Citrus Sinensis ID: 018558

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----

MDYRTESSETLRNKCAACFRQFNRLEHLVEHMRTSYHSVHEPVCGICKKHCRSFESLREHLIGPLPKQECKNVFNNRGCRFCLAILDGPNARRLHQERCQMVSSATTGLNARLANLGVRDSLTIDNTHTRDPQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLYMRMKSQAHKREDYPLASDPQNRNNYASWRQTELERMSPEEMLAISRSDYYCWCLDR

ccccccccccccccccccccccccccccHHHccccccccccccccccccccccHHHHccccccccccHHHccccccccccccccccccccHHHHHHHHHccccccccccHHHHccccccccccccccccccccEEEEEEcEEEEcccccEEEEEEEEEEEccccEEEEEEccccccEEcccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccEEEEEccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccHHHHHHccccccEEEEccc

ccccccccccccccHHHHHHHHcHHHHHHHHHHHHccccccccccccccccccHHHHHHHccccccHHHHHHHHHHcccccHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEcEEccccccccccEEEEEEEEEccccEEEEEEEcccccEEEcEEEEccccHHHHcccccHHHHHHHHHHHHHcccccEEEEccccccEEEEEccHHHHHHHHcccccccccccccccccHHccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHcccccEEEEEccc

mdyrtesseTLRNKCAACFRQFNRLEHLVEHMRtsyhsvhepvcgicKKHCRSFESLRehligplpkqecknvfnnrgcrfclaildgpnarrLHQERCQMVSSATTGLNARLanlgvrdsltidnthtrdPQVVAIACKmvgggsdgsldlcgrvciideyENIIFhayvkppipvtsyryettgirpehlrdaiplKQVQRKIQDFLcngepmwkirprgsraRILVGHgldhdldrlqveypaimtrdtakypplmktsklsNSLKYLTQAYlgydiqigiqdpydDCVATMRLYMRMKsqahkredyplasdpqnrnnYASWRQTElermspeemlaisrsdyycwcldr

mdyrtessetlrnkCAACFRQFNRLEHLVEHMRTSYHSVHEPVCGICKKHCRSFESLREHligplpkqeCKNVFNNRGCRFCLAILDGPNARRLHQERCQMVSSATTGLNARLANLGVRDSltidnthtrdpQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFhayvkppipVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCngepmwkirprGSRARILVGHGLDHDLDRLQVEYPAIMtrdtakypplmktSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLYMRMKSQahkredyplasdpqnrnNYASWRQTElermspeemlaisrsdyycwCLDR

MDYRTESSETLRNKCAACFRQFNRLEHLVEHMRTSYHSVHEPVCGICKKHCRSFESLREHLIGPLPKQECKNVFNNRGCRFCLAILDGPNARRLHQERCQMVSSATTGLNARLANLGVRDSLTIDNTHTRDPQVVAIACKMVgggsdgsldlCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLYMRMKSQAHKREDYPLASDPQNRNNYASWRQTELERMSPEEMLAISRSDYYCWCLDR

************NKCAACFRQFNRLEHLVEHMRTSYHSVHEPVCGICKKHCRSFESLREHLIGPLPKQECKNVFNNRGCRFCLAILDGPNARRLHQERCQMVSSATTGLNARLANLGVRDSLTIDNTHTRDPQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLYMR***************************************LAISRSDYYCWCL**

******************F*QFN***********************CKKH*****************QECKNVFNNRGCRFCLAILDGP********************************************VVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLYMRMKSQAHK***************************************YYCWCLDR

**********LRNKCAACFRQFNRLEHLVEHMRTSYHSVHEPVCGICKKHCRSFESLREHLIGPLPKQECKNVFNNRGCRFCLAILDGPNARRLHQERCQMVSSATTGLNARLANLGVRDSLTIDNTHTRDPQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLYMRMKSQAHKREDYPLASDPQNRNNYASWRQTELERMSPEEMLAISRSDYYCWCLDR

***********RNKCAACFRQFNRLEHLVEHMRTSYHSVHEPVCGICKKHCRSFESLREHLIGPLPKQECKNVFNNRGCRFCLAILDGPNARRL***********************************RDPQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLYMRMKSQAHKREDY**************WRQTELERMSPEEMLAISRSDYYCWCLDR

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		354	2.2.26 [Sep-21-2011]
Q08237		289	RNA exonuclease 4 OS=Sacc	yes	no	0.502	0.615	0.312	2e-24
Q9GZR2		422	RNA exonuclease 4 OS=Homo	yes	no	0.480	0.402	0.347	6e-23
Q6CMT3		294	RNA exonuclease 4 OS=Kluy	yes	no	0.423	0.510	0.343	5e-22
Q6PAQ4		432	RNA exonuclease 4 OS=Mus	yes	no	0.483	0.395	0.340	5e-22
Q5A3Q0		285	RNA exonuclease 4 OS=Cand	N/A	no	0.471	0.585	0.349	8e-22
Q91560		421	RNA exonuclease 4 OS=Xeno	N/A	no	0.545	0.458	0.325	1e-21
Q757I9		285	RNA exonuclease 4 OS=Ashb	yes	no	0.429	0.533	0.327	1e-20
Q4WHF8		310	RNA exonuclease 4 OS=Neos	yes	no	0.451	0.516	0.361	1e-20
Q6FQA0		263	RNA exonuclease 4 OS=Cand	yes	no	0.435	0.585	0.323	2e-20
Q4IEV5		319	RNA exonuclease 4 OS=Gibb	yes	no	0.437	0.485	0.370	2e-20

>sp\|Q08237\|REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX4 PE=1 SV=1	Back alignment and function desciption

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 103/195 (52%), Gaps = 17/195 (8%)

Query: 116 LGVRDSLTIDNTHTRD-PQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPP 174
           +G+ +   I++  +++  + +A+ C+ VG G +G      R+ I++ + +++   +VKP 
Sbjct: 102 VGISEDTRINSNKSKEIGKYIAMDCEFVGVGPEGKESALARISIVNYFGHVVLDEFVKPR 161

Query: 175 IPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLD 234
             V  +R   +GI+PEH+++AI  K+ Q+K  D L                RILVGH L 
Sbjct: 162 EKVVEWRTWVSGIKPEHMKNAITFKEAQKKTADIL--------------EGRILVGHALK 207

Query: 235 HDLDRLQVEYPAIMTRDTAKYPPLMK--TSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCV 292
           HDL+ L + +P  + RDT+++ P  K      + SLK LT+  L   IQ G     +D  
Sbjct: 208 HDLEALMLSHPKSLLRDTSRHLPFRKLYAKGKTPSLKKLTREVLKISIQEGEHSSVEDAR 267

Query: 293 ATMRLYMRMKSQAHK 307
           ATM LY + K++  K
Sbjct: 268 ATMLLYKKEKTEFEK 282

Exoribonuclease involved in ribosome biosynthesis. Involved in the processing of ITS1, the internal transcribed spacer localized between the 18S and 5.8S rRNAs.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -

>sp\|Q9GZR2\|REXO4_HUMAN RNA exonuclease 4 OS=Homo sapiens GN=REXO4 PE=1 SV=2	Back alignment and function description

>sp\|Q6CMT3\|REXO4_KLULA RNA exonuclease 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX4 PE=3 SV=1	Back alignment and function description

>sp\|Q6PAQ4\|REXO4_MOUSE RNA exonuclease 4 OS=Mus musculus GN=Rexo4 PE=2 SV=2	Back alignment and function description

>sp\|Q5A3Q0\|REXO4_CANAL RNA exonuclease 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX4 PE=3 SV=1	Back alignment and function description

>sp\|Q91560\|REXO4_XENLA RNA exonuclease 4 OS=Xenopus laevis GN=rexo4 PE=2 SV=2	Back alignment and function description

>sp\|Q757I9\|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1	Back alignment and function description

>sp\|Q4WHF8\|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1	Back alignment and function description

>sp\|Q6FQA0\|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1	Back alignment and function description

>sp\|Q4IEV5\|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		354
79422951		357	exonuclease-like protein [Arabidopsis th	0.994	0.985	0.783	1e-170
45935039		357	exonuclease family protein [Arabidopsis	0.994	0.985	0.780	1e-169
302398687		351	C2H2L domain class transcription factor	0.988	0.997	0.787	1e-169
297815068		357	predicted protein [Arabidopsis lyrata su	0.994	0.985	0.774	1e-168
356573815		354	PREDICTED: RNA exonuclease 4-like [Glyci	0.991	0.991	0.773	1e-168
9294313		353	exonuclease-like protein [Arabidopsis th	0.977	0.980	0.770	1e-166
225452464		395	PREDICTED: apoptosis-enhancing nuclease-	0.980	0.878	0.782	1e-165
147810158		351	hypothetical protein VITISV_036419 [Viti	0.974	0.982	0.784	1e-164
224141305		324	predicted protein [Populus trichocarpa]	0.915	1.0	0.789	1e-162
15242645		348	exonuclease-like protein [Arabidopsis th	0.971	0.988	0.753	1e-160

>gi\|79422951\|ref\|NP_189436.2\| exonuclease-like protein [Arabidopsis thaliana] gi\|193211503\|gb\|ACF16171.1\| At3g27970 [Arabidopsis thaliana] gi\|225898687\|dbj\|BAH30474.1\| hypothetical protein [Arabidopsis thaliana] gi\|332643867\|gb\|AEE77388.1\| exonuclease-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 278/355 (78%), Positives = 314/355 (88%), Gaps = 3/355 (0%)

Query: 1   MDYRT--ESSETLRNKCAACFRQFNRLEHLVEHMRTSYHSVHEPVCGICKKHCRSFESLR 58
           MDYR+  ESSETLRNKCAAC+RQFN+LEHLVEHM+ SYHS HEP CG+CKKHCRSFESLR
Sbjct: 1   MDYRSSMESSETLRNKCAACYRQFNKLEHLVEHMKISYHSGHEPTCGVCKKHCRSFESLR 60

Query: 59  EHLIGPLPKQECKNVFNNRGCRFCLAILDGPNARRLHQERCQMVSSATTGLNARLANLGV 118
           EHLIGPLPKQECKN+F+ RGCRFC+ IL+ PN+RR+HQERCQ  SS  +GL  R+A LG+
Sbjct: 61  EHLIGPLPKQECKNIFSLRGCRFCMTILESPNSRRIHQERCQF-SSVNSGLTTRMAALGL 119

Query: 119 RDSLTIDNTHTRDPQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVT 178
           RD   ID T +R P+VVA++CKMVGGGSDGSLDLC RVCI DE +N+IFH YVKP + VT
Sbjct: 120 RDKAMIDYTSSRSPRVVALSCKMVGGGSDGSLDLCARVCITDESDNVIFHTYVKPSMAVT 179

Query: 179 SYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLD 238
           SYRYETTGIRPE+LRDA+PLKQVQRKIQ+FLCNGEPMWKIRPRG +ARILVGHGLDHDLD
Sbjct: 180 SYRYETTGIRPENLRDAMPLKQVQRKIQEFLCNGEPMWKIRPRGGKARILVGHGLDHDLD 239

Query: 239 RLQVEYPAIMTRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLY 298
           RLQ+EYP+ M RDTAKYPPLMKTSKLSNSLKYLTQAYLGYD+  GIQDPY+DCVATMRLY
Sbjct: 240 RLQLEYPSSMIRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDVHFGIQDPYEDCVATMRLY 299

Query: 299 MRMKSQAHKREDYPLASDPQNRNNYASWRQTELERMSPEEMLAISRSDYYCWCLD 353
            RM+ Q HK E YPLA+D QNR+N  +WRQ+E ERMSP+EML+ISRSDYYCWCLD
Sbjct: 300 TRMRYQKHKIEAYPLAADAQNRSNQVAWRQSEAERMSPDEMLSISRSDYYCWCLD 354

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|45935039\|gb\|AAS79554.1\| exonuclease family protein [Arabidopsis thaliana] gi\|46367478\|emb\|CAG25865.1\| hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|302398687\|gb\|ADL36638.1\| C2H2L domain class transcription factor [Malus x domestica]	Back alignment and taxonomy information

>gi\|297815068\|ref\|XP_002875417.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297321255\|gb\|EFH51676.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356573815\|ref\|XP_003555051.1\| PREDICTED: RNA exonuclease 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|9294313\|dbj\|BAB01484.1\| exonuclease-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|225452464\|ref\|XP_002274475.1\| PREDICTED: apoptosis-enhancing nuclease-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147810158\|emb\|CAN71456.1\| hypothetical protein VITISV_036419 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224141305\|ref\|XP_002324015.1\| predicted protein [Populus trichocarpa] gi\|222867017\|gb\|EEF04148.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|15242645\|ref\|NP_198847.1\| exonuclease-like protein [Arabidopsis thaliana] gi\|10178140\|dbj\|BAB11585.1\| exonuclease-like protein [Arabidopsis thaliana] gi\|332007149\|gb\|AED94532.1\| exonuclease-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		354
TAIR\|locus:2086839		357	AT3G27970 [Arabidopsis thalian	0.994	0.985	0.754	3.2e-152
TAIR\|locus:2170533		348	AT5G40310 [Arabidopsis thalian	0.971	0.988	0.724	1.6e-143
TAIR\|locus:2066406		344	AT2G48100 [Arabidopsis thalian	0.918	0.944	0.432	3.9e-76
ASPGD\|ASPL0000065793		299	AN10955 [Emericella nidulans (	0.491	0.581	0.322	5.7e-20
SGD\|S000005440		289	REX4 "Putative RNA exonuclease	0.502	0.615	0.302	7.2e-20
UNIPROTKB\|F1PBR5		411	REXO4 "Uncharacterized protein	0.488	0.420	0.326	9.1e-19
UNIPROTKB\|Q9GZR2		422	REXO4 "RNA exonuclease 4" [Hom	0.488	0.409	0.326	1e-18
TAIR\|locus:2086320		275	AT3G15080 [Arabidopsis thalian	0.443	0.570	0.329	1.2e-18
CGD\|CAL0003518		285	orf19.5220 [Candida albicans (	0.477	0.592	0.324	6.5e-18
UNIPROTKB\|H9KZR7		379	H9KZR7 "Uncharacterized protei	0.533	0.498	0.333	2.7e-17

TAIR\|locus:2086839 AT3G27970 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1485 (527.8 bits), Expect = 3.2e-152, P = 3.2e-152
 Identities = 268/355 (75%), Positives = 304/355 (85%)

Query:     1 MDYRT--ESSETLRNKCAACFRQFNRLEHLVEHMRTSYHSVHEPVCGICKKHCRSFESLR 58
             MDYR+  ESSETLRNKCAAC+RQFN+LEHLVEHM+ SYHS HEP CG+CKKHCRSFESLR
Sbjct:     1 MDYRSSMESSETLRNKCAACYRQFNKLEHLVEHMKISYHSGHEPTCGVCKKHCRSFESLR 60

Query:    59 EHLIGPLPKQECKNVFNNRGCRFCLAILDGPNARRLHQERCQMVSSATTGLNARLANLGV 118
             EHLIGPLPKQECKN+F+ RGCRFC+ IL+ PN+RR+HQERCQ  SS  +GL  R+A LG+
Sbjct:    61 EHLIGPLPKQECKNIFSLRGCRFCMTILESPNSRRIHQERCQF-SSVNSGLTTRMAALGL 119

Query:   119 RDSLTIDNTHTRDPQVVAIACKMVXXXXXXXXXXCGRVCIIDEYENIIFHAYVKPPIPVT 178
             RD   ID T +R P+VVA++CKMV          C RVCI DE +N+IFH YVKP + VT
Sbjct:   120 RDKAMIDYTSSRSPRVVALSCKMVGGGSDGSLDLCARVCITDESDNVIFHTYVKPSMAVT 179

Query:   179 SYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLD 238
             SYRYETTGIRPE+LRDA+PLKQVQRKIQ+FLCNGEPMWKIRPRG +ARILVGHGLDHDLD
Sbjct:   180 SYRYETTGIRPENLRDAMPLKQVQRKIQEFLCNGEPMWKIRPRGGKARILVGHGLDHDLD 239

Query:   239 RLQVEYPAIMTRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLY 298
             RLQ+EYP+ M RDTAKYPPLMKTSKLSNSLKYLTQAYLGYD+  GIQDPY+DCVATMRLY
Sbjct:   240 RLQLEYPSSMIRDTAKYPPLMKTSKLSNSLKYLTQAYLGYDVHFGIQDPYEDCVATMRLY 299

Query:   299 MRMKSQAHKREDYPLASDPQNRNNYASWRQTELERMSPEEMLAISRSDYYCWCLD 353
              RM+ Q HK E YPLA+D QNR+N  +WRQ+E ERMSP+EML+ISRSDYYCWCLD
Sbjct:   300 TRMRYQKHKIEAYPLAADAQNRSNQVAWRQSEAERMSPDEMLSISRSDYYCWCLD 354

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0004527 "exonuclease activity" evidence=IEA;ISS

GO:0005622 "intracellular" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA

TAIR\|locus:2170533 AT5G40310 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2066406 AT2G48100 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000065793 AN10955 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

SGD\|S000005440 REX4 "Putative RNA exonuclease possibly involved in ribosome biogenesis" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PBR5 REXO4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9GZR2 REXO4 "RNA exonuclease 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

TAIR\|locus:2086320 AT3G15080 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

CGD\|CAL0003518 orf19.5220 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

UNIPROTKB\|H9KZR7 H9KZR7 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		354
cd06144		152	cd06144, REX4_like, DEDDh 3'-5' exonuclease domain	6e-75
cd06149		157	cd06149, ISG20, DEDDh 3'-5' exonuclease domain of	2e-30
smart00479		169	smart00479, EXOIII, exonuclease domain in DNA-poly	3e-29
cd06145		150	cd06145, REX1_like, DEDDh 3'-5' exonuclease domain	1e-27
pfam00929		161	pfam00929, RNase_T, Exonuclease	1e-15
cd06137		161	cd06137, DEDDh_RNase, DEDDh 3'-5' exonuclease doma	1e-13
cd06127		159	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain fam	4e-11
COG0847		243	COG0847, DnaQ, DNA polymerase III, epsilon subunit	1e-10
cd06133		176	cd06133, ERI-1_3'hExo_like, DEDDh 3'-5' exonucleas	2e-07
COG2176		1444	COG2176, PolC, DNA polymerase III, alpha subunit (	5e-07
TIGR01405		1213	TIGR01405, polC_Gram_pos, DNA polymerase III, alph	2e-06
PRK00448		1437	PRK00448, polC, DNA polymerase III PolC; Validated	4e-06
cd06143		174	cd06143, PAN2_exo, DEDDh 3'-5' exonuclease domain	5e-06
TIGR00573		217	TIGR00573, dnaq, exonuclease, DNA polymerase III,	0.003

>gnl\|CDD\|99847 cd06144, REX4_like, DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

 Score =  227 bits (582), Expect = 6e-75
 Identities = 75/165 (45%), Positives = 99/165 (60%), Gaps = 15/165 (9%)

Query: 135 VAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHLRD 194
           VA+ C+MVG G DGS     RV I++E  N+++  YVKP  PVT YR   +GIRPEHL+D
Sbjct: 1   VALDCEMVGVGPDGSESALARVSIVNEDGNVVYDTYVKPQEPVTDYRTAVSGIRPEHLKD 60

Query: 195 AIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDTAK 254
           A   ++VQ+K+ + L                RILVGH L +DL  L++++P  + RDT+K
Sbjct: 61  APDFEEVQKKVAELLKG--------------RILVGHALKNDLKVLKLDHPKKLIRDTSK 106

Query: 255 YPPLMKTSK-LSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLY 298
           Y PL KT+K  S SLK L +  LG DIQ G     +D  A MRLY
Sbjct: 107 YKPLRKTAKGKSPSLKKLAKQLLGLDIQEGEHSSVEDARAAMRLY 151

This subfamily is composed of RNA exonuclease 4 (REX4 or Rex4p), XPMC2, Interferon (IFN) Stimulated Gene product of 20 kDa (ISG20), and similar proteins. REX4 is involved in pre-rRNA processing. It controls the ratio between the two forms of 5.8S rRNA in yeast. XPMC2 is a Xenopus gene which was identified through its ability to correct a mitotic defect in fission yeast. The human homolog of XPMC2 (hPMC2) may be involved in angiotensin II-induced adrenal cell cycle progression and cell proliferation. ISG20 is an IFN-induced antiviral exonuclease with a strong preference for single-stranded RNA and minor activity towards single-stranded DNA. These proteins are DEDDh-type DnaQ-like 3'-5' exonucleases containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. REX proteins function in the processing and maturation of many RNA species, similar to the function of Escherchia coli RNase T. Length = 152

>gnl\|CDD\|99852 cd06149, ISG20, DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>gnl\|CDD\|214685 smart00479, EXOIII, exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases	Back alignment and domain information

>gnl\|CDD\|99848 cd06145, REX1_like, DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins	Back alignment and domain information

>gnl\|CDD\|216200 pfam00929, RNase_T, Exonuclease	Back alignment and domain information

>gnl\|CDD\|99840 cd06137, DEDDh_RNase, DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins	Back alignment and domain information

>gnl\|CDD\|176648 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family	Back alignment and domain information

>gnl\|CDD\|223916 COG0847, DnaQ, DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|99836 cd06133, ERI-1_3'hExo_like, DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins	Back alignment and domain information

>gnl\|CDD\|225087 COG2176, PolC, DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233397 TIGR01405, polC_Gram_pos, DNA polymerase III, alpha chain, Gram-positive type	Back alignment and domain information

>gnl\|CDD\|234767 PRK00448, polC, DNA polymerase III PolC; Validated	Back alignment and domain information

>gnl\|CDD\|99846 cd06143, PAN2_exo, DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2	Back alignment and domain information

>gnl\|CDD\|129663 TIGR00573, dnaq, exonuclease, DNA polymerase III, epsilon subunit family	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		354
KOG2249		280	consensus 3'-5' exonuclease [Replication, recombin	100.0
cd06149		157	ISG20 DEDDh 3'-5' exonuclease domain of Interferon	100.0
cd06143		174	PAN2_exo DEDDh 3'-5' exonuclease domain of the euk	100.0
cd06145		150	REX1_like DEDDh 3'-5' exonuclease domain of RNA ex	100.0
cd06144		152	REX4_like DEDDh 3'-5' exonuclease domain of RNA ex	100.0
cd06137		161	DEDDh_RNase DEDDh 3'-5' exonuclease domain of the	100.0
PRK07247		195	DNA polymerase III subunit epsilon; Validated	99.95
KOG2248		380	consensus 3'-5' exonuclease [Replication, recombin	99.95
PRK07740		244	hypothetical protein; Provisional	99.95
PRK09146		239	DNA polymerase III subunit epsilon; Validated	99.94
PRK06309		232	DNA polymerase III subunit epsilon; Validated	99.94
PRK07942		232	DNA polymerase III subunit epsilon; Provisional	99.94
PRK05711		240	DNA polymerase III subunit epsilon; Provisional	99.94
PRK06807		313	DNA polymerase III subunit epsilon; Validated	99.94
PRK06063		313	DNA polymerase III subunit epsilon; Provisional	99.94
TIGR01406		225	dnaQ_proteo DNA polymerase III, epsilon subunit, P	99.94
cd06130		156	DNA_pol_III_epsilon_like an uncharacterized bacter	99.93
PRK09145		202	DNA polymerase III subunit epsilon; Validated	99.93
PRK06310		250	DNA polymerase III subunit epsilon; Validated	99.93
PRK06195		309	DNA polymerase III subunit epsilon; Validated	99.93
TIGR00573		217	dnaq exonuclease, DNA polymerase III, epsilon subu	99.93
PRK07983		219	exodeoxyribonuclease X; Provisional	99.93
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.93
PRK08517		257	DNA polymerase III subunit epsilon; Provisional	99.93
PRK07748		207	sporulation inhibitor KapD; Provisional	99.92
cd06131		167	DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl	99.92
smart00479		169	EXOIII exonuclease domain in DNA-polymerase alpha	99.92
COG2176		1444	PolC DNA polymerase III, alpha subunit (gram-posit	99.92
PRK07883		557	hypothetical protein; Validated	99.92
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.92
PRK06722		281	exonuclease; Provisional	99.92
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.91
cd06136		177	TREX1_2 DEDDh 3'-5' exonuclease domain of three pr	99.91
PRK05168		211	ribonuclease T; Provisional	99.91
cd06134		189	RNaseT DEDDh 3'-5' exonuclease domain of RNase T.	99.91
TIGR01298		200	RNaseT ribonuclease T. in gamma-subdivision Proteo	99.91
PRK05601		377	DNA polymerase III subunit epsilon; Validated	99.9
TIGR01405		1213	polC_Gram_pos DNA polymerase III, alpha chain, Gra	99.89
cd06133		176	ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain o	99.88
PRK09182		294	DNA polymerase III subunit epsilon; Validated	99.87
cd06127		159	DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh	99.87
PTZ00315		582	2'-phosphotransferase; Provisional	99.86
COG0847		243	DnaQ DNA polymerase III, epsilon subunit and relat	99.86
cd06138		183	ExoI_N N-terminal DEDDh 3'-5' exonuclease domain o	99.86
PF00929		164	RNase_T: Exonuclease; InterPro: IPR013520 This ent	99.85
PRK00448		1437	polC DNA polymerase III PolC; Validated	99.83
cd06135		173	Orn DEDDh 3'-5' exonuclease domain of oligoribonuc	99.8
PRK11779		476	sbcB exonuclease I; Provisional	99.8
PRK05359		181	oligoribonuclease; Provisional	99.78
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	99.72
KOG2462		279	consensus C2H2-type Zn-finger protein [Transcripti	99.51
KOG2462		279	consensus C2H2-type Zn-finger protein [Transcripti	99.44
KOG3623		1007	consensus Homeobox transcription factor SIP1 [Tran	99.23
COG5018		210	KapD Inhibitor of the KinA pathway to sporulation,	99.16
KOG0542		280	consensus Predicted exonuclease [Replication, reco	99.13
KOG3576		267	consensus Ovo and related transcription factors [T	99.11
cd05160		199	DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain	98.99
cd06139		193	DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease	98.71
COG2925		475	SbcB Exonuclease I [DNA replication, recombination	98.71
KOG3623		1007	consensus Homeobox transcription factor SIP1 [Tran	98.67
KOG3576		267	consensus Ovo and related transcription factors [T	98.66
KOG1074		958	consensus Transcriptional repressor SALM [Transcri	98.66
KOG1074		958	consensus Transcriptional repressor SALM [Transcri	98.64
PHA02768		55	hypothetical protein; Provisional	98.63
PHA00733		128	hypothetical protein	98.61
PF01612		176	DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR00	98.59
KOG3242		208	consensus Oligoribonuclease (3'->5' exoribonucleas	98.59
COG1949		184	Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA	98.35
cd06146		193	mut-7_like_exo DEDDy 3'-5' exonuclease domain of C	98.24
PRK05755		880	DNA polymerase I; Provisional	98.19
KOG3608		467	consensus Zn finger proteins [General function pre	98.17
cd05780		195	DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease dom	98.13
cd06125		96	DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonucleas	98.11
KOG3608		467	consensus Zn finger proteins [General function pre	98.06
PHA00733		128	hypothetical protein	98.04
cd06141		170	WRN_exo DEDDy 3'-5' exonuclease domain of WRN and	97.96
cd06129		161	RNaseD_like DEDDy 3'-5' exonuclease domain of RNas	97.85
PLN03086		567	PRLI-interacting factor K; Provisional	97.85
PHA02768		55	hypothetical protein; Provisional	97.79
KOG3993		500	consensus Transcription factor (contains Zn finger	97.77
PF13465		26	zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A	97.75
PHA00616		44	hypothetical protein	97.75
PLN03086		567	PRLI-interacting factor K; Provisional	97.75
PHA00732		79	hypothetical protein	97.73
cd00007		155	35EXOc 3'-5' exonuclease. The 35EXOc domain is res	97.64
cd05781		188	DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of	97.6
cd05779		204	DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domai	97.6
KOG3993		500	consensus Transcription factor (contains Zn finger	97.56
cd05777		230	DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain	97.48
cd05785		207	DNA_polB_like2_exo Uncharacterized bacterial subgr	97.38
cd05784		193	DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of	97.35
COG0349		361	Rnd Ribonuclease D [Translation, ribosomal structu	97.35
TIGR01388		367	rnd ribonuclease D. This model describes ribonucle	97.32
PRK10829		373	ribonuclease D; Provisional	97.26
PHA00732		79	hypothetical protein	97.09
PF00096		23	zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070	97.07
cd05783		204	DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of	96.99
cd06148		197	Egl_like_exo DEDDy 3'-5' exonuclease domain of Dro	96.94
smart00474		172	35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proo	96.76
PF13912		27	zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9	96.62
PF13482		164	RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A	96.58
PF13465		26	zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A	96.56
PHA02528		881	43 DNA polymerase; Provisional	96.45
PF00096		23	zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070	96.36
PTZ00166		1054	DNA polymerase delta catalytic subunit; Provisiona	96.25
PF13894		24	zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP	96.12
PF05605		54	zf-Di19: Drought induced 19 protein (Di19), zinc-b	96.11
COG5189		423	SFP1 Putative transcriptional repressor regulating	96.11
cd06142		178	RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribon	96.1
PRK05762		786	DNA polymerase II; Reviewed	95.77
PF09237		54	GAGA: GAGA factor; InterPro: IPR015318 Zinc finger	95.72
PHA00616		44	hypothetical protein	95.7
COG0749		593	PolA DNA polymerase I - 3'-5' exonuclease and poly	95.63
PF13894		24	zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP	95.63
cd06140		178	DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5'	95.63
PF04857		262	CAF1: CAF1 family ribonuclease; InterPro: IPR00694	95.49
PF12756		100	zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB:	95.46
smart00355		26	ZnF_C2H2 zinc finger.	95.39
cd05776		234	DNA_polB_alpha_exo inactive DEDDy 3'-5' exonucleas	95.36
PF10108		209	DNA_pol_B_exo2: Predicted 3'-5' exonuclease relate	95.22
cd05778		231	DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease	95.11
TIGR00593		887	pola DNA polymerase I. This family is based on the	94.65
PF13912		27	zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9	94.32
cd05782		208	DNA_polB_like1_exo Uncharacterized bacterial subgr	94.08
PF05605		54	zf-Di19: Drought induced 19 protein (Di19), zinc-b	93.56
PF12874		25	zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG	93.41
cd09018		150	DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease	93.32
PF13913		25	zf-C2HC_2: zinc-finger of a C2HC-type	93.28
smart00355		26	ZnF_C2H2 zinc finger.	93.11
PF03104		325	DNA_pol_B_exo1: DNA polymerase family B, exonuclea	92.7
PF12171		27	zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi	92.35
KOG4793		318	consensus Three prime repair exonuclease [Replicat	92.29
cd06147		192	Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of y	92.13
PHA02570		220	dexA exonuclease; Provisional	92.07
PF09237		54	GAGA: GAGA factor; InterPro: IPR015318 Zinc finger	91.77
KOG1798		2173	consensus DNA polymerase epsilon, catalytic subuni	90.71
PF13909		24	zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W	89.82
COG0417		792	PolB DNA polymerase elongation subunit (family B)	89.5
PF13913		25	zf-C2HC_2: zinc-finger of a C2HC-type	89.49
KOG0304		239	consensus mRNA deadenylase subunit [RNA processing	88.67
PF12874		25	zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG	88.51
smart00486		471	POLBc DNA polymerase type-B family. DNA polymerase	88.01
COG5048		467	FOG: Zn-finger [General function prediction only]	87.1
PF12171		27	zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi	87.04
smart00451		35	ZnF_U1 U1-like zinc finger. Family of C2H2-type zi	85.18
COG3359		278	Predicted exonuclease [DNA replication, recombinat	84.37
KOG2231		669	consensus Predicted E3 ubiquitin ligase [Posttrans	83.2
TIGR00592		1172	pol2 DNA polymerase (pol2). This family is based o	81.14
KOG0969		1066	consensus DNA polymerase delta, catalytic subunit	80.09

>KOG2249 consensus 3'-5' exonuclease [Replication, recombination and repair]	Back alignment and domain information

Probab=100.00  E-value=7.2e-46  Score=324.43  Aligned_cols=272  Identities=49%  Similarity=0.791  Sum_probs=218.9

Q ss_pred             cccccccccCChHHHHHhhhhccccCccccccccccccCCccccccccCCCCCcccccccccccccccccccCCCChhHH
Q 018558           14 KCAACFRQFNRLEHLVEHMRTSYHSVHEPVCGICKKHCRSFESLREHLIGPLPKQECKNVFNNRGCRFCLAILDGPNARR   93 (354)
Q Consensus        14 ~C~~Cgk~f~~~~~L~~H~~~~~H~~~k~~C~~C~k~f~~~~~L~~H~~~e~p~~~C~k~F~~~~C~~C~k~f~~~~~l~   93 (354)
                      +|..|-+.|.....+..|+ +.+|....+.|..|.+.-.....+..++.+..+- .|...|....|..|.-.-.......
T Consensus         2 ~~~~~~~~~~~~~~~~~~~-v~~~~~~~~~~~~~k~~~~~~~~~~e~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~   79 (280)
T KOG2249|consen    2 KASSCAQQFNKKEHLPNHK-VSRHKLHERKCGKCKKVARSFESNEEGLIAPLPK-EGKNIFSQRGNRFKATIKASPGKRR   79 (280)
T ss_pred             CccHHHHHhCccccCcccc-chhhccCcchhhhHHHhccCcccccccccCCCCc-ccCccccchhhHHHhhHhhcCCcch
Confidence            3556777777777777777 3224432227888877766666666666332222 6778888888888766555566666


Q ss_pred             HHHhhccccCCCCccchhhhhccCCCCCcccCCCCC-CCCceEEeeccccccCCCCCccceeeEEEEecCCceEEeeeec
Q 018558           94 LHQERCQMVSSATTGLNARLANLGVRDSLTIDNTHT-RDPQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVK  172 (354)
Q Consensus        94 ~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~vaiD~Ettg~~~~~~~~~i~~i~vv~~~g~~i~~~~v~  172 (354)
                      .|+..|+...+...        .      ..+.... ...++||+||||+|+|+++..+.+++++|||..|.++||+||+
T Consensus        80 ~~~~~~~~~~~~~~--------~------~~k~s~~~~~~r~vAmDCEMVG~Gp~G~~s~lARvSIVN~~G~VvyDkyVk  145 (280)
T KOG2249|consen   80 IHQGSCQASCRMAA--------L------GSKDSRMGSLTRVVAMDCEMVGVGPDGRESLLARVSIVNYHGHVVYDKYVK  145 (280)
T ss_pred             hhhcccCCCccccc--------c------chhhccccccceEEEEeeeEeccCCCccceeeeEEEEeeccCcEeeeeecC
Confidence            66655554422111        0      1111112 2226999999999999999999999999999999999999999


Q ss_pred             CCccccCceeeecCCChhhhcCCCCHHHHHHHHHHHHhcCCCCccccCCCCCCcEEEEechhhhhhhhcccCCCceeeec
Q 018558          173 PPIPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDT  252 (354)
Q Consensus       173 P~~~i~~~~~~itGIt~~~l~~ap~~~~v~~~~~~~i~~~~~~~~~~~~~~~~~ilVgHn~~~Dl~~L~~~~~~~~~~Dt  252 (354)
                      |..+|++|+|+++||+|+++.+|.+|+.|+.++++||              .|+|||||.+.+||.+|++.||..+++||
T Consensus       146 P~~~VtDyRT~vSGIrpehm~~A~pf~~aQ~ev~klL--------------~gRIlVGHaLhnDl~~L~l~hp~s~iRDT  211 (280)
T KOG2249|consen  146 PTEPVTDYRTRVSGIRPEHMRDAMPFKVAQKEVLKLL--------------KGRILVGHALHNDLQALKLEHPRSMIRDT  211 (280)
T ss_pred             CCcccccceeeecccCHHHhccCccHHHHHHHHHHHH--------------hCCEEeccccccHHHHHhhhCchhhhccc
Confidence            9999999999999999999999999999999999999              89999999999999999999999999999


Q ss_pred             cccCCCcc--CCCCCchHHHHHHHHhCCcCCCCCCChHHHHHHHHHHHHHHHHhhhhccCCCCCC
Q 018558          253 AKYPPLMK--TSKLSNSLKYLTQAYLGYDIQIGIQDPYDDCVATMRLYMRMKSQAHKREDYPLAS  315 (354)
Q Consensus       253 ~~~~~~~~--~~~~~~~L~~l~~~~l~~~i~~~~H~Al~DA~at~~l~~~~~~~~~~~~~~~~~~  315 (354)
                      +.+.+++.  .....++|+.|++.+||++||.|.|++++||+|||+||.+++.+|++....++..
T Consensus       212 s~~~pl~k~~~~~~tpSLK~Lt~~~Lg~~IQ~GeHsSvEDA~AtM~LY~~vk~qwe~~~~r~l~~  276 (280)
T KOG2249|consen  212 SKYPPLMKLLSKKATPSLKKLTEALLGKDIQVGEHSSVEDARATMELYKRVKVQWEKIEARPLAT  276 (280)
T ss_pred             ccCchHHHHhhccCCccHHHHHHHHhchhhhccccCcHHHHHHHHHHHHHHHHHHHHHhhccccc
Confidence            99999887  4667899999999999999999999999999999999999999998866655433

>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2	Back alignment and domain information

>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins	Back alignment and domain information

>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins	Back alignment and domain information

>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins	Back alignment and domain information

>PRK07247 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG2248 consensus 3'-5' exonuclease [Replication, recombination and repair]	Back alignment and domain information

>PRK07740 hypothetical protein; Provisional	Back alignment and domain information

>PRK09146 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06309 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK07942 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>PRK05711 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>PRK06807 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06063 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial	Back alignment and domain information

>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III	Back alignment and domain information

>PRK09145 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06310 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06195 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family	Back alignment and domain information

>PRK07983 exodeoxyribonuclease X; Provisional	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK08517 DNA polymerase III subunit epsilon; Provisional	Back alignment and domain information

>PRK07748 sporulation inhibitor KapD; Provisional	Back alignment and domain information

>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins	Back alignment and domain information

>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases	Back alignment and domain information

>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07883 hypothetical protein; Validated	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK06722 exonuclease; Provisional	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins	Back alignment and domain information

>PRK05168 ribonuclease T; Provisional	Back alignment and domain information

>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T	Back alignment and domain information

>TIGR01298 RNaseT ribonuclease T	Back alignment and domain information

>PRK05601 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type	Back alignment and domain information

>cd06133 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins	Back alignment and domain information

>PRK09182 DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family	Back alignment and domain information

>PTZ00315 2'-phosphotransferase; Provisional	Back alignment and domain information

>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]	Back alignment and domain information

>cd06138 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins	Back alignment and domain information

>PF00929 RNase_T: Exonuclease; InterPro: IPR013520 This entry includes a variety of exonuclease proteins, such as ribonuclease T [] and the epsilon subunit of DNA polymerase III	Back alignment and domain information

>PRK00448 polC DNA polymerase III PolC; Validated	Back alignment and domain information

>cd06135 Orn DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins	Back alignment and domain information

>PRK11779 sbcB exonuclease I; Provisional	Back alignment and domain information

>PRK05359 oligoribonuclease; Provisional	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]	Back alignment and domain information

>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]	Back alignment and domain information

>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]	Back alignment and domain information

>COG5018 KapD Inhibitor of the KinA pathway to sporulation, predicted exonuclease [General function prediction only]	Back alignment and domain information

>KOG0542 consensus Predicted exonuclease [Replication, recombination and repair]	Back alignment and domain information

>KOG3576 consensus Ovo and related transcription factors [Transcription]	Back alignment and domain information

>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases	Back alignment and domain information

>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases	Back alignment and domain information

>COG2925 SbcB Exonuclease I [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]	Back alignment and domain information

>KOG3576 consensus Ovo and related transcription factors [Transcription]	Back alignment and domain information

>KOG1074 consensus Transcriptional repressor SALM [Transcription]	Back alignment and domain information

>KOG1074 consensus Transcriptional repressor SALM [Transcription]	Back alignment and domain information

>PHA02768 hypothetical protein; Provisional	Back alignment and domain information

>PHA00733 hypothetical protein	Back alignment and domain information

>PF01612 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides	Back alignment and domain information

>KOG3242 consensus Oligoribonuclease (3'->5' exoribonuclease) [RNA processing and modification]	Back alignment and domain information

>COG1949 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA processing and modification]	Back alignment and domain information

>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins	Back alignment and domain information

>PRK05755 DNA polymerase I; Provisional	Back alignment and domain information

>KOG3608 consensus Zn finger proteins [General function prediction only]	Back alignment and domain information

>cd05780 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease domain of Pyrococcus kodakaraensis Kod1 and similar archaeal family-B DNA polymerases	Back alignment and domain information

>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily	Back alignment and domain information

>KOG3608 consensus Zn finger proteins [General function prediction only]	Back alignment and domain information

>PHA00733 hypothetical protein	Back alignment and domain information

>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins	Back alignment and domain information

>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins	Back alignment and domain information

>PLN03086 PRLI-interacting factor K; Provisional	Back alignment and domain information

>PHA02768 hypothetical protein; Provisional	Back alignment and domain information

>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]	Back alignment and domain information

>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A	Back alignment and domain information

>PHA00616 hypothetical protein	Back alignment and domain information

>PLN03086 PRLI-interacting factor K; Provisional	Back alignment and domain information

>PHA00732 hypothetical protein	Back alignment and domain information

>cd00007 35EXOc 3'-5' exonuclease	Back alignment and domain information

>cd05781 DNA_polB_B3_exo DEDDy 3'-5' exonuclease domain of Sulfurisphaera ohwakuensis DNA polymerase B3 and similar archaeal family-B DNA polymerases	Back alignment and domain information

>cd05779 DNA_polB_epsilon_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase epsilon, a family-B DNA polymerase	Back alignment and domain information

>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]	Back alignment and domain information

>cd05777 DNA_polB_delta_exo DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase delta, a family-B DNA polymerase	Back alignment and domain information

>cd05785 DNA_polB_like2_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases	Back alignment and domain information

>cd05784 DNA_polB_II_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase II and similar bacterial family-B DNA polymerases	Back alignment and domain information

>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01388 rnd ribonuclease D	Back alignment and domain information

>PRK10829 ribonuclease D; Provisional	Back alignment and domain information

>PHA00732 hypothetical protein	Back alignment and domain information

>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>cd05783 DNA_polB_B1_exo DEDDy 3'-5' exonuclease domain of Sulfolobus solfataricus DNA polymerase B1 and similar archaeal family-B DNA polymerases	Back alignment and domain information

>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins	Back alignment and domain information

>smart00474 35EXOc 3'-5' exonuclease	Back alignment and domain information

>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B	Back alignment and domain information

>PF13482 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 2AJQ_F 1T8E_A 1T7P_A 1SKR_A 1X9W_A 1TK8_A 1TK0_A 1SL2_A	Back alignment and domain information

>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A	Back alignment and domain information

>PHA02528 43 DNA polymerase; Provisional	Back alignment and domain information

>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PTZ00166 DNA polymerase delta catalytic subunit; Provisional	Back alignment and domain information

>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A	Back alignment and domain information

>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins	Back alignment and domain information

>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]	Back alignment and domain information

>cd06142 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins	Back alignment and domain information

>PRK05762 DNA polymerase II; Reviewed	Back alignment and domain information

>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PHA00616 hypothetical protein	Back alignment and domain information

>COG0749 PolA DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A	Back alignment and domain information

>cd06140 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases	Back alignment and domain information

>PF04857 CAF1: CAF1 family ribonuclease; InterPro: IPR006941 CAF1 is an RNase of the DEDD superfamily, and a subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA deadenylation	Back alignment and domain information

>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A	Back alignment and domain information

>smart00355 ZnF_C2H2 zinc finger	Back alignment and domain information

>cd05776 DNA_polB_alpha_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha, a family-B DNA polymerase	Back alignment and domain information

>PF10108 DNA_pol_B_exo2: Predicted 3'-5' exonuclease related to the exonuclease domain of PolB; InterPro: IPR019288 This entry represents various prokaryotic 3'-5' exonucleases and hypothetical proteins	Back alignment and domain information

>cd05778 DNA_polB_zeta_exo inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase zeta, a family-B DNA polymerase	Back alignment and domain information

>TIGR00593 pola DNA polymerase I	Back alignment and domain information

>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B	Back alignment and domain information

>cd05782 DNA_polB_like1_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases	Back alignment and domain information

>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins	Back alignment and domain information

>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A	Back alignment and domain information

>cd09018 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins	Back alignment and domain information

>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type	Back alignment and domain information

>smart00355 ZnF_C2H2 zinc finger	Back alignment and domain information

>PF03104 DNA_pol_B_exo1: DNA polymerase family B, exonuclease domain Several related DNA polymerases were too dissimilar to be included	Back alignment and domain information

>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length	Back alignment and domain information

>KOG4793 consensus Three prime repair exonuclease [Replication, recombination and repair]	Back alignment and domain information

>cd06147 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins	Back alignment and domain information

>PHA02570 dexA exonuclease; Provisional	Back alignment and domain information

>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG1798 consensus DNA polymerase epsilon, catalytic subunit A [Replication, recombination and repair]	Back alignment and domain information

>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A	Back alignment and domain information

>COG0417 PolB DNA polymerase elongation subunit (family B) [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type	Back alignment and domain information

>KOG0304 consensus mRNA deadenylase subunit [RNA processing and modification]	Back alignment and domain information

>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A	Back alignment and domain information

>smart00486 POLBc DNA polymerase type-B family	Back alignment and domain information

>COG5048 FOG: Zn-finger [General function prediction only]	Back alignment and domain information

>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length	Back alignment and domain information

>smart00451 ZnF_U1 U1-like zinc finger	Back alignment and domain information

>COG3359 Predicted exonuclease [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00592 pol2 DNA polymerase (pol2)	Back alignment and domain information

>KOG0969 consensus DNA polymerase delta, catalytic subunit [Replication, recombination and repair]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		354
1wlj_A		189	Human Isg20 Length = 189		3e-09

>pdb|1WLJ|A Chain A, Human Isg20 Length = 189

Back alignment and structure

Iteration: 1

Score = 59.3 bits (142), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 42/172 (24%), Positives = 77/172 (44%), Gaps = 21/172 (12%) Query: 133 QVVAIACKMVXXXXXXXXXXCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHL 192 +VVA+ C+MV R +++ + +++ +++P +T YR +G+ P+H+ Sbjct: 6 EVVAMDCEMVGLGPHRESG-LARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHM 64 Query: 193 RDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDT 252 A P + +I L + +++VGH L HD L+ + DT Sbjct: 65 VGATPFAVARLEILQLL--------------KGKLVVGHDLKHDFQALKEDMSGYTIYDT 110 Query: 253 AKYPPLMKTSKLSN----SLKYLTQAYLGYDIQIGI--QDPYDDCVATMRLY 298 + L + +KL + SL+ L++ L IQ + +D ATM LY Sbjct: 111 STDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELY 162

PyMOL of 1wlj

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		354
1wlj_A		189	Interferon stimulated gene 20KDA; exoribonuclease,	2e-56
1zbh_A		299	3'-5' exonuclease ERI1; histone mRNA 3'-END-specif	6e-08
1w0h_A		204	3'-5' exonuclease ERI1; nuclease domain, hydrolase	6e-08
1zbu_A		349	ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase;	1e-07
2xri_A		224	ERI1 exoribonuclease 3; hydrolase, metal binding;	1e-06
2p1j_A		186	POLIII, DNA polymerase III POLC-type; structural g	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-06
3v9w_A		235	Ribonuclease T; DEDD nucleases family, EXO-nucleas	3e-06
2drp_A		66	Protein (tramtrack DNA-binding domain); protein-DN	4e-06
3cg7_A		308	CRN-4, cell death-related nuclease 4; hydrolase, a	6e-06
1y97_A		238	Three prime repair exonuclease 2; TREX2, hydrolase	8e-05
1a1h_A		90	QGSR zinc finger peptide; complex (zinc finger/DNA	8e-04

>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Length = 189	Back alignment and structure

 Score =  181 bits (461), Expect = 2e-56
 Identities = 50/202 (24%), Positives = 92/202 (45%), Gaps = 22/202 (10%)

Query: 129 TRDPQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIR 188
               +VVA+ C+MVG G      L  R  +++ +  +++  +++P   +T YR   +G+ 
Sbjct: 2   AGSREVVAMDCEMVGLGPHRESGLA-RCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVT 60

Query: 189 PEHLRDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIM 248
           P+H+  A P    + +I   L              + +++VGH L HD   L+ +     
Sbjct: 61  PQHMVGATPFAVARLEILQLL--------------KGKLVVGHDLKHDFQALKEDMSGYT 106

Query: 249 TRDTAKYPPLMKTSKLSN----SLKYLTQAYLGYDIQIGIQ--DPYDDCVATMRLYMRMK 302
             DT+    L + +KL +    SL+ L++  L   IQ  +      +D  ATM LY   +
Sbjct: 107 IYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQ 166

Query: 303 SQAHKREDYPLA-SDPQNRNNY 323
               +R    LA SD ++ +++
Sbjct: 167 RIRARRGLPRLAVSDLEHHHHH 188

PyMOL of 1wlj

>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Length = 299	Back alignment and structure

>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Length = 204	Back alignment and structure

>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Length = 349	Back alignment and structure

>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Length = 224	Back alignment and structure

>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Length = 186	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A Length = 235	Back alignment and structure

>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66	Back alignment and structure

>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A Length = 308	Back alignment and structure

>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Length = 238	Back alignment and structure

>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		354
1wlj_A		189	Interferon stimulated gene 20KDA; exoribonuclease,	100.0
2p1j_A		186	POLIII, DNA polymerase III POLC-type; structural g	99.95
2gui_A		194	DNA polymerase III epsilon subunit; DNA polymerase	99.95
1w0h_A		204	3'-5' exonuclease ERI1; nuclease domain, hydrolase	99.94
3cg7_A		308	CRN-4, cell death-related nuclease 4; hydrolase, a	99.94
2xri_A		224	ERI1 exoribonuclease 3; hydrolase, metal binding;	99.94
3mxm_B		242	Three prime repair exonuclease 1; RNAse H-like fol	99.93
3u3y_B		314	Three prime repair exonuclease 1; RNAse H fold, 3'	99.92
1zbh_A		299	3'-5' exonuclease ERI1; histone mRNA 3'-END-specif	99.92
1y97_A		238	Three prime repair exonuclease 2; TREX2, hydrolase	99.92
2igi_A		180	Oligoribonuclease; RNAse, exoribonuclease, exonucl	99.91
2f96_A		224	Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas	99.91
1zbu_A		349	ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase;	99.9
2gbz_A		194	Oligoribonuclease; ORN, deddh, structural genomics	99.9
3v9w_A		235	Ribonuclease T; DEDD nucleases family, EXO-nucleas	99.9
2qxf_A		482	Exodeoxyribonuclease I; alpha-beta domain, DNAQ su	99.86
3tr8_A		186	Oligoribonuclease; transcription, hydrolase; 2.50A	99.86
2lt7_A		133	Transcriptional regulator kaiso; zinc finger, doub	99.62
2dmd_A		96	Zinc finger protein 64, isoforms 1 and 2; ZNF338,	99.57
2ee8_A		106	Protein ODD-skipped-related 2; zinc binding, ZF-C2	99.54
2dlq_A		124	GLI-kruppel family member HKR3; ZF-C2H2 domain, st	99.53
2yt9_A		95	Zinc finger-containing protein 1; C2H2, structural	99.52
2csh_A		110	Zinc finger protein 297B; ZF-C2H2 domain, zinc fin	99.5
2kmk_A		82	Zinc finger protein GFI-1; tandem repeat zinc fing	99.49
1a1h_A		90	QGSR zinc finger peptide; complex (zinc finger/DNA	99.49
2jp9_A		119	Wilms tumor 1; DNA binding, nucleic acid recogniti	99.48
2dmi_A		115	Teashirt homolog 3; zinc finger protein 537, struc	99.45
2i13_A		190	AART; DNA binding, zinc finger, DNA binding protei	99.43
1wjp_A		107	Zinc finger protein 295; ZF-C2H2 domain, zinc bind	99.41
1ubd_C		124	Protein (YY1 zinc finger domain); transcription in	99.41
4gzn_C		60	ZFP-57, zinc finger protein 57; transcription-DNA	99.4
2ebt_A		100	Krueppel-like factor 5; C2H2-type zinc-finger, met	99.38
2wbs_A		89	Krueppel-like factor 4; transcription-DNA complex,	99.38
2i13_A		190	AART; DNA binding, zinc finger, DNA binding protei	99.38
1llm_C		88	Chimera of ZIF23-GCN4; dimerization, DNA recogniti	99.36
1tf6_A		190	Protein (transcription factor IIIA); complex (tran	99.31
2dlk_A		79	Novel protein; ZF-C2H2 domain, zinc finger protein	99.29
1tf6_A		190	Protein (transcription factor IIIA); complex (tran	99.26
2gli_A		155	Protein (five-finger GLI); protein/DNA complex, tr	99.26
2j7j_A		85	Transcription factor IIIA; zinc finger module, alt	99.25
2lt7_A		133	Transcriptional regulator kaiso; zinc finger, doub	99.21
2ghf_A		102	ZHX1, zinc fingers and homeoboxes protein 1; C2H2	99.2
2rpc_A		155	Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr	99.19
2lce_A		74	B-cell lymphoma 6 protein; structural genomics, no	99.19
4gzn_C		60	ZFP-57, zinc finger protein 57; transcription-DNA	99.18
2gli_A		155	Protein (five-finger GLI); protein/DNA complex, tr	99.16
2cot_A		77	Zinc finger protein 435; ADK_LID domain, zinc fing	99.15
1x5w_A		70	Zinc finger protein 64, isoforms 1; ZNF338, nuclea	99.11
1x6h_A		86	Transcriptional repressor CTCF; zinc finger protei	99.08
2lv2_A		85	Insulinoma-associated protein 1; structural genomi	99.07
2rpc_A		155	Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr	99.03
3uk3_C		57	Zinc finger protein 217; transcription factor, DNA	99.01
2ct1_A		77	Transcriptional repressor CTCF; CCCTC-BINDING fact	99.0
2gqj_A		98	Zinc finger protein KIAA1196; ZF-C2H2 like domain,	98.97
1x6e_A		72	Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca	98.96
2wbt_A		129	B-129; zinc finger; 2.70A {Sulfolobus virus 1}	98.96
2d9h_A		78	Zinc finger protein 692; ZF-C2H2 domain, structura	98.93
1bbo_A		57	Human enhancer-binding protein MBP-1; DNA-binding	98.92
2adr_A		60	ADR1; transcription regulation, zinc finger,; NMR	98.91
2gqj_A		98	Zinc finger protein KIAA1196; ZF-C2H2 like domain,	98.91
2ctd_A		96	Zinc finger protein 512; zinc binding, two ZF-C2H2	98.9
2ctd_A		96	Zinc finger protein 512; zinc binding, two ZF-C2H2	98.89
2dlq_A		124	GLI-kruppel family member HKR3; ZF-C2H2 domain, st	98.89
2eps_A		54	POZ-, at HOOK-, and zinc finger-containing protein	98.87
2ct1_A		77	Transcriptional repressor CTCF; CCCTC-BINDING fact	98.87
1x6e_A		72	Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca	98.86
1ubd_C		124	Protein (YY1 zinc finger domain); transcription in	98.86
2jp9_A		119	Wilms tumor 1; DNA binding, nucleic acid recogniti	98.85
4hec_A		190	Putative uncharacterized protein; ssgcid, structur	98.85
1x5w_A		70	Zinc finger protein 64, isoforms 1; ZNF338, nuclea	98.85
2kfn_A		605	Klenow fragment of DNA polymerase I; complex (poly	98.85
2lv2_A		85	Insulinoma-associated protein 1; structural genomi	98.82
2drp_A		66	Protein (tramtrack DNA-binding domain); protein-DN	98.82
2drp_A		66	Protein (tramtrack DNA-binding domain); protein-DN	98.82
2ee8_A		106	Protein ODD-skipped-related 2; zinc binding, ZF-C2	98.81
1x6h_A		86	Transcriptional repressor CTCF; zinc finger protei	98.8
3uk3_C		57	Zinc finger protein 217; transcription factor, DNA	98.76
2lce_A		74	B-cell lymphoma 6 protein; structural genomics, no	98.75
1f2i_G		73	Fusion of N-terminal 17-MER peptide extension to Z	98.74
2epr_A		48	POZ-, at HOOK-, and zinc finger-containing protein	98.7
2d9h_A		78	Zinc finger protein 692; ZF-C2H2 domain, structura	98.7
1a1h_A		90	QGSR zinc finger peptide; complex (zinc finger/DNA	98.69
2dmd_A		96	Zinc finger protein 64, isoforms 1 and 2; ZNF338,	98.66
1f2i_G		73	Fusion of N-terminal 17-MER peptide extension to Z	98.65
2cot_A		77	Zinc finger protein 435; ADK_LID domain, zinc fing	98.64
2epq_A		45	POZ-, at HOOK-, and zinc finger-containing protein	98.64
2ctu_A		73	Zinc finger protein 483; zinc finger domain, struc	98.63
2elz_A		46	Zinc finger protein 224; DNA-binding, metal-bindin	98.63
2emf_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.61
2kmk_A		82	Zinc finger protein GFI-1; tandem repeat zinc fing	98.61
2epa_A		72	Krueppel-like factor 10; transforming growth facto	98.61
1x9m_A		698	DNA polymerase; DNA ploymerase, N-2-acetylaminoflu	98.6
2ytq_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	98.6
2ytn_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.6
2epz_A		46	Zinc finger protein 28 homolog; C2H2, zinc finger	98.59
2el6_A		46	Zinc finger protein 268; alternative splicing, DNA	98.59
2em7_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.58
2eq0_A		46	Zinc finger protein 347; C2H2, zinc finger domain,	98.58
2ene_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.58
1bbo_A		57	Human enhancer-binding protein MBP-1; DNA-binding	98.58
2el4_A		46	Zinc finger protein 268; alternative splicing, DNA	98.58
2eq4_A		46	Zinc finger protein 224; C2H2, zinc finger domain,	98.58
2ep0_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.58
1vd4_A		62	Transcription initiation factor IIE, alpha subunit	98.58
2eoe_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.58
2emk_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.58
2em0_A		46	Zinc finger protein 224; DNA-binding, metal-bindin	98.57
2enc_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.57
2ctu_A		73	Zinc finger protein 483; zinc finger domain, struc	98.57
2ep2_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.57
2eop_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	98.57
2ytr_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.57
2ema_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.56
2em5_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.56
2eod_A		66	TNF receptor-associated factor 4; zinc binding, NF	98.56
2eml_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.56
2ely_A		46	Zinc finger protein 224; DNA-binding, metal-bindin	98.56
2emx_A		44	Zinc finger protein 268; ZF-C2H2, structural genom	98.56
2eoq_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.56
2emm_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.56
2emy_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	98.56
2ysp_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.56
2em9_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.55
2epx_A		47	Zinc finger protein 28 homolog; C2H2, zinc finger	98.55
2ytm_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.55
2en8_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.55
2eov_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.54
2em8_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.54
2epw_A		46	Zinc finger protein 268; C2H2, zinc finger domain,	98.54
2ytg_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.54
2eme_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	98.54
1wjp_A		107	Zinc finger protein 295; ZF-C2H2 domain, zinc bind	98.54
2ytd_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	98.54
2ytk_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.54
2yt9_A		95	Zinc finger-containing protein 1; C2H2, structural	98.54
2en1_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.54
2en6_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	98.54
2ytj_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.54
2eoo_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.54
2emh_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.54
2ytt_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	98.53
2emp_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.53
2eod_A		66	TNF receptor-associated factor 4; zinc binding, NF	98.53
2yso_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.53
2wbt_A		129	B-129; zinc finger; 2.70A {Sulfolobus virus 1}	98.53
2yu8_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.52
2adr_A		60	ADR1; transcription regulation, zinc finger,; NMR	98.52
2csh_A		110	Zinc finger protein 297B; ZF-C2H2 domain, zinc fin	98.51
2ep3_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.51
2wbs_A		89	Krueppel-like factor 4; transcription-DNA complex,	98.45
2em2_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.45
2ept_A		41	Zinc finger protein 32; C2H2, zinc finger domain,	98.43
2ej4_A		95	Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi	98.43
1llm_C		88	Chimera of ZIF23-GCN4; dimerization, DNA recogniti	98.41
1x3c_A		73	Zinc finger protein 292; DNA binding, nuclear prot	98.41
2yrm_A		43	B-cell lymphoma 6 protein; ZF-C2H2, zinc binding,	98.4
2ytp_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.39
2eon_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.39
2epu_A		45	Zinc finger protein 32; C2H2, zinc finger domain,	98.39
2ghf_A		102	ZHX1, zinc fingers and homeoboxes protein 1; C2H2	98.39
2enf_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.38
2ebt_A		100	Krueppel-like factor 5; C2H2-type zinc-finger, met	98.37
2eom_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.37
2em6_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.37
2enh_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.37
2el5_A		42	Zinc finger protein 268; alternative splicing, DNA	98.37
2yti_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.37
2emg_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.36
1vd4_A		62	Transcription initiation factor IIE, alpha subunit	98.36
2ytf_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	98.36
2em4_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.36
2eoh_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.36
2ent_A		48	Krueppel-like factor 15; zinc binding, transcripti	98.36
2yts_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.36
2ytb_A		42	Zinc finger protein 32; zinc-finger domain, C2H2,	98.36
2en9_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.36
2eq2_A		46	Zinc finger protein 347; C2H2, zinc finger domain,	98.36
2yth_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.35
2yte_A		42	Zinc finger protein 473; ZF-C2H2, structural genom	98.35
2emi_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.34
2dlk_A		79	Novel protein; ZF-C2H2 domain, zinc finger protein	98.34
2yrj_A		46	Zinc finger protein 473; C2H2-type zinc finger, st	98.33
2eos_A		42	B-cell lymphoma 6 protein; ZF-C2H2, structural gen	98.33
2eoj_A		44	Zinc finger protein 268; ZF-C2H2, structural genom	98.33
2emj_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.33
2ep1_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.33
2en7_A		44	Zinc finger protein 268; ZF-C2H2, structural genom	98.33
2eoy_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	98.33
2eq1_A		46	Zinc finger protein 347; C2H2, zinc finger domain,	98.33
2eow_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.32
2ytg_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.32
2em3_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.32
2dmi_A		115	Teashirt homolog 3; zinc finger protein 537, struc	98.31
2epc_A		42	Zinc finger protein 32; zinc finger domain, C2H2,	98.31
2eou_A		44	Zinc finger protein 473; ZF-C2H2, structural genom	98.31
2em0_A		46	Zinc finger protein 224; DNA-binding, metal-bindin	98.31
2eof_A		44	Zinc finger protein 268; ZF-C2H2, structural genom	98.31
2ely_A		46	Zinc finger protein 224; DNA-binding, metal-bindin	98.3
2emb_A		44	Zinc finger protein 473; ZF-C2H2, structural genom	98.3
1yui_A		54	GAGA-factor; complex (DNA-binding protein/DNA), ch	98.29
2ytn_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.29
2yto_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.29
2emk_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.29
2yu5_A		44	Zinc finger protein 473; ZF-C2H2 domain, structura	98.29
2eq3_A		46	Zinc finger protein 347; C2H2, zinc finger domain,	98.29
2el4_A		46	Zinc finger protein 268; alternative splicing, DNA	98.29
2eps_A		54	POZ-, at HOOK-, and zinc finger-containing protein	98.29
2emf_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.29
2eor_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.29
2en2_A		42	B-cell lymphoma 6 protein; ZF-C2H2, structural gen	98.29
2eml_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.28
2emx_A		44	Zinc finger protein 268; ZF-C2H2, structural genom	98.28
2eov_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.28
2elz_A		46	Zinc finger protein 224; DNA-binding, metal-bindin	98.28
2eq4_A		46	Zinc finger protein 224; C2H2, zinc finger domain,	98.28
2eop_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	98.27
2ytr_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.27
2ene_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.27
2eoq_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.27
2eoz_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	98.27
2ytq_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	98.27
2emy_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	98.27
2emm_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.27
2ema_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.26
2ytk_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.26
2en8_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.26
2epz_A		46	Zinc finger protein 28 homolog; C2H2, zinc finger	98.26
2en1_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.26
2em9_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.26
2eoe_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.26
2em5_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.26
2ytj_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.26
2eq0_A		46	Zinc finger protein 347; C2H2, zinc finger domain,	98.25
2em7_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.25
2ep2_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.25
2yu8_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.25
2emz_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.25
2emh_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.25
2emp_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	98.25
2ytd_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	98.24
2epw_A		46	Zinc finger protein 268; C2H2, zinc finger domain,	98.24
2eoo_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.24
2eox_A		44	Zinc finger protein 473; ZF-C2H2, structural genom	98.24
2epv_A		44	Zinc finger protein 268; C2H2, zinc finger domain,	98.24
2epa_A		72	Krueppel-like factor 10; transforming growth facto	98.24
2eme_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	98.24
2enc_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.22
2elo_A		37	Zinc finger protein 406; ZFAT zinc finger 1, struc	98.22
2yso_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.22
2ysp_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.22
2elx_A		35	Zinc finger protein 406; ZFAT zinc finger 1, struc	98.21
2ytm_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.21
2en6_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	98.21
2el6_A		46	Zinc finger protein 268; alternative splicing, DNA	98.2
2ep3_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	98.2
1njq_A		39	Superman protein; zinc-finger, peptide-zinc comple	98.2
2en3_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	98.19
1srk_A		35	Zinc finger protein ZFPM1; classical zinc finger,	98.18
2em8_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.17
1x6f_A		88	Zinc finger protein 462; zinc finger domain, KIAA1	98.14
2eln_A		38	Zinc finger protein 406; ZFAT zinc finger 1, struc	98.12
2epx_A		47	Zinc finger protein 28 homolog; C2H2, zinc finger	98.11
1rim_A		33	E6APC2 peptide; E6-binding domain, zinc finger, hu	98.11
2d9k_A		75	FLN29 gene product; zinc finger, ZF-TRAF, structur	98.11
2em2_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.11
2elv_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	98.08
4dfk_A		540	DNA polymerase I, thermostable; DNA polymerase, tr	98.06
2epq_A		45	POZ-, at HOOK-, and zinc finger-containing protein	98.03
2elt_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	98.03
2elr_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	98.03
2ep0_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	98.03
2elq_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	98.03
2ytb_A		42	Zinc finger protein 32; zinc-finger domain, C2H2,	98.02
2eq2_A		46	Zinc finger protein 347; C2H2, zinc finger domain,	98.02
2els_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	98.01
2epr_A		48	POZ-, at HOOK-, and zinc finger-containing protein	98.01
2el5_A		42	Zinc finger protein 268; alternative splicing, DNA	98.01
2yth_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	98.01
1p7a_A		37	BF3, BKLF, kruppel-like factor 3; classical zinc f	98.0
2yte_A		42	Zinc finger protein 473; ZF-C2H2, structural genom	98.0
2enf_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	97.99
2ej4_A		95	Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi	97.99
2em4_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	97.99
2emj_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	97.99
2ep1_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	97.98
2eon_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	97.98
2yti_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	97.98
2yts_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	97.98
2ytp_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	97.97
2em6_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	97.97
2emg_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	97.97
2eow_A		46	Zinc finger protein 347; ZF-C2H2, structural genom	97.97
2eos_A		42	B-cell lymphoma 6 protein; ZF-C2H2, structural gen	97.97
2elp_A		37	Zinc finger protein 406; ZFAT zinc finger 1, struc	97.96
2m0d_A		30	Zinc finger and BTB domain-containing protein 17;	97.96
2ytf_A		46	Zinc finger protein 268; ZF-C2H2, structural genom	97.96
2ytt_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	97.95
2en7_A		44	Zinc finger protein 268; ZF-C2H2, structural genom	97.95
2yto_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	97.95
2yu5_A		44	Zinc finger protein 473; ZF-C2H2 domain, structura	97.95
2elm_A		37	Zinc finger protein 406; ZFAT zinc finger 1, struc	97.95
2eq1_A		46	Zinc finger protein 347; C2H2, zinc finger domain,	97.95
2eoh_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	97.95
2eoj_A		44	Zinc finger protein 268; ZF-C2H2, structural genom	97.94
2em3_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	97.94
2en9_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	97.94
2emi_A		46	Zinc finger protein 484; ZF-C2H2, structural genom	97.94
1rik_A		29	E6APC1 peptide; E6-binding domain, zinc finger, hu	97.94
2enh_A		46	Zinc finger protein 28 homolog; ZF-C2H2, structura	97.93
2eoy_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	97.93
2yrj_A		46	Zinc finger protein 473; C2H2-type zinc finger, st	97.93
2j7j_A		85	Transcription factor IIIA; zinc finger module, alt	97.92
2eor_A		46	Zinc finger protein 224; ZF-C2H2, structural genom	97.92
1yui_A		54	GAGA-factor; complex (DNA-binding protein/DNA), ch	97.92
2kfq_A		32	FP1; protein, de novo protein; NMR {Synthetic}	97.92
2eoz_A		46	Zinc finger protein 473; ZF-C2H2, structural genom	97.92
2eof_A		44	Zinc finger protein 268; ZF-C2H2, structural genom	97.92
2en2_A		42	B-cell lymphoma 6 protein; ZF-C2H2, structural gen	97.92
2eox_A		44	Zinc finger protein 473; ZF-C2H2, structural genom	97.91
2epc_A		42	Zinc finger protein 32; zinc finger domain, C2H2,	97.9
2epp_A		66	POZ-, at HOOK-, and zinc finger-containing protein	97.9
2kvg_A		27	Zinc finger and BTB domain-containing protein 32;	97.89
3iuf_A		48	Zinc finger protein UBI-D4; structural genomics co	97.89
1ard_A		29	Yeast transcription factor ADR1; transcription reg	97.89
2emb_A		44	Zinc finger protein 473; ZF-C2H2, structural genom	97.88
2kvf_A		28	Zinc finger and BTB domain-containing protein 32;	97.88
2eq3_A		46	Zinc finger protein 347; C2H2, zinc finger domain,	97.87
2kvh_A		27	Zinc finger and BTB domain-containing protein 32;	97.86
1fv5_A		36	First zinc finger of U-shaped; CCHC, protein inter	97.85
1klr_A		30	Zinc finger Y-chromosomal protein; transcription;	97.85
2emz_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	97.84
1va1_A		37	Transcription factor SP1; C2H2 type zinc finger, D	97.83
1paa_A		30	Yeast transcription factor ADR1; transcription reg	97.83
2eou_A		44	Zinc finger protein 473; ZF-C2H2, structural genom	97.83
2ent_A		48	Krueppel-like factor 15; zinc binding, transcripti	97.82
1zfd_A		32	SWI5; DNA binding motif, zinc finger DNA binding d	97.82
2epv_A		44	Zinc finger protein 268; C2H2, zinc finger domain,	97.82
1sp2_A		31	SP1F2; zinc finger, transcription activation; NMR	97.82
2m0e_A		29	Zinc finger and BTB domain-containing protein 17;	97.82
3saf_A		428	Exosome component 10; exoribonuclease, RNA exosome	97.82
2en3_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	97.82
1bhi_A		38	CRE-BP1, ATF-2; CRE binding protein, transcription	97.81
2m0f_A		29	Zinc finger and BTB domain-containing protein 17;	97.81
2lvt_A		29	Zinc finger and BTB domain-containing protein 17;	97.01
2lvr_A		30	Zinc finger and BTB domain-containing protein 17;	96.99
2d9k_A		75	FLN29 gene product; zinc finger, ZF-TRAF, structur	97.76
1znf_A		27	31ST zinc finger from XFIN; zinc finger DNA bindin	97.76
2eom_A		46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	97.75
2yrm_A		43	B-cell lymphoma 6 protein; ZF-C2H2, zinc binding,	97.72
2epu_A		45	Zinc finger protein 32; C2H2, zinc finger domain,	97.7
2ept_A		41	Zinc finger protein 32; C2H2, zinc finger domain,	97.67
2lvu_A		26	Zinc finger and BTB domain-containing protein 17;	96.8
2e6m_A		208	Werner syndrome ATP-dependent helicase homolog; AP	97.61
3pv8_A		592	DNA polymerase I; DNA polymerase I, protein-DNA co	97.55
1vk0_A		206	Hypothetical protein; homohexamer, AT5G06450, stru	97.51
1ncs_A		47	Peptide M30F, transcriptional factor SWI5; DNA bin	97.46
2elo_A		37	Zinc finger protein 406; ZFAT zinc finger 1, struc	97.46
1njq_A		39	Superman protein; zinc-finger, peptide-zinc comple	97.45
1p7a_A		37	BF3, BKLF, kruppel-like factor 3; classical zinc f	97.43
1qht_A		775	Protein (DNA polymerase); archaea, hyperthermostab	97.41
2ab3_A		29	ZNF29; zinc finger protein, beta BETA alpha, RREII	97.4
2elx_A		35	Zinc finger protein 406; ZFAT zinc finger 1, struc	97.34
2eln_A		38	Zinc finger protein 406; ZFAT zinc finger 1, struc	97.33
1fv5_A		36	First zinc finger of U-shaped; CCHC, protein inter	97.29
4gmj_B		285	CCR4-NOT transcription complex subunit 7; mRNA dec	97.28
1yt3_A		375	Ribonuclease D, RNAse D; exoribonuclease, exonucle	97.27
1noy_A		388	Protein (DNA polymerase (E.C.2.7.7.7)); exonucleas	97.22
1srk_A		35	Zinc finger protein ZFPM1; classical zinc finger,	97.2
2kvh_A		27	Zinc finger and BTB domain-containing protein 32;	97.2
2kvg_A		27	Zinc finger and BTB domain-containing protein 32;	97.15
2hbj_A		410	Exosome complex exonuclease RRP6; RNA metabolism,	97.11
2elr_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	97.1
2kfq_A		32	FP1; protein, de novo protein; NMR {Synthetic}	97.04
2elv_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	97.01
2elq_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	97.01
2elt_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	97.0
1bhi_A		38	CRE-BP1, ATF-2; CRE binding protein, transcription	96.99
3iay_A		919	DNA polymerase delta catalytic subunit; protein-DN	96.98
2kvf_A		28	Zinc finger and BTB domain-containing protein 32;	96.98
1rim_A		33	E6APC2 peptide; E6-binding domain, zinc finger, hu	96.97
2epp_A		66	POZ-, at HOOK-, and zinc finger-containing protein	96.96
2elp_A		37	Zinc finger protein 406; ZFAT zinc finger 1, struc	96.95
3iuf_A		48	Zinc finger protein UBI-D4; structural genomics co	96.91
2lvu_A		26	Zinc finger and BTB domain-containing protein 17;	95.95
2elm_A		37	Zinc finger protein 406; ZFAT zinc finger 1, struc	96.9
1x3c_A		73	Zinc finger protein 292; DNA binding, nuclear prot	96.88
2els_A		36	Zinc finger protein 406; ZFAT zinc finger 1, struc	96.88
1x6f_A		88	Zinc finger protein 462; zinc finger domain, KIAA1	96.87
2m0d_A		30	Zinc finger and BTB domain-containing protein 17;	96.84
2m0e_A		29	Zinc finger and BTB domain-containing protein 17;	96.8
1klr_A		30	Zinc finger Y-chromosomal protein; transcription;	96.79
1znf_A		27	31ST zinc finger from XFIN; zinc finger DNA bindin	96.77
1zfd_A		32	SWI5; DNA binding motif, zinc finger DNA binding d	96.76
1rik_A		29	E6APC1 peptide; E6-binding domain, zinc finger, hu	96.75
1s5j_A		847	DNA polymerase I; replication, disulfide bonds, tr	96.74
1ard_A		29	Yeast transcription factor ADR1; transcription reg	96.7
2lvr_A		30	Zinc finger and BTB domain-containing protein 17;	95.7
1ncs_A		47	Peptide M30F, transcriptional factor SWI5; DNA bin	96.61
2lvt_A		29	Zinc finger and BTB domain-containing protein 17;	95.55
1va1_A		37	Transcription factor SP1; C2H2 type zinc finger, D	96.53
2m0f_A		29	Zinc finger and BTB domain-containing protein 17;	96.43
2a1r_A		430	Poly(A)-specific ribonuclease PARN; DEDD, nuclease	96.37
1paa_A		30	Yeast transcription factor ADR1; transcription reg	96.37
1sp2_A		31	SP1F2; zinc finger, transcription activation; NMR	96.36
3d45_A		507	Poly(A)-specific ribonuclease PARN; CAP analogue,	96.24
3k59_A		786	POL II, DNA polymerase II; protein-DNA complex, DN	96.2
3qex_A		903	DNA polymerase, GP43; difluorotoluene nucleoside;	96.16
2ab3_A		29	ZNF29; zinc finger protein, beta BETA alpha, RREII	95.94
2gv9_A		1193	DNA polymerase; polymerase alpha fold, transferase	95.71
3cym_A		440	Uncharacterized protein BAD_0989; structural genom	95.36
1zr9_A		124	Zinc finger protein 593; DNA binding, structural g	95.26
1zu1_A		127	DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr	93.7
2e72_A		49	POGO transposable element with ZNF domain; zinc fi	93.18
1zr9_A		124	Zinc finger protein 593; DNA binding, structural g	92.82
1zw8_A		64	Zinc-responsive transcriptional regulator ZAP1; in	90.81
2p51_A		333	SPCC18.06C protein; DEDD nuclease fold, hydrolase,	90.56
2d5r_A		252	CCR4-NOT transcription complex subunit 7; poly(A)	89.56
2e72_A		49	POGO transposable element with ZNF domain; zinc fi	89.2
1zw8_A		64	Zinc-responsive transcriptional regulator ZAP1; in	88.72
2py5_A		575	DNA polymerase; protein-DNA complex, replication,	87.92
1wjv_A		79	Cell growth regulating nucleolar protein LYAR; DNA	83.99

>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

Probab=100.00  E-value=2.5e-33  Score=244.33  Aligned_cols=162  Identities=26%  Similarity=0.447  Sum_probs=139.6

Q ss_pred             CCceEEeeccccccCCCCCccceeeEEEEecCCceEEeeeecCCccccCceeeecCCChhhhcCCCCHHHHHHHHHHHHh
Q 018558          131 DPQVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLC  210 (354)
Q Consensus       131 ~~~~vaiD~Ettg~~~~~~~~~i~~i~vv~~~g~~i~~~~v~P~~~i~~~~~~itGIt~~~l~~ap~~~~v~~~~~~~i~  210 (354)
                      ..+++++|+||||+++.. ..+|++|++|+.+|+++|++||+|..+|+++++++||||++||+++|+|++|+++|.+|+ 
T Consensus         4 ~~~~vviD~ETTGl~~~~-~~~iiei~~v~~~g~~i~~~lV~P~~~i~~~~~~i~GIt~~~l~~a~~~~~v~~~~~~~l-   81 (189)
T 1wlj_A            4 SREVVAMDCEMVGLGPHR-ESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLL-   81 (189)
T ss_dssp             --CEEEEEEEEEEETTTT-EEEEEEEEEECTTCCEEEEEEEECSSCEEECCHHHHCCCHHHHTTCEEHHHHHHHHHHHH-
T ss_pred             CCeEEEEEeECcCcCCCC-CceEEEEEEEeCCCCEEEeeEecCCCCCCccccCCCCCCHHHHcCCCCHHHHHHHHHHHH-
Confidence            457999999999986543 356788999999999999999999999999999999999999999999999999999999 


Q ss_pred             cCCCCccccCCCCCCcEEEEechhhhhhhhcccCCCceeeeccccCCCcc----CCCCCchHHHHHHHHhCCcCCCC--C
Q 018558          211 NGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDTAKYPPLMK----TSKLSNSLKYLTQAYLGYDIQIG--I  284 (354)
Q Consensus       211 ~~~~~~~~~~~~~~~~ilVgHn~~~Dl~~L~~~~~~~~~~Dt~~~~~~~~----~~~~~~~L~~l~~~~l~~~i~~~--~  284 (354)
                                   ++.+|||||+.||+++|+..+|...++||+.++....    +...+++|+.|++.++|+.++.+  +
T Consensus        82 -------------~~~~lV~hn~~fD~~~L~~~~~~~~~idt~~~~~~~~~~~~p~~~~~~L~~l~~~~lgi~~~~~~~~  148 (189)
T 1wlj_A           82 -------------KGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLG  148 (189)
T ss_dssp             -------------TTSEEEESSHHHHHHHTTCCCTTCEEEEGGGCHHHHHHHTC-----CCHHHHHHHHTCCCCSCCTTC
T ss_pred             -------------CCCEEEECCcHHHHHHHHHhCCCCceechHhhhhhhhcccCCCCCCccHHHHHHHHcCCCCCCCCCC
Confidence                         8899999999999999998888777899998743221    22357899999998789888765  9


Q ss_pred             CChHHHHHHHHHHHHHHHHhhhh
Q 018558          285 QDPYDDCVATMRLYMRMKSQAHK  307 (354)
Q Consensus       285 H~Al~DA~at~~l~~~~~~~~~~  307 (354)
                      |+|++||++|++||.++.++|..
T Consensus       149 H~Al~Da~ata~l~~~l~~~~~~  171 (189)
T 1wlj_A          149 HSSVEDARATMELYQISQRIRAR  171 (189)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCcHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999866

PyMOL of 1wlj

>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8}	Back alignment and structure

>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A*	Back alignment and structure

>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

>3cg7_A CRN-4, cell death-related nuclease 4; hydrolase, apoptosis, 3'-5' exonuclease, deddh; 2.50A {Caenorhabditis elegans} PDB: 3cm5_A 3cm6_A	Back alignment and structure

>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens}	Back alignment and structure

>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A	Back alignment and structure

>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B*	Back alignment and structure

>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens}	Back alignment and structure

>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5	Back alignment and structure

>2igi_A Oligoribonuclease; RNAse, exoribonuclease, exonuclease, hydrolase, mRNA decay; 1.70A {Escherichia coli} SCOP: c.55.3.5 PDB: 1yta_A 1j9a_A	Back alignment and structure

>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5	Back alignment and structure

>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens}	Back alignment and structure

>2gbz_A Oligoribonuclease; ORN, deddh, structural genomics, hydrolase; 2.30A {Xanthomonas campestris PV}	Back alignment and structure

>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A	Back alignment and structure

>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A*	Back alignment and structure

>3tr8_A Oligoribonuclease; transcription, hydrolase; 2.50A {Coxiella burnetii}	Back alignment and structure

>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A*	Back alignment and structure

>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1	Back alignment and structure

>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus}	Back alignment and structure

>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C	Back alignment and structure

>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A*	Back alignment and structure

>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C*	Back alignment and structure

>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A*	Back alignment and structure

>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus}	Back alignment and structure

>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A	Back alignment and structure

>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C*	Back alignment and structure

>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A	Back alignment and structure

>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A	Back alignment and structure

>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A	Back alignment and structure

>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A	Back alignment and structure

>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A*	Back alignment and structure

>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens}	Back alignment and structure

>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}	Back alignment and structure

>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus}	Back alignment and structure

>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}	Back alignment and structure

>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens}	Back alignment and structure

>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens}	Back alignment and structure

>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1}	Back alignment and structure

>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A	Back alignment and structure

>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A*	Back alignment and structure

>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A*	Back alignment and structure

>4hec_A Putative uncharacterized protein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, unknown; 1.80A {Mycobacterium tuberculosis}	Back alignment and structure

>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} SCOP: c.55.3.5 e.8.1.1 PDB: 1d9f_A* 1d9d_A* 1krp_A* 1ksp_A* 1qsl_A* 1kfs_A* 2kfz_A* 2kzm_A* 2kzz_A* 1dpi_A* 1kfd_A* 1kln_A* 1d8y_A*	Back alignment and structure

>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}	Back alignment and structure

>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1	Back alignment and structure

>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens}	Back alignment and structure

>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}	Back alignment and structure

>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C	Back alignment and structure

>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus}	Back alignment and structure

>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens}	Back alignment and structure

>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A*	Back alignment and structure

>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens}	Back alignment and structure

>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A	Back alignment and structure

>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A	Back alignment and structure

>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1	Back alignment and structure

>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A	Back alignment and structure

>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens}	Back alignment and structure

>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A	Back alignment and structure

>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A	Back alignment and structure

>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A	Back alignment and structure

>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1}	Back alignment and structure

>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A	Back alignment and structure

>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A	Back alignment and structure

>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A	Back alignment and structure

>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1	Back alignment and structure

>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A	Back alignment and structure

>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A	Back alignment and structure

>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens}	Back alignment and structure

>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A	Back alignment and structure

>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A*	Back alignment and structure

>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A	Back alignment and structure

>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A	Back alignment and structure

>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A	Back alignment and structure

>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A	Back alignment and structure

>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens}	Back alignment and structure

>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens}	Back alignment and structure

>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A	Back alignment and structure

>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1	Back alignment and structure

>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1	Back alignment and structure

>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4dfk_A DNA polymerase I, thermostable; DNA polymerase, transferase-DNA complex; HET: DNA DOC 0L5; 1.65A {Thermus aquaticus} PDB: 1jxe_A* 3ktq_A* 3lwl_A* 3lwm_A* 3m8s_A* 3m8r_A* 3oju_A* 3rr7_A* 3rr8_A* 3rrg_A* 3ojs_A* 3rtv_A* 3sv3_A* 3sv4_A* 3syz_A* 3sz2_A* 3t3f_A* 4df4_A* 4df8_A* 4dfj_A* ...	Back alignment and structure

>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A	Back alignment and structure

>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A	Back alignment and structure

>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A	Back alignment and structure

>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}	Back alignment and structure

>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A	Back alignment and structure

>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A	Back alignment and structure

>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A*	Back alignment and structure

>2kfq_A FP1; protein, de novo protein; NMR {Synthetic}	Back alignment and structure

>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A	Back alignment and structure

>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}	Back alignment and structure

>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens}	Back alignment and structure

>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A	Back alignment and structure

>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}	Back alignment and structure

>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}	Back alignment and structure

>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B	Back alignment and structure

>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A	Back alignment and structure

>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens}	Back alignment and structure

>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1	Back alignment and structure

>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1	Back alignment and structure

>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A	Back alignment and structure

>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}	Back alignment and structure

>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A	Back alignment and structure

>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}	Back alignment and structure

>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}	Back alignment and structure

>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens}	Back alignment and structure

>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1	Back alignment and structure

>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1	Back alignment and structure

>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}	Back alignment and structure

>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A*	Back alignment and structure

>3pv8_A DNA polymerase I; DNA polymerase I, protein-DNA complex, thymine-adenine, CLOS conformation; HET: DNA 2DT D3T; 1.52A {Geobacillus kaustophilus} PDB: 3px0_A* 3px4_A* 3px6_A* 3thv_A* 3ti0_A* 4dse_A* 4dsf_A* 4ds4_A* 4dqp_A* 4dqi_A* 4ds5_A* 4e0d_A* 4dqr_A* 4dqq_A* 3tan_A* 3tap_A* 3taq_A* 3tar_A* 4dqs_A* 3hp6_A* ...	Back alignment and structure

>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A	Back alignment and structure

>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1	Back alignment and structure

>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A	Back alignment and structure

>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A	Back alignment and structure

>1qht_A Protein (DNA polymerase); archaea, hyperthermostable, family B polymer alpha family polymerase, transferase; 2.10A {Thermococcus SP} SCOP: c.55.3.5 e.8.1.1 PDB: 1tgo_A 2xhb_A* 2vwj_A* 2vwk_A* 1wns_A* 1wn7_A 1qqc_A* 4ahc_A* 4ail_C* 3a2f_A* 2jgu_A* 1d5a_A	Back alignment and structure

>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A	Back alignment and structure

>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B	Back alignment and structure

>4gmj_B CCR4-NOT transcription complex subunit 7; mRNA decay, deadenylase, RNA bindin; HET: GOL; 2.70A {Homo sapiens}	Back alignment and structure

>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5	Back alignment and structure

>1noy_A Protein (DNA polymerase (E.C.2.7.7.7)); exonuclease, DNA-binding, complex (nucleotidyltransferase/DNA); HET: DNA; 2.20A {Enterobacteria phage T4} SCOP: c.55.3.5 PDB: 1noz_A*	Back alignment and structure

>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1	Back alignment and structure

>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}	Back alignment and structure

>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}	Back alignment and structure

>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A*	Back alignment and structure

>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kfq_A FP1; protein, de novo protein; NMR {Synthetic}	Back alignment and structure

>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>3iay_A DNA polymerase delta catalytic subunit; protein-DNA complex, DNA replication, DNA-BI DNA-directed DNA polymerase, exonuclease, hydrolase; HET: DNA DOC DCP; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}	Back alignment and structure

>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1	Back alignment and structure

>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens}	Back alignment and structure

>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}	Back alignment and structure

>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}	Back alignment and structure

>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}	Back alignment and structure

>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A	Back alignment and structure

>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1	Back alignment and structure

>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1	Back alignment and structure

>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A	Back alignment and structure

>1s5j_A DNA polymerase I; replication, disulfide bonds, transferase; HET: DNA; 2.40A {Sulfolobus solfataricus} SCOP: c.55.3.5 e.8.1.1	Back alignment and structure

>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A	Back alignment and structure

>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens}	Back alignment and structure

>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1	Back alignment and structure

>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}	Back alignment and structure

>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens}	Back alignment and structure

>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}	Back alignment and structure

>2a1r_A Poly(A)-specific ribonuclease PARN; DEDD, nuclease domain, hydrolase-RNA complex; 2.60A {Homo sapiens} PDB: 2a1s_A	Back alignment and structure

>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1	Back alignment and structure

>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A	Back alignment and structure

>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus}	Back alignment and structure

>3k59_A POL II, DNA polymerase II; protein-DNA complex, DNA damage, DNA repair, DNA-binding; HET: DNA DOC DCP; 1.92A {Escherichia coli} PDB: 3k57_A* 3k58_A* 3k5l_A* 3k5m_A* 3k5n_A* 3k5o_A* 3maq_A* 1q8i_A*	Back alignment and structure

>3qex_A DNA polymerase, GP43; difluorotoluene nucleoside; HET: DNA DOC DGT; 1.73A {Enterobacteria phage RB69} PDB: 3qei_A* 3qer_A* 3qes_A* 3qet_A* 3qep_A* 3qew_A* 3qev_A* 3s9h_A* 3sq0_A* 4dtn_A* 4dto_A* 4dtp_A* 4dtr_A* 4dts_A* 4dtu_A* 4dtx_A* 4e3s_A* 4fjm_A* 4fjl_A* 3spz_A* ...	Back alignment and structure

>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A	Back alignment and structure

>2gv9_A DNA polymerase; polymerase alpha fold, transferase; HET: DNA; 2.68A {Human herpesvirus 1} PDB: 1dml_B*	Back alignment and structure

>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID}	Back alignment and structure

>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4	Back alignment and structure

>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4	Back alignment and structure

>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4	Back alignment and structure

>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2p51_A SPCC18.06C protein; DEDD nuclease fold, hydrolase, gene regulation; 1.40A {Schizosaccharomyces pombe} PDB: 3g0z_A 3g10_A	Back alignment and structure

>2d5r_A CCR4-NOT transcription complex subunit 7; poly(A) deadenylase, antiproliferative protein, transcription; 2.50A {Homo sapiens} SCOP: c.55.3.9	Back alignment and structure

>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2py5_A DNA polymerase; protein-DNA complex, replication, transferase/DNA complex; HET: DNA; 1.60A {Bacillus phage PHI29} SCOP: c.55.3.5 e.8.1.1 PDB: 1xhz_A* 1xhx_A* 2ex3_A* 1xi1_A* 2pyj_A* 2pyl_A* 2pzs_A*	Back alignment and structure

>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		354
d1wlja_		173	c.55.3.5 (A:) Interferon-stimulated gene 20 kDa pr	3e-13
d1y97a1		228	c.55.3.5 (A:1-228) Three prime repair exonuclease	9e-07
d3b6oa1		226	c.55.3.5 (A:9-234) Three prime repair exonuclease	4e-05
d2guia1		174	c.55.3.5 (A:7-180) N-terminal exonuclease domain o	0.003

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Length = 173	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Interferon-stimulated gene 20 kDa protein, ISG20
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 65.0 bits (157), Expect = 3e-13
 Identities = 45/182 (24%), Positives = 77/182 (42%), Gaps = 21/182 (11%)

Query: 133 QVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHL 192
           +VVA+ C+MVG G         R  +++ +  +++  +++P   +T YR   +G+ P+H+
Sbjct: 1   EVVAMDCEMVGLGPHRE-SGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHM 59

Query: 193 RDAIPLKQVQRKIQDFLCNGEPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTRDT 252
             A P    + +I   L                   VGH L HD   L+ +       DT
Sbjct: 60  VGATPFAVARLEILQLLKGKLV--------------VGHDLKHDFQALKEDMSGYTIYDT 105

Query: 253 AKYPPLMKTSKL----SNSLKYLTQAYLGYDIQIGIQ--DPYDDCVATMRLYMRMKSQAH 306
           +    L + +KL      SL+ L++  L   IQ  +      +D  ATM LY   +    
Sbjct: 106 STDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQRIRA 165

Query: 307 KR 308
           +R
Sbjct: 166 RR 167

PyMOL of d1wlja_

>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Length = 228	Back information, alignment and structure

>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 226	Back information, alignment and structure

>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} Length = 174	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		354
d1wlja_		173	Interferon-stimulated gene 20 kDa protein, ISG20 {	99.97
d2guia1		174	N-terminal exonuclease domain of the epsilon subun	99.9
d3b6oa1		226	Three prime repair exonuclease 1, TREX1 {Mouse (Mu	99.85
d1y97a1		228	Three prime repair exonuclease 2, TREX2 {Human (Ho	99.83
d1w0ha_		200	Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 960	99.79
d2f96a1		202	Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287	99.64
d2qxfa1		467	Exonuclease I {Escherichia coli K12 (Escherichia c	99.61
d2csha1		53	Zinc finger protein 297b {Human (Homo sapiens) [Ta	99.29
d2igia1		180	Oligoribonuclease {Escherichia coli [TaxId: 562]}	99.29
d2csha1		53	Zinc finger protein 297b {Human (Homo sapiens) [Ta	99.11
d2epsa1		39	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	98.92
d1x6ea1		33	Zinc finger protein 24 {Human (Homo sapiens) [TaxI	98.83
d2cota2		38	Zinc finger and SCAN domain-containing protein 16,	98.78
d2adra1		29	ADR1 {Synthetic, based on Saccharomyces cerevisiae	98.76
d1sp1a_		29	Transcription factor sp1 {Human (Homo sapiens) [Ta	98.74
d1a1ia2		28	ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	98.73
d1srka_		35	Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc	98.7
d1x6ea2		26	Zinc finger protein 24 {Human (Homo sapiens) [TaxI	98.69
d1kfsa1		195	Exonuclease domain of prokaryotic DNA polymerase {	98.63
d1x6ha2		36	Transcriptional repressor CTCF {Human (Homo sapien	98.59
d1p7aa_		37	Kruppel-like factor 3, Bklf {Mouse (Mus musculus)	98.47
d1yt3a3		193	Ribonuclease D, catalytic domain {Escherichia coli	98.41
d2glia3		30	Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960	98.36
d2ct1a2		36	Transcriptional repressor CTCF {Human (Homo sapien	98.36
d1srka_		35	Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc	98.33
d2cota2		38	Zinc finger and SCAN domain-containing protein 16,	98.31
d1sp2a_		31	Transcription factor sp1 {Human (Homo sapiens) [Ta	98.3
d1p7aa_		37	Kruppel-like factor 3, Bklf {Mouse (Mus musculus)	98.3
d1ubdc3		30	Ying-yang 1 (yy1, zinc finger domain) {Human (Homo	98.3
d1x6ea1		33	Zinc finger protein 24 {Human (Homo sapiens) [TaxI	98.26
d1x6ha2		36	Transcriptional repressor CTCF {Human (Homo sapien	98.23
d2epsa1		39	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	98.2
d1a1ia2		28	ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	98.2
d2dlka2		36	Zinc finger protein 692, ZNF692 {Human (Homo sapie	98.19
d2hhva1		171	Exonuclease domain of prokaryotic DNA polymerase {	98.18
d1ncsa_		47	SWI5 zinc-finger domains {Baker's yeast (Saccharom	98.15
d1x6ea2		26	Zinc finger protein 24 {Human (Homo sapiens) [TaxI	98.15
d2ct1a2		36	Transcriptional repressor CTCF {Human (Homo sapien	98.09
d1zfda_		32	SWI5 zinc-finger domains {Baker's yeast (Saccharom	98.08
d1a1ia1		29	ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	98.03
d2dmda2		26	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	98.02
d2hbka2		292	Exosome complex exonuclease RRP6 {Baker's yeast (S	98.01
d1sp1a_		29	Transcription factor sp1 {Human (Homo sapiens) [Ta	97.98
d1ubdc4		28	Ying-yang 1 (yy1, zinc finger domain) {Human (Homo	97.9
d2adra1		29	ADR1 {Synthetic, based on Saccharomyces cerevisiae	97.88
d1ncsa_		47	SWI5 zinc-finger domains {Baker's yeast (Saccharom	97.85
d2d5ra1		252	CCR4-NOT transcription complex subunit 7, CAF1 {Hu	97.81
d1vk0a_		206	Hypothetical protein AT5G06450 {Thale-cress (Arabi	97.75
d1zfda_		32	SWI5 zinc-finger domains {Baker's yeast (Saccharom	97.69
d2epra1		35	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	97.67
d1x9ma1		204	Exonuclease domain of T7 DNA polymerase {Bacteriop	97.61
d1ubdc2		28	Ying-yang 1 (yy1, zinc finger domain) {Human (Homo	97.59
d1a1ia3		28	ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	97.58
d1ubdc4		28	Ying-yang 1 (yy1, zinc finger domain) {Human (Homo	97.5
d2glia3		30	Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960	97.45
d2epqa1		32	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	97.45
d1ubdc3		30	Ying-yang 1 (yy1, zinc finger domain) {Human (Homo	97.27
d1tgoa1		347	Exonuclease domain of family B DNA polymerases {Ar	97.2
d2dmda2		26	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	97.17
d1a1ia3		28	ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	97.13
d1a1ia1		29	ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	97.11
d1sp2a_		31	Transcription factor sp1 {Human (Homo sapiens) [Ta	97.1
d2dmda3		29	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	97.09
d2dlka2		36	Zinc finger protein 692, ZNF692 {Human (Homo sapie	96.87
d2epra1		35	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	96.83
d2dlqa4		27	GLI-Krueppel family member HKR3 {Mouse (Mus muscul	96.65
d1znfa_		26	XFIN, third domain {Xenopus laevis [TaxId: 8355]}	96.6
d2dmda1		28	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	96.52
d2glia5		29	Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960	96.41
d2j7ja2		29	Transcription factor IIIA, TFIIIA {Xenopus laevis	96.4
d1q8ia1		388	Exonuclease domain of family B DNA polymerases {Es	96.38
d1bboa1		28	Enhancer binding protein {Human (Homo sapiens) [Ta	96.29
d1s5ja1		410	Exonuclease domain of family B DNA polymerases {Su	96.17
d2csha2		44	Zinc finger protein 297b {Human (Homo sapiens) [Ta	96.04
d1bboa2		29	Enhancer binding protein {Human (Homo sapiens) [Ta	95.97
d2dlqa3		30	GLI-Krueppel family member HKR3 {Mouse (Mus muscul	95.88
d1njqa_		37	SUPERMAN zinc finger domain {Thale cress (Arabidop	95.8
d1ubdc2		28	Ying-yang 1 (yy1, zinc finger domain) {Human (Homo	95.76
d2glia4		31	Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960	95.74
d2csha2		44	Zinc finger protein 297b {Human (Homo sapiens) [Ta	95.65
d2dlqa1		26	GLI-Krueppel family member HKR3 {Mouse (Mus muscul	95.49
d2epqa1		32	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	95.46
d2glia5		29	Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960	95.45
d1klra_		30	ZFY {Human (Homo sapiens) [TaxId: 9606]}	95.41
d2dlqa2		28	GLI-Krueppel family member HKR3 {Mouse (Mus muscul	95.22
d2adra2		31	ADR1 {Synthetic, based on Saccharomyces cerevisiae	95.12
d1znfa_		26	XFIN, third domain {Xenopus laevis [TaxId: 8355]}	94.97
d1x5wa2		29	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	94.72
d2dmda1		28	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	94.47
d2j7ja2		29	Transcription factor IIIA, TFIIIA {Xenopus laevis	94.39
d2dmda3		29	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	94.07
d1bboa2		29	Enhancer binding protein {Human (Homo sapiens) [Ta	94.03
d1klra_		30	ZFY {Human (Homo sapiens) [TaxId: 9606]}	93.93
d1bhia_		38	Transactivation domain of cre-bp1/atf-2 {Human (Ho	93.16
d2glia4		31	Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960	92.99
d1x5wa1		28	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	92.91
d1tf3a2		30	Transcription factor IIIA, TFIIIA {Xenopus laevis	92.38
d1bboa1		28	Enhancer binding protein {Human (Homo sapiens) [Ta	92.27
d1bhia_		38	Transactivation domain of cre-bp1/atf-2 {Human (Ho	92.26
d1x5wa2		29	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	91.98
d1noya_		372	Exonuclease domain of family B DNA polymerases {Ba	91.92
d1x5wa1		28	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	91.87
d2dlqa4		27	GLI-Krueppel family member HKR3 {Mouse (Mus muscul	91.44
d1njqa_		37	SUPERMAN zinc finger domain {Thale cress (Arabidop	91.33
d2dlqa2		28	GLI-Krueppel family member HKR3 {Mouse (Mus muscul	90.81
d2eppa1		53	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	89.63
d2ctda2		30	Zinc finger protein 512, ZNF512 {Human (Homo sapie	89.28
d1yuja_		54	GAGA factor {Drosophila melanogaster [TaxId: 7227]	89.17
d1ih7a1		375	Exonuclease domain of family B DNA polymerases {Ba	89.05
d2adra2		31	ADR1 {Synthetic, based on Saccharomyces cerevisiae	88.87
d2ct1a1		28	Transcriptional repressor CTCF {Human (Homo sapien	88.85
d1x6ha1		37	Transcriptional repressor CTCF {Human (Homo sapien	88.83
d2glia2		33	Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960	88.63
d2drpa2		26	Tramtrack protein (two zinc-finger peptide) {Droso	88.28
d2dlqa1		26	GLI-Krueppel family member HKR3 {Mouse (Mus muscul	86.42
d2eppa1		53	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	85.77
d1x6ha1		37	Transcriptional repressor CTCF {Human (Homo sapien	84.65
d2drpa2		26	Tramtrack protein (two zinc-finger peptide) {Droso	83.93
d1yuza2		36	Nigerythrin, C-terminal domain {Desulfovibrio vulg	81.77
d1tf3a2		30	Transcription factor IIIA, TFIIIA {Xenopus laevis	81.0
d1y0jb1		36	U-shaped transcription factor, different fingers {	80.13

>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Interferon-stimulated gene 20 kDa protein, ISG20
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=3e-32  Score=231.54  Aligned_cols=158  Identities=25%  Similarity=0.428  Sum_probs=131.3

Q ss_pred             ceEEeeccccccCCCCCccceeeEEEEecCCceEEeeeecCCccccCceeeecCCChhhhcCCCCHHHHHHHHHHHHhcC
Q 018558          133 QVVAIACKMVGGGSDGSLDLCGRVCIIDEYENIIFHAYVKPPIPVTSYRYETTGIRPEHLRDAIPLKQVQRKIQDFLCNG  212 (354)
Q Consensus       133 ~~vaiD~Ettg~~~~~~~~~i~~i~vv~~~g~~i~~~~v~P~~~i~~~~~~itGIt~~~l~~ap~~~~v~~~~~~~i~~~  212 (354)
                      ++|+||+||||+++. ....|..+++|+.+|+++|++||+|..+|+++++++||||+++++++|+|++++++|.+|+   
T Consensus         1 ~~v~iD~EttGl~~~-~~~ii~~~~iv~~~g~~i~~~~v~p~~~i~~~~~~i~GIt~e~~~~~~~~~~~~~~~~~~~---   76 (173)
T d1wlja_           1 EVVAMDCEMVGLGPH-RESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLL---   76 (173)
T ss_dssp             CEEEEEEEEEEETTT-TEEEEEEEEEECTTCCEEEEEEEECSSCEEECCHHHHCCCHHHHTTCEEHHHHHHHHHHHH---
T ss_pred             CEEEEEEEcCCCCCC-CCcEEEEEEEEEecCeEEEEEeeecccccCcceeEEecCcchhhhcCCcHHHHHHHHHhhc---
Confidence            479999999999754 3445678999999999999999999999999999999999999999999999999999999   


Q ss_pred             CCCccccCCCCCCcEEEEechhhhhhhhcccCCCceee----eccccCCCccCCCCCchHHHHHHHHhCCcCCC--CCCC
Q 018558          213 EPMWKIRPRGSRARILVGHGLDHDLDRLQVEYPAIMTR----DTAKYPPLMKTSKLSNSLKYLTQAYLGYDIQI--GIQD  286 (354)
Q Consensus       213 ~~~~~~~~~~~~~~ilVgHn~~~Dl~~L~~~~~~~~~~----Dt~~~~~~~~~~~~~~~L~~l~~~~l~~~i~~--~~H~  286 (354)
                                 ++.++||||+.||+++|+...+...+.    |+..+++...+...+++|+.|+..|++.+++.  .+|+
T Consensus        77 -----------~~~~lv~hn~~fD~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~~~~~~~~i~~~~~~H~  145 (173)
T d1wlja_          77 -----------KGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHS  145 (173)
T ss_dssp             -----------TTSEEEESSHHHHHHHTTCCCTTCEEEEGGGCHHHHHHHTC-----CCHHHHHHHHTCCCCSCCTTCCC
T ss_pred             -----------ccceEEeechHhHHHHHHHhhccCcccchhHHHHHHHHHhhcccCCcCHHHHHHHHhCCcccCCCCCCC
Confidence                       889999999999999998766554433    44444444444556789999999999998863  3799


Q ss_pred             hHHHHHHHHHHHHHHHHhh
Q 018558          287 PYDDCVATMRLYMRMKSQA  305 (354)
Q Consensus       287 Al~DA~at~~l~~~~~~~~  305 (354)
                      |++||++|++||+.+++.-
T Consensus       146 Al~Da~at~~l~~~~~~~~  164 (173)
T d1wlja_         146 SVEDARATMELYQISQRIR  164 (173)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            9999999999997766543

PyMOL of d1wlja_

>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w0ha_ c.55.3.5 (A:) Exonuclease ERI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2qxfa1 c.55.3.5 (A:8-474) Exonuclease I {Escherichia coli K12 (Escherichia coli K-12) [TaxId: 83333]}	Back information, alignment and structure

>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2igia1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence}	Back information, alignment and structure

>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}	Back information, alignment and structure

>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence}	Back information, alignment and structure

>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2d5ra1 c.55.3.9 (A:11-262) CCR4-NOT transcription complex subunit 7, CAF1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x9ma1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus gorgonarius [TaxId: 71997]}	Back information, alignment and structure

>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]}	Back information, alignment and structure

>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]}	Back information, alignment and structure

>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence}	Back information, alignment and structure

>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]}	Back information, alignment and structure

>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]}	Back information, alignment and structure

>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]}	Back information, alignment and structure

>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}	Back information, alignment and structure

>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence}	Back information, alignment and structure

>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}	Back information, alignment and structure

>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]}	Back information, alignment and structure

>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure