICTED: cytosolic 5'-nucleotidase 3 [Vitis vinifera] gi|296084428|emb|CBI24987.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  507 bits (1305), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 241/326 (73%), Positives = 272/326 (83%), Gaps = 7/326 (2%)

Query: 30  LPSKYCCTSSPRVWNRCCSAQNKMENQDLSKFT--IKGDPQSLQNKISQIRMAGPSKLQV 87
            P  +CCT +P         Q  ME  D SK +  +   P  L  KIS IRMAG SKLQ+
Sbjct: 25  FPRVWCCTHTP-----INQTQTAMEQLDPSKSSQVVVPHPHLLHAKISSIRMAGHSKLQI 79

Query: 88  IADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKL 147
           IADFD TLT+Y++NG RGQSSHGLLQQGNPEYD KR+ LY+YYHPLE SP++P+EEK KL
Sbjct: 80  IADFDATLTKYWVNGCRGQSSHGLLQQGNPEYDVKRRELYDYYHPLEISPSIPIEEKAKL 139

Query: 148 MEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLAD 207
           MEEWWGKTH LLIEGGLTYDAI KSV+N++I FR+GVV+LFEFLE RDIPVLIFSAGLAD
Sbjct: 140 MEEWWGKTHALLIEGGLTYDAITKSVANSMITFREGVVELFEFLEARDIPVLIFSAGLAD 199

Query: 208 IIEEVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHF 267
           +IEEVLRQK+H+SFKN+KIVSNRM+FD DGHLVSFKGKTIH LNKNEHALDMA PLH+  
Sbjct: 200 VIEEVLRQKLHRSFKNIKIVSNRMIFDGDGHLVSFKGKTIHVLNKNEHALDMAGPLHDEL 259

Query: 268 GDTDGPNYDNASVKNRTNVLLLGDHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNA 327
           GD+DGPN D+ASVK RTNVLLLGDHIGDLGMSDGL YETRISVGFLNDN+E +LD+YR A
Sbjct: 260 GDSDGPNEDSASVKKRTNVLLLGDHIGDLGMSDGLDYETRISVGFLNDNVEKSLDSYRKA 319

Query: 328 FDIVYLNDAPMWEVVELVSQLCSNEA 353
           FD+VYLND PMW VV+LVSQLCS E 
Sbjct: 320 FDLVYLNDGPMWGVVKLVSQLCSTEG 345

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356576391|ref|XP_003556315.1| PREDICTED: cytosolic 5'-nucleotidase 3-like [Glycine max] Back     alignment and taxonomy information
>gi|147777087|emb|CAN70066.1| hypothetical protein VITISV_015731 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357442777|ref|XP_003591666.1| Cytosolic 5'-nucleotidase III-like protein [Medicago truncatula] gi|358346061|ref|XP_003637091.1| Cytosolic 5'-nucleotidase III-like protein [Medicago truncatula] gi|355480714|gb|AES61917.1| Cytosolic 5'-nucleotidase III-like protein [Medicago truncatula] gi|355503026|gb|AES84229.1| Cytosolic 5'-nucleotidase III-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449434528|ref|XP_004135048.1| PREDICTED: cytosolic 5'-nucleotidase 3-like [Cucumis sativus] gi|449525884|ref|XP_004169946.1| PREDICTED: cytosolic 5'-nucleotidase 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224113371|ref|XP_002316473.1| predicted protein [Populus trichocarpa] gi|222865513|gb|EEF02644.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255546813|ref|XP_002514465.1| Cytosolic 5'-nucleotidase III, putative [Ricinus communis] gi|223546461|gb|EEF47961.1| Cytosolic 5'-nucleotidase III, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|413933585|gb|AFW68136.1| cytosolic 5-nucleotidase III [Zea mays] Back     alignment and taxonomy information
>gi|194703152|gb|ACF85660.1| unknown [Zea mays] Back     alignment and taxonomy information
>gi|226496569|ref|NP_001150463.1| LOC100284093 [Zea mays] gi|195625198|gb|ACG34429.1| cytosolic 5-nucleotidase III [Zea mays] gi|195639450|gb|ACG39193.1| cytosolic 5-nucleotidase III [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query354
TAIR|locus:2064113315 AT2G38680 [Arabidopsis thalian 0.850 0.955 0.706 1.4e-112
ZFIN|ZDB-GENE-030131-439368 nt5c3a "5'-nucleotidase, cytos 0.768 0.739 0.367 1.5e-44
UNIPROTKB|Q5ZID6331 NT5C3 "Cytosolic 5'-nucleotida 0.748 0.800 0.379 1e-43
UNIPROTKB|Q5ZKF6289 NT5C3B "7-methylguanosine phos 0.762 0.934 0.378 1.3e-43
MGI|MGI:1927186331 Nt5c3 "5'-nucleotidase, cytoso 0.765 0.818 0.377 3.5e-43
RGD|1312013331 Nt5c3a "5'-nucleotidase, cytos 0.765 0.818 0.377 3.5e-43
RGD|1359229292 Nt5c3b "5'-nucleotidase, cytos 0.731 0.886 0.370 3.5e-43
UNIPROTKB|Q6AYP7292 Nt5c3l "Cytosolic 5'-nucleotid 0.731 0.886 0.370 3.5e-43
UNIPROTKB|F1MLB9292 NT5C3L "Uncharacterized protei 0.725 0.880 0.381 4.5e-43
MGI|MGI:1915356292 Nt5c3b "5'-nucleotidase, cytos 0.731 0.886 0.366 7.3e-43
TAIR|locus:2064113 AT2G38680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1111 (396.2 bits), Expect = 1.4e-112, P = 1.4e-112
 Identities = 214/303 (70%), Positives = 256/303 (84%)

Query:    53 MENQDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRG-QSSHGL 111
             ME  +LS  T+   P++L +K++ IR AGPSK QVIADFD TLTRY +NG RG Q+SHGL
Sbjct:     1 MEPCELSANTVIAHPRALTDKMTLIRDAGPSKFQVIADFDATLTRYRVNGLRGRQTSHGL 60

Query:   112 LQQGNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKK 171
             LQQG+  YDAKRQALY++YHPLE SP +P++EKTKLMEEWWGKTH LLIEGGLTYDAIKK
Sbjct:    61 LQQGDAYYDAKRQALYDHYHPLEISPVIPIDEKTKLMEEWWGKTHELLIEGGLTYDAIKK 120

Query:   172 SVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVSNRM 231
             SV+N+ IAFR+GV +LFEFLE+++IPVLIFSAGLAD+IEEVLRQ + ++FKNVKIVSNRM
Sbjct:   121 SVANSSIAFREGVSELFEFLEKKEIPVLIFSAGLADVIEEVLRQNLDRTFKNVKIVSNRM 180

Query:   232 VFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFG-DTDGPNYDNASVKNRTNVLLLG 290
             VF+ DG LVSFKGK IH LNKNEHALDMAAPLH+  G D    + +N ++K R NVLL+G
Sbjct:   181 VFNDDGQLVSFKGKLIHVLNKNEHALDMAAPLHDRLGVDIGEEDEENVNMKERRNVLLMG 240

Query:   291 DHIGDLGMSDGLKYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLCS 350
             DH+GDL MSDGL YETRIS+GFLNDNIE +L++YR +FD+VYLNDAPMW  +ELVS+L S
Sbjct:   241 DHLGDLRMSDGLDYETRISIGFLNDNIEKSLESYRESFDLVYLNDAPMWGALELVSRLFS 300

Query:   351 NEA 353
              EA
Sbjct:   301 TEA 303
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0008253 "5'-nucleotidase activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0005829 "cytosol" evidence=IDA
ZFIN|ZDB-GENE-030131-439 nt5c3a "5'-nucleotidase, cytosolic IIIA" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZID6 NT5C3 "Cytosolic 5'-nucleotidase 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKF6 NT5C3B "7-methylguanosine phosphate-specific 5'-nucleotidase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1927186 Nt5c3 "5'-nucleotidase, cytosolic III" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1312013 Nt5c3a "5'-nucleotidase, cytosolic IIIA" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1359229 Nt5c3b "5'-nucleotidase, cytosolic IIIB" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AYP7 Nt5c3l "Cytosolic 5'-nucleotidase III-like protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MLB9 NT5C3L "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915356 Nt5c3b "5'-nucleotidase, cytosolic IIIB" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.766
3rd Layer3.1.3.50.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
pfam05822246 pfam05822, UMPH-1, Pyrimidine 5'-nucleotidase (UMP 1e-108
TIGR01544277 TIGR01544, HAD-SF-IE, haloacid dehalogenase superf 2e-68
TIGR01489188 TIGR01489, DKMTPPase-SF, 2,3-diketo-5-methylthio-1 1e-06
COG4359220 COG4359, COG4359, Uncharacterized conserved protei 4e-06
TIGR01488177 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superf 9e-06
>gnl|CDD|147785 pfam05822, UMPH-1, Pyrimidine 5'-nucleotidase (UMPH-1) Back     alignment and domain information 
 Score =  317 bits (814), Expect = e-108
 Identities = 112/260 (43%), Positives = 153/260 (58%), Gaps = 19/260 (7%)

Query: 94  TLTRYFINGSRGQSSHGLLQQG---NPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEE 150
           TL+++  NG R  +SH +         E   K   LY  Y+P+E  P + +EEK   M E
Sbjct: 2   TLSKFRYNGERCPTSHNIFDNCKSITEECRKKLVELYHKYYPIEIDPHLTIEEKVPYMVE 61

Query: 151 WWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIE 210
           WWGK+H LLIE GL  DAI + V  + I  RDG  + F+ L++ +IPVLIFSAGL D++E
Sbjct: 62  WWGKSHDLLIEQGLQKDAIAEVVKESDIMLRDGYDEFFDKLQQLNIPVLIFSAGLGDVLE 121

Query: 211 EVLRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDT 270
           EVLRQ  +    NVK+VSN M FD +G L  FKG  IH+ NKNE  LD            
Sbjct: 122 EVLRQA-NVYHPNVKVVSNFMDFDDNGVLNGFKGPLIHTFNKNESVLD------------ 168

Query: 271 DGPNYDNASVKNRTNVLLLGDHIGDLGMSDGL-KYETRISVGFLNDNIENNLDNYRNAFD 329
               +D   +K RTN++LLGD +GDLGM+DG+   E  + +GFLND +E NLD Y +++D
Sbjct: 169 GTEYFD--QLKKRTNIILLGDSLGDLGMADGVPSVEHILKIGFLNDKVEENLDKYMDSYD 226

Query: 330 IVYLNDAPMWEVVELVSQLC 349
           IV ++D  M     ++  + 
Sbjct: 227 IVLVDDETMDVPNAILQMIL 246

This family consists of several eukaryotic pyrimidine 5'-nucleotidase proteins. P5'N-1, also known as uridine monophosphate hydrolase-1 (UMPH-1), is a member of a large functional group of enzymes, characterized by the ability to dephosphorylate nucleic acids. P5'N-1 catalyzes the dephosphorylation of pyrimidine nucleoside monophosphates to the corresponding nucleosides. Deficiencies in this proteins function can lead to several different disorders in humans. Length = 246
>gnl|CDD|130607 TIGR01544, HAD-SF-IE, haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>gnl|CDD|213629 TIGR01489, DKMTPPase-SF, 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>gnl|CDD|226802 COG4359, COG4359, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233435 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 354
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 100.0
KOG3128298 consensus Uncharacterized conserved protein [Funct 100.0
PF05822246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 100.0
COG4359220 Uncharacterized conserved protein [Function unknow 99.96
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 99.95
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.94
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.93
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 99.89
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.84
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 99.84
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.82
PLN02954224 phosphoserine phosphatase 99.82
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.76
PRK11133322 serB phosphoserine phosphatase; Provisional 99.7
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.68
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.67
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.62
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.59
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.56
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 99.42
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 99.34
PRK11590211 hypothetical protein; Provisional 99.32
PRK13288214 pyrophosphatase PpaX; Provisional 99.06
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.05
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.0
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 98.98
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 98.98
PRK13222226 phosphoglycolate phosphatase; Provisional 98.97
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 98.96
COG0546220 Gph Predicted phosphatases [General function predi 98.95
PRK13225273 phosphoglycolate phosphatase; Provisional 98.95
PRK11587218 putative phosphatase; Provisional 98.91
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 98.9
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 98.9
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.89
PRK13226229 phosphoglycolate phosphatase; Provisional 98.88
PRK14988224 GMP/IMP nucleotidase; Provisional 98.88
PLN02770248 haloacid dehalogenase-like hydrolase family protei 98.86
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 98.85
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 98.83
PLN02779286 haloacid dehalogenase-like hydrolase family protei 98.83
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 98.8
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 98.8
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 98.79
PRK13223272 phosphoglycolate phosphatase; Provisional 98.78
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 98.78
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 98.76
PLN02575381 haloacid dehalogenase-like hydrolase 98.74
PLN02177 497 glycerol-3-phosphate acyltransferase 98.7
PRK09449224 dUMP phosphatase; Provisional 98.67
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 98.65
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 98.64
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 98.62
PLN02940 382 riboflavin kinase 98.59
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 98.58
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 98.57
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 98.57
PRK10563221 6-phosphogluconate phosphatase; Provisional 98.51
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 98.48
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 98.47
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.32
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 98.29
PRK08238 479 hypothetical protein; Validated 98.26
COG0637221 Predicted phosphatase/phosphohexomutase [General f 98.25
PRK10748238 flavin mononucleotide phosphatase; Provisional 98.21
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 98.2
PLN02811220 hydrolase 98.1
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 98.02
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 97.93
PHA02597197 30.2 hypothetical protein; Provisional 97.92
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 97.88
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 97.86
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 97.76
PLN02499 498 glycerol-3-phosphate acyltransferase 97.71
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 97.68
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 97.66
COG4030315 Uncharacterized protein conserved in archaea [Func 97.65
TIGR01497 675 kdpB K+-transporting ATPase, B subunit. One sequen 97.64
PRK01122 679 potassium-transporting ATPase subunit B; Provision 97.57
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 97.55
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 97.53
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 97.52
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 97.51
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 97.49
PRK15122 903 magnesium-transporting ATPase; Provisional 97.46
PRK14010 673 potassium-transporting ATPase subunit B; Provision 97.46
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.45
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 97.45
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 97.44
PRK10671834 copA copper exporting ATPase; Provisional 97.44
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 97.35
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 97.32
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 97.2
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 97.2
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 97.2
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 97.17
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 97.13
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 97.13
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 97.12
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 97.05
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 96.98
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 96.98
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 96.93
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 96.9
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 96.89
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 96.85
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 96.76
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 96.75
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 96.72
PLN02382 413 probable sucrose-phosphatase 96.67
PRK06769173 hypothetical protein; Validated 96.62
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 96.56
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 96.55
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 96.51
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 96.44
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 96.41
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 96.34
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 96.22
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 95.92
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 95.72
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 95.67
TIGR01684301 viral_ppase viral phosphatase. These proteins also 95.51
KOG0204 1034 consensus Calcium transporting ATPase [Inorganic i 95.43
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 95.42
PHA03398303 viral phosphatase superfamily protein; Provisional 95.15
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 94.95
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 94.94
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 94.69
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 94.55
COG4087152 Soluble P-type ATPase [General function prediction 94.15
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 94.06
PHA02530300 pseT polynucleotide kinase; Provisional 93.77
TIGR01675229 plant-AP plant acid phosphatase. This model explic 93.77
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 93.26
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 93.19
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 92.97
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 92.9
PLN03190 1178 aminophospholipid translocase; Provisional 92.28
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 92.0
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 91.72
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 91.66
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 91.66
PLN02151354 trehalose-phosphatase 91.43
KOG0206 1151 consensus P-type ATPase [General function predicti 90.83
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 90.7
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 90.59
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 90.55
COG0241181 HisB Histidinol phosphatase and related phosphatas 90.29
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 89.73
KOG3128298 consensus Uncharacterized conserved protein [Funct 88.67
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 86.98
COG4229229 Predicted enolase-phosphatase [Energy production a 86.77
PRK10976266 putative hydrolase; Provisional 86.6
PRK01158230 phosphoglycolate phosphatase; Provisional 84.66
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 84.3
PRK10513270 sugar phosphate phosphatase; Provisional 84.04
PLN02580384 trehalose-phosphatase 83.18
COG5663194 Uncharacterized conserved protein [Function unknow 82.74
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 81.65
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 81.17
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 80.96
KOG0203 1019 consensus Na+/K+ ATPase, alpha subunit [Inorganic 80.78
COG2216681 KdpB High-affinity K+ transport system, ATPase cha 80.28
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 80.02
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information 
Probab=100.00  E-value=1e-74  Score=550.64  Aligned_cols=272  Identities=38%  Similarity=0.657  Sum_probs=253.2

Q ss_pred             EECChhHHHHHHHHHHhcCCCcEEEEEecccccccccc-cCccccchHHHhhccC---hhHHHHHHHHHHhhCCCCCCCC
Q 018557           63 IKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFI-NGSRGQSSHGLLQQGN---PEYDAKRQALYEYYHPLEFSPT  138 (354)
Q Consensus        63 ~i~d~~~~~~k~~~~~~~g~~kl~Vi~DFDgTIT~~~~-~g~~~ds~~~il~~~~---~e~~~~~~~L~~~y~p~E~d~~  138 (354)
                      +|+||++|++||++|+++|+++||||+|||+|||+|++ ||+|++|||++|+++.   +++++++++||++|||||+||+
T Consensus         1 ~i~d~~~~~~~~~~~~~~g~~~lqvisDFD~Tlt~~~~~~g~~~~s~~~~~~~~~~~~~~~~~~~~~l~~~Y~PiE~d~~   80 (277)
T TIGR01544         1 RMADPTRVEEIICGLVKGGAAKLQIISDFDYTLSRFSYEDGKRCPTCHGIFDNCKLLTDECRKKLLQLKEKYYPIEVDPV   80 (277)
T ss_pred             CCCCHHHHHHHHHHHHhcChhheEEeeccCccceeeecCCCCCCcchHhHHhhCCCCCHHHHHHHHHHHhhccceecCCC
Confidence            58999999999999999999999999999999999996 9999999999999986   7999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHhcCCcccccHHHHHHHHHhCCCCEEEEecChHHHHHHHHHHhcC
Q 018557          139 VPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVH  218 (354)
Q Consensus       139 is~~Ek~~~m~ew~~~~~~ll~~~glt~~~i~e~v~~~~i~LrpG~~efl~~L~~~gipv~I~SaG~~~~Ie~vL~~~~g  218 (354)
                      ||.+||+++|+|||+++|+|+++.+++++++.+++++++++++||+.+|+++|+++|+|++|+|||++.+|+.+|++. |
T Consensus        81 ~~~~eK~~~m~eWw~k~~~l~~~~~~~~e~i~~~v~~~~l~l~pG~~efl~~L~~~GIpv~IvS~G~~~~Ie~vL~~l-g  159 (277)
T TIGR01544        81 LTVEEKYPYMVEWWTKSHGLLVQQAFPKAKIKEIVAESDVMLKDGYENFFDKLQQHSIPVFIFSAGIGNVLEEVLRQA-G  159 (277)
T ss_pred             CChHHhhhHHHHHHHHHHHHHhcCCCCHHHHHHHHhhcCCccCcCHHHHHHHHHHCCCcEEEEeCCcHHHHHHHHHHc-C
Confidence            999999999999999999999999999999999998788999999999999999999999999999999999999987 6


Q ss_pred             CCCCcceEEeeeeEEcCCCcEEecCCCccccCCCCcccccccccccccCCCCCCCCccccccCCCceEEEEcCCCCChhc
Q 018557          219 KSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHIGDLGM  298 (354)
Q Consensus       219 ~~~~ni~IvSN~~~fd~dG~l~gf~~~~ih~~nK~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~r~~vI~iGDg~~Dl~m  298 (354)
                      ...++++|+||+|.|+++|.++||++|++|+++|++.++...             ...+..+..+.++|++|||.||++|
T Consensus       160 l~~~~~~IvSN~L~f~~dGvltG~~~P~i~~~~K~~~v~~~~-------------~~~~~~~~~~~~vI~vGDs~~Dl~m  226 (277)
T TIGR01544       160 VYHPNVKVVSNFMDFDEDGVLKGFKGPLIHTFNKNHDVALRN-------------TEYFNQLKDRSNIILLGDSQGDLRM  226 (277)
T ss_pred             CCCcCceEEeeeEEECCCCeEeCCCCCcccccccHHHHHHHH-------------HHHhCccCCcceEEEECcChhhhhH
Confidence            655789999999999999999999999999999998655211             0112223467899999999999999


Q ss_pred             ccCC-CccceeeeeccchHHHhhHhhhcccccEEEEcCCChHHHHHHHHHH
Q 018557          299 SDGL-KYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQL  348 (354)
Q Consensus       299 a~gl-~~d~vlaiGfL~~~~ee~l~~y~~~fDIV~v~d~t~~~~~~ll~~i  348 (354)
                      ++|+ ..+++++|||||+++|++++.|++.||||+++|+||+||++||+.|
T Consensus       227 a~g~~~~~~~l~igfln~~~e~~l~~y~~~~Divl~~D~t~~v~~~il~~i  277 (277)
T TIGR01544       227 ADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDETLEVANSILQKI  277 (277)
T ss_pred             hcCCCcccceEEEEecccCHHHHHHHHHHhCCEEEECCCCchHHHHHHhhC
Confidence            9999 4789999999999999999999999999999999999999999876

This group of sequences was found during searches for members of the haloacid dehalogenase (HAD) superfamily. All of the conserved catalytic motifs are found. The placement of the variable domain between motifs 1 and 2 indicates membership in subfamily I of the superfamily, but these sequences are sufficiently different from any of the branches (IA, TIGR01493, TIGR01509, TIGR01549; IB, TIGR01488; IC, TIGR01494; ID, TIGR01658; IF TIGR01545) of that subfamily as to constitute a separate branch to now be called IE. Considering that the closest identifiable hit outside of the noise range is to a phosphoserine phosphatase, this group may be considered to be most closely allied to subfamily IB.
>KOG3128 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>KOG0206 consensus P-type ATPase [General function prediction only] Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>KOG3128 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
4fe3_A297 Structure Of Murine Cytosolic 5'-Nucleotidase Iii C 2e-44
2cn1_A292 Crystal Structure Of Human Cytosolic 5'-Nucleotidas 3e-43
2jga_A292 Crystal Structure Of Human Cytosolic 5'-Nucleotidas 3e-43
2bdu_A297 X-Ray Structure Of A Cytosolic 5'-Nucleotidase Iii 1e-42
2g07_A297 X-Ray Structure Of Mouse Pyrimidine 5'-Nucleotidase 6e-42
>pdb|4FE3|A Chain A, Structure Of Murine Cytosolic 5'-Nucleotidase Iii Complexed With Uridinine Monophosphate Length = 297 Back     alignment and structure 
Iteration: 1

 Score =  176 bits (446), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 168/288 (58%), Gaps = 24/288 (8%)
Query: 66  DPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGNPEYDAKRQA 125
           +P  ++  I  +   G +KLQ+I DF+ TL+R+  NG R  + H ++       D  R+ 
Sbjct: 25  NPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRK 84
Query: 126 LY---EYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRD 182
           L    E Y+ +E  P + +EEK   M EW+ K+HGLLIE G+    +K+ V+++ +  ++
Sbjct: 85  LLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKE 144
Query: 183 GVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQK-VHKSFKNVKIVSNRMVFDKDGHLVS 241
           G    F  L++  IPV IFSAG+ D++EEV+RQ  V+ S  NVK+VSN M FD++G L  
Sbjct: 145 GYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHS--NVKVVSNFMDFDENGVLKG 202
Query: 242 FKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNAS-VKNRTNVLLLGDHIGDLGMSD 300
           FKG+ IH  NK++ AL                N D  S +K+ +N++LLGD  GDL M+D
Sbjct: 203 FKGELIHVFNKHDGAL---------------KNTDYFSQLKDNSNIILLGDSQGDLRMAD 247
Query: 301 GLK-YETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQ 347
           G+   E  + +G+LND ++  L+ Y +++DIV + +  + EVV  + Q
Sbjct: 248 GVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESL-EVVNSILQ 294
>pdb|2CN1|A Chain A, Crystal Structure Of Human Cytosolic 5'-Nucleotidase Iii ( Nt5c3)(Casp Target) Length = 292 Back     alignment and structure
>pdb|2JGA|A Chain A, Crystal Structure Of Human Cytosolic 5'-Nucleotidase Iii In Complex With Phosphate And Magnesium Length = 292 Back     alignment and structure
>pdb|2BDU|A Chain A, X-Ray Structure Of A Cytosolic 5'-Nucleotidase Iii From Mus Musculus Mm.158936 Length = 297 Back     alignment and structure
>pdb|2G07|A Chain A, X-Ray Structure Of Mouse Pyrimidine 5'-Nucleotidase Type 1, Phospho- Enzyme Intermediate Analog With Beryllium Fluoride Length = 297 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query354
2g09_A297 Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMP 1e-104
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
>2g09_A Cytosolic 5'-nucleotidase III; uniprot Q9D020, UMPH-1, pyrim nucleotidase 1, P5N-1, NT5C3 protein, AAH38029, BC038029, M LEAD poisoning; HET: PIN; 2.10A {Mus musculus} PDB: 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Length = 297 Back     alignment and structure
 Score =  308 bits (790), Expect = e-104
 Identities = 103/309 (33%), Positives = 167/309 (54%), Gaps = 19/309 (6%)

Query: 44  NRCCSAQNKMENQDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGS 103
           N+  +   KM  +         +P  ++  I  +   G +KLQ+I DFD TL+R+  NG 
Sbjct: 3   NQESAVHLKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYNGK 62

Query: 104 RGQSSHGLLQQGN---PEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLI 160
           R  + H ++        E   K   L E Y+ +E  P + +EEK   M EW+ K+HGLLI
Sbjct: 63  RCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLI 122

Query: 161 EGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKS 220
           E G+    +K+ V+++ +  ++G    F  L++  IPV IFSAG+ D++EEV+RQ     
Sbjct: 123 EQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQA-GVY 181

Query: 221 FKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASV 280
             NVK+VSN M FD++G L  FKG+ IH  NK++ AL       +              +
Sbjct: 182 HSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQ--------------L 227

Query: 281 KNRTNVLLLGDHIGDLGMSDGLK-YETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMW 339
           K+ +N++LLGD  GDL M+DG+   E  + +G+LND ++  L+ Y +++DIV + +  + 
Sbjct: 228 KDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLE 287

Query: 340 EVVELVSQL 348
            V  ++ + 
Sbjct: 288 VVNSILQKT 296
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Length = 236 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 100.0
4gxt_A385 A conserved functionally unknown protein; structur 99.73
3fvv_A232 Uncharacterized protein; unknown function, structu 99.6
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.55
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.52
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.48
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.46
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.43
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.42
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.41
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.39
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.28
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.24
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.03
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.01
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.01
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.01
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.99
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.91
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 98.89
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 98.88
2hsz_A243 Novel predicted phosphatase; structural genomics, 98.86
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 98.84
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 98.84
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 98.83
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 98.82
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.81
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.8
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 98.79
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 98.79
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 98.78
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 98.78
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 98.78
3sd7_A240 Putative phosphatase; structural genomics, haloaci 98.77
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 98.77
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.75
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 98.75
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 98.75
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.75
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 98.74
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 98.73
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 98.72
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 98.72
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 98.72
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 98.72
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 98.71
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 98.7
2zg6_A220 Putative uncharacterized protein ST2620, probable 98.7
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.69
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.69
1te2_A226 Putative phosphatase; structural genomics, phospha 98.68
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.68
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 98.68
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.67
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 98.67
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 98.66
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 98.66
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.65
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 98.65
3mmz_A176 Putative HAD family hydrolase; structural genomics 98.65
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 98.64
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 98.64
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 98.64
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 98.63
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 98.6
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 98.52
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.51
3mn1_A189 Probable YRBI family phosphatase; structural genom 98.49
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.47
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.47
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 98.46
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.45
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 98.43
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.43
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 98.4
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 98.39
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.34
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 98.31
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.31
1y8a_A332 Hypothetical protein AF1437; structural genomics, 98.3
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.27
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 98.23
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 98.19
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 98.16
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 98.12
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 98.09
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 98.04
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 98.03
2p11_A231 Hypothetical protein; putative haloacid dehalogena 98.03
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 98.0
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 97.95
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 97.9
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 97.89
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 97.74
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 97.74
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 96.87
2o2x_A218 Hypothetical protein; structural genomics, joint c 97.69
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 97.66
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 97.65
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 97.64
3ib6_A189 Uncharacterized protein; structural genomics, unkn 97.64
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 97.61
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 97.61
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 97.59
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 97.58
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 97.54
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 97.5
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 97.47
3dao_A283 Putative phosphatse; structural genomics, joint ce 97.42
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 97.35
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 97.34
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 97.32
1l6r_A227 Hypothetical protein TA0175; structural genomics, 97.3
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 97.3
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 97.27
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 97.25
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 97.24
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 97.22
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 97.2
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 97.02
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 96.98
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 96.95
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 96.9
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 96.83
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 96.58
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 96.54
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 96.44
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 96.29
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 96.17
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 95.15
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 94.07
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 93.77
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 93.77
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 91.48
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 91.03
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 90.65
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 90.0
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 89.31
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 88.68
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 87.42
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 87.34
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 87.11
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 86.04
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 85.72
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 85.62
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 83.83
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 83.27
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 82.42
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 82.06
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 82.01
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 81.65
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 81.12
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
Probab=100.00  E-value=2.2e-55  Score=418.35  Aligned_cols=279  Identities=35%  Similarity=0.609  Sum_probs=256.3

Q ss_pred             ccCCCceEECChhHHHHHHHHHHhcCCCcEEEEEecccccccccccCccccchHHHhhccC---hhHHHHHHHHHHhhCC
Q 018557           56 QDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGN---PEYDAKRQALYEYYHP  132 (354)
Q Consensus        56 ~~~~~~v~i~d~~~~~~k~~~~~~~g~~kl~Vi~DFDgTIT~~~~~g~~~ds~~~il~~~~---~e~~~~~~~L~~~y~p  132 (354)
                      .-+++.|+|+||+.|++|+++|+++|+++||||||||||||+++.||+++.+++++++++.   +++.+..++|+++|+|
T Consensus        15 ~l~k~~v~ikd~~~~e~~i~~~~kgg~~kL~VV~DfdgTLT~~~~~g~~~~s~~~i~e~~~~~~~~~~~~~~~l~~~y~~   94 (297)
T 4fe3_A           15 EFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFNMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYA   94 (297)
T ss_dssp             GGTSTTEECSCHHHHHHHHHHHHHHHHHHEEEEECCTTTTBCSEETTEECCCHHHHHHTSTTSCHHHHHHHHHHHHHHHH
T ss_pred             HHhcCCeEEcChHHHHHHHHHHHhCcchhEEEEEcCCCCceeeccCCeEeechHHHHHhhhhcCHHHHHHHHHHHHhhcc
Confidence            3466789999999999999999999999999999999999999999999999999999865   7888899999999999


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHhcCCcccccHHHHHHHHHhCCCCEEEEecChHHHHHHH
Q 018557          133 LEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEV  212 (354)
Q Consensus       133 ~E~d~~is~~Ek~~~m~ew~~~~~~ll~~~glt~~~i~e~v~~~~i~LrpG~~efl~~L~~~gipv~I~SaG~~~~Ie~v  212 (354)
                      +|.++.++.+|+.+.|.+||.+.++++.+.|++++.+.+++...++++|||+.+++++|+++|++++|+|+|+.++++++
T Consensus        95 ~e~~~~~~~~ek~~~~~~~~~~~~e~l~~~gl~~~~~~~~v~~~~i~l~~g~~e~i~~l~~~gi~v~ivSgg~~~~i~~i  174 (297)
T 4fe3_A           95 IEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEV  174 (297)
T ss_dssp             HHHCSSSCHHHHHHHHHHHHHHHHHHHHHTTCBGGGHHHHHHTSCCCBCBTHHHHHHHHHHTTCCEEEEEEEEHHHHHHH
T ss_pred             ccccccccHHHhhhhhHHhhhhhHHHHhhcCccHHHHHHHHHhcCCCCCCcHHHHHHHHHHcCCeEEEEeCCcHHHHHHH
Confidence            99999999999999999999999999999999999999999988999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCCcceEEeeeeEEcCCCcEEecCCCccccCCCCcccccccccccccCCCCCCCCccccccCCCceEEEEcCC
Q 018557          213 LRQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDH  292 (354)
Q Consensus       213 L~~~~g~~~~ni~IvSN~~~fd~dG~l~gf~~~~ih~~nK~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~r~~vI~iGDg  292 (354)
                      +++. |..+++++|+||.+.|++++...+|.++.+|.++|....+...            .+  ....+.+.+|+++|||
T Consensus       175 ~~~~-g~~~~~~~i~~n~l~~~~~~~~~~~~~~~i~~~~k~~~~~k~~------------~~--~~~~~~~~~v~~vGDG  239 (297)
T 4fe3_A          175 IRQA-GVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKNT------------DY--FSQLKDNSNIILLGDS  239 (297)
T ss_dssp             HHHT-TCCCTTEEEEEECEEECTTSBEEEECSSCCCTTCHHHHHHTCH------------HH--HHHTTTCCEEEEEESS
T ss_pred             HHHc-CCCcccceEEeeeEEEcccceeEeccccccchhhcccHHHHHH------------HH--HHhhccCCEEEEEeCc
Confidence            9987 7777899999999999988888889999999998875433210            11  1222467899999999


Q ss_pred             CCChhcccCC-CccceeeeeccchHHHhhHhhhcccccEEEEcCCChHHHHHHHHHHh
Q 018557          293 IGDLGMSDGL-KYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLC  349 (354)
Q Consensus       293 ~~Dl~ma~gl-~~d~vlaiGfL~~~~ee~l~~y~~~fDIV~v~d~t~~~~~~ll~~i~  349 (354)
                      +||++|++++ .+|++++||||++++++..+.|+++|||||++|++|++|++||++|+
T Consensus       240 iNDa~m~k~l~~advgiaiGfl~~~v~~~~d~~~e~~Divl~~d~~~~v~~~il~~i~  297 (297)
T 4fe3_A          240 QGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL  297 (297)
T ss_dssp             GGGGGTTTTCSCCSEEEEEEEECSSHHHHHHHHHHHSSEEEETCCBCHHHHHHHHHHC
T ss_pred             HHHHHHHhCccccCeEEEEEecchhHHHhHHHHHhhCCEEEECCCChHHHHHHHHhhC
Confidence            9999999988 69999999999999999999999999999999999999999999984
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 354
d2bdua1291 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III 1e-86
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Length = 291 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Pyrimidine 5'-nucleotidase (UMPH-1)
domain: Cytosolic 5'-nucleotidase III
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  261 bits (668), Expect = 1e-86
 Identities = 102/301 (33%), Positives = 163/301 (54%), Gaps = 19/301 (6%)

Query: 52  KMENQDLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGL 111
           KM  +         +P  ++  I  +   G +KLQ+I DFD TL+R+  NG R  + H +
Sbjct: 5   KMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYNGKRCPTCHNI 64

Query: 112 LQQ---GNPEYDAKRQALYEYYHPLEFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDA 168
           +        E   K   L E Y+ +E  P + +EEK   M EW+ K+HGLLIE G+    
Sbjct: 65  IDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAK 124

Query: 169 IKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVLRQKVHKSFKNVKIVS 228
           +K+ V+++ +  ++G    F  L++  IPV IFSAG+ D++EEV+RQ       NVK+VS
Sbjct: 125 LKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQA-GVYHSNVKVVS 183

Query: 229 NRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLL 288
           N M FD++G L  FKG+ IH  NK++ AL       +               K+ +N++L
Sbjct: 184 NFMDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQL--------------KDNSNIIL 229

Query: 289 LGDHIGDLGMSDGL-KYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQ 347
           LGD  GDL M+DG+   E  + +G+LND ++  L+ Y +++DIV + +  +  V  ++ +
Sbjct: 230 LGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQK 289

Query: 348 L 348
            
Sbjct: 290 T 290

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query354
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 100.0
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.89
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.85
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.42
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.19
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.02
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 98.97
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 98.92
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 98.87
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 98.83
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 98.78
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 98.71
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 98.57
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 98.54
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 98.51
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 98.38
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 98.36
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 98.34
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 98.23
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.15
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 98.14
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 98.13
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 97.89
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 97.79
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 97.75
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 97.6
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 97.41
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 97.04
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 96.86
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 96.53
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 96.14
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 95.94
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 95.93
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 95.91
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 95.76
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 95.44
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 95.14
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 94.95
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 94.16
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 93.86
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 93.19
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 92.17
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 92.08
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 91.87
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 91.69
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 90.38
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 90.14
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 88.49
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 86.25
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 85.4
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 84.73
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 83.11
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 82.97
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 82.72
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 82.52
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 81.67
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 81.61
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Pyrimidine 5'-nucleotidase (UMPH-1)
domain: Cytosolic 5'-nucleotidase III
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=8e-71  Score=526.50  Aligned_cols=278  Identities=36%  Similarity=0.608  Sum_probs=259.6

Q ss_pred             cCCCceEECChhHHHHHHHHHHhcCCCcEEEEEecccccccccccCccccchHHHhhccC---hhHHHHHHHHHHhhCCC
Q 018557           57 DLSKFTIKGDPQSLQNKISQIRMAGPSKLQVIADFDGTLTRYFINGSRGQSSHGLLQQGN---PEYDAKRQALYEYYHPL  133 (354)
Q Consensus        57 ~~~~~v~i~d~~~~~~k~~~~~~~g~~kl~Vi~DFDgTIT~~~~~g~~~ds~~~il~~~~---~e~~~~~~~L~~~y~p~  133 (354)
                      -.+++|+|+||++|++||++|+++|+++||||||||||||++++||.+++|+|++++++.   +++.++..+|+++|+|+
T Consensus        10 l~~~~v~i~d~~~v~~~i~~~~~~g~~klqVisDFD~Tit~~~~~~~~~~s~~~i~~~~~~~~e~~~~~~~~l~~~y~p~   89 (291)
T d2bdua1          10 FQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYNGKRCPTCHNIIDNCKLVTDECRRKLLQLKEQYYAI   89 (291)
T ss_dssp             GGSTTEECSCHHHHHHHHHHHHHHTGGGEEEEECCTTTTBCSEETTEECCCHHHHHHTSTTSCHHHHHHHHHHHHHHHHH
T ss_pred             hccCcEEECCHHHHHHHHHHHHhcChhhEEEEecCCCcccccccCCcccchhHHHHhhCCCCCHHHHHHHHHHHhhhccc
Confidence            456889999999999999999999999999999999999999999999999999999865   78888999999999999


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHhcCCcccccHHHHHHHHHhCCCCEEEEecChHHHHHHHH
Q 018557          134 EFSPTVPLEEKTKLMEEWWGKTHGLLIEGGLTYDAIKKSVSNALIAFRDGVVKLFEFLEERDIPVLIFSAGLADIIEEVL  213 (354)
Q Consensus       134 E~d~~is~~Ek~~~m~ew~~~~~~ll~~~glt~~~i~e~v~~~~i~LrpG~~efl~~L~~~gipv~I~SaG~~~~Ie~vL  213 (354)
                      |+|+++|++||+++|.|||.++|+++.+.|++++++.+++.++++.||||+.||+++|+++|+|++|+|||++++|+++|
T Consensus        90 E~d~~~s~~ek~~~m~ew~~~~~~ll~~~~l~~~~i~~~v~~~~i~Lr~G~~e~~~~l~~~~i~~~IvSgG~~~~ie~vl  169 (291)
T d2bdua1          90 EVDPVLTVEEKFPYMVEWYTKSHGLLIEQGIPKAKLKEIVADSDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVI  169 (291)
T ss_dssp             HTCSSSCHHHHHHHHHHHHHHHHHHHHHHCCBGGGHHHHHHHSCCCBCBTHHHHHHHHHHHTCCEEEEEEEEHHHHHHHH
T ss_pred             ccCCCCCHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHhcCCCcccCHHHHHHHHHHcCCeEEEEcCChHHHHHHHH
Confidence            99999999999999999999999999999999999999999889999999999999999999999999999999999999


Q ss_pred             HHhcCCCCCcceEEeeeeEEcCCCcEEecCCCccccCCCCcccccccccccccCCCCCCCCccccccCCCceEEEEcCCC
Q 018557          214 RQKVHKSFKNVKIVSNRMVFDKDGHLVSFKGKTIHSLNKNEHALDMAAPLHEHFGDTDGPNYDNASVKNRTNVLLLGDHI  293 (354)
Q Consensus       214 ~~~~g~~~~ni~IvSN~~~fd~dG~l~gf~~~~ih~~nK~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~r~~vI~iGDg~  293 (354)
                      ++. |..++|++||||++.|+++|...+|+++++|+++|++..+..              ...+...+.+.++|++|||+
T Consensus       170 ~~l-g~~~~ni~I~sN~l~f~~~~~~~~~~~~~i~~~~K~~~~~~~--------------~~~~~~~~~~~~vI~iGDs~  234 (291)
T d2bdua1         170 RQA-GVYHSNVKVVSNFMDFDENGVLKGFKGELIHVFNKHDGALKN--------------TDYFSQLKDNSNIILLGDSQ  234 (291)
T ss_dssp             HHT-TCCBTTEEEEEECEEECTTSBEEEECSSCCCTTCHHHHHHTT--------------HHHHHHTTTCCEEEEEESSS
T ss_pred             HHc-CCCccCceEEeeEEEEeCCeeEeeccCCccccccCcchhhhh--------------HHHHhccCCcCcEEEEeCCH
Confidence            987 777789999999999999999999999999999998765531              11123335688999999999


Q ss_pred             CChhcccCC-CccceeeeeccchHHHhhHhhhcccccEEEEcCCChHHHHHHHHHHh
Q 018557          294 GDLGMSDGL-KYETRISVGFLNDNIENNLDNYRNAFDIVYLNDAPMWEVVELVSQLC  349 (354)
Q Consensus       294 ~Dl~ma~gl-~~d~vlaiGfL~~~~ee~l~~y~~~fDIV~v~d~t~~~~~~ll~~i~  349 (354)
                      ||++|++|+ .++++++|||||+++++++++|+++||||+++|+||++|+.||++|+
T Consensus       235 ~Dl~Ma~g~~~~~~~l~igFL~~~~ee~l~~y~~~~DIVl~~d~~~~v~~~il~~i~  291 (291)
T d2bdua1         235 GDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVKEESLEVVNSILQKTL  291 (291)
T ss_dssp             GGGGTTTTCSCCSEEEEEEEECSCHHHHHHHHHHHSSEEEETCCBCHHHHHHHHHHC
T ss_pred             hHHHHHhCCccccceeeeehhHhhHHHHHHHHHhcCCEEEecCCChhHHHHHHHHhC
Confidence            999999998 48999999999999999999999999999999999999999999984
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure