Citrus Sinensis ID: 018578


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
MASPPTKDAPADKKAEGSTPKSEATSGSVRDSSSSPSGASAASAFPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL
cccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHcccHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccHHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHcHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccHHHHHHHHHHcccHcccccHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHcHcccc
maspptkdapadkkaegstpkseatsgsvrdsssspsgasaasafpgvggaapnpfdfsamsgllndpsIKELAEQIAKDPAFNSMAEQLQKTLhganaeesipqfdttQYYSTMQQVMQNPQFMTMAERLGnalmqdpsmshmmesltnptkkdQIEERMAKikedpslkpildeiesggpsammKYWNDKDVLQKLGEAMglavggdattsadnagadeaeevgnedesivhhtasvgdaEGLKNALaagadkdeedsegrTALHFACGYGEVKCAQILLEAganvdaldknknTALHYAAGYGRKECVALLLENGAavtlqnmdgktpidvaKLNSQHDVLKLLEKDAFL
maspptkdapadkkaegstpkseatsgsvrdsssspsGASAASAFPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAkikedpslkpiLDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL
MASPPTKDAPADKKAEGSTPKSEatsgsvrdsssspsgasaasafpgvggaapNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL
******************************************************************************************************************************************************************************************KYWNDKDVLQKLGEAMGLA**********************************************************TALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKL****************
*****************************************************NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL
********************************************FPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALA************RTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL
***************************************************APNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDA**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASPPTKDAPADKKAEGSTPKSEATSGSVRDSSSSPSGASAASAFPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query353 2.2.26 [Sep-21-2011]
Q9SAR5342 Ankyrin repeat domain-con no no 0.903 0.932 0.667 1e-118
Q8N283 1001 Ankyrin repeat domain-con yes no 0.467 0.164 0.331 4e-13
Q91ZT9 288 Ankyrin repeat and SOCS b no no 0.322 0.395 0.382 7e-13
Q5F478 990 Serine/threonine-protein no no 0.249 0.088 0.460 8e-13
Q5R6D7 288 Ankyrin repeat and SOCS b no no 0.322 0.395 0.382 8e-13
Q9H765 288 Ankyrin repeat and SOCS b no no 0.322 0.395 0.382 9e-13
Q08E43 288 Ankyrin repeat and SOCS b no no 0.322 0.395 0.382 9e-13
Q6PFX9 1320 Tankyrase-1 OS=Mus muscul no no 0.339 0.090 0.388 1e-12
O95271 1327 Tankyrase-1 OS=Homo sapie no no 0.339 0.090 0.388 1e-12
Q9H2K2 1166 Tankyrase-2 OS=Homo sapie no no 0.339 0.102 0.388 1e-12
>sp|Q9SAR5|AKR2_ARATH Ankyrin repeat domain-containing protein 2 OS=Arabidopsis thaliana GN=AKR2 PE=1 SV=2 Back     alignment and function desciption
 Score =  426 bits (1094), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 217/325 (66%), Positives = 260/325 (80%), Gaps = 6/325 (1%)

Query: 31  DSSSSPSGASAASAFPGVGGAAPNPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQL 90
           + SS P  AS +S    + G   N FDFS M+ +LNDPSI+E+AEQIAKDPAFN +AEQL
Sbjct: 22  NKSSKPESASGSSTSSAMPGLNFNAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQL 81

Query: 91  QKTLHGANAEESIPQFDTTQYYSTMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTN 150
           Q+++  A  E   P FD  QY +TMQQVM NP+F TMAE+LG AL+QDP MS  +++ +N
Sbjct: 82  QRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFKTMAEKLGTALVQDPQMSPFLDAFSN 141

Query: 151 PTKKDQIEERMAKIKEDPSLKPILDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGG-- 208
           P   +   ERMA++KEDP LKPILDEI++GGPSAMMKYWND +VL+KLGEAMG+ V G  
Sbjct: 142 PETAEHFTERMARMKEDPELKPILDEIDAGGPSAMMKYWNDPEVLKKLGEAMGMPVAGLP 201

Query: 209 DATTSADNAGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHF 268
           D T SA+   A+E EE     ESIVH TAS+GD EGLK ALA+G +KDEEDSEGRTALHF
Sbjct: 202 DQTVSAEPEVAEEGEEE----ESIVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHF 257

Query: 269 ACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDG 328
           ACGYGE+KCAQ+L++AGA+V+A+DKNKNT LHYAAGYGRKECV+LLLENGAAVTLQN+D 
Sbjct: 258 ACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDE 317

Query: 329 KTPIDVAKLNSQHDVLKLLEKDAFL 353
           KTPIDVAKLNSQ +V+KLLEKDAFL
Sbjct: 318 KTPIDVAKLNSQLEVVKLLEKDAFL 342




Seems to be involved in the regulation of hydrogen peroxide levels during biotic and abiotic stresses by optimizing the ascorbate peroxidase 3 (APX3) hydrogen peroxide-degrading activity. This regulation might be monitored by GRF6.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 Back     alignment and function description
>sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 Back     alignment and function description
>sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 Back     alignment and function description
>sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 Back     alignment and function description
>sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 Back     alignment and function description
>sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 Back     alignment and function description
>sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 Back     alignment and function description
>sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 Back     alignment and function description
>sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query353
359474945358 PREDICTED: ankyrin repeat domain-contain 0.991 0.977 0.811 1e-159
37625031354 putative ankyrin-repeat protein [Vitis a 0.875 0.872 0.858 1e-158
255546638345 ankyrin repeat domain protein, putative 0.966 0.988 0.792 1e-157
327344119371 putative PDF1-interacting protein 2, par 0.912 0.867 0.829 1e-155
449444443359 PREDICTED: ankyrin repeat domain-contain 0.983 0.966 0.752 1e-154
224132484308 predicted protein [Populus trichocarpa] 0.872 1.0 0.834 1e-154
224132478366 predicted protein [Populus trichocarpa] 0.852 0.822 0.857 1e-153
359806300352 uncharacterized protein LOC100784610 [Gl 0.997 1.0 0.762 1e-153
359806322350 uncharacterized protein LOC100797622 [Gl 0.980 0.988 0.756 1e-153
118485011366 unknown [Populus trichocarpa] 0.852 0.822 0.853 1e-152
>gi|359474945|ref|XP_002283498.2| PREDICTED: ankyrin repeat domain-containing protein 2-like [Vitis vinifera] gi|297744439|emb|CBI37701.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  568 bits (1465), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 293/361 (81%), Positives = 311/361 (86%), Gaps = 11/361 (3%)

Query: 1   MASPPTKDAPADKKAEGSTPKSEATSGSVRDSSSSPSGASAASAFPGVGGAAPNPFDFSA 60
           MAS   KD PAD+K  GS   S++ S S    S     A+AAS  PG G  A NPFDFSA
Sbjct: 1   MASNSDKDTPADEKT-GSAENSKSDSSSGESHSEQRRAAAAAS-VPGAGLPA-NPFDFSA 57

Query: 61  MSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYSTMQQVMQ 120
           M+GLLNDPSIKELAEQIAKDPAFN MAEQLQKT HGA  EESIPQFDT QYYSTMQQVMQ
Sbjct: 58  MTGLLNDPSIKELAEQIAKDPAFNQMAEQLQKTFHGAAVEESIPQFDTQQYYSTMQQVMQ 117

Query: 121 NPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPILDEIESG 180
           NPQFMTMAERLGNALMQDPSMS M+E+L NPT KDQ+EERMA+IKEDPSLKPILDEIE+G
Sbjct: 118 NPQFMTMAERLGNALMQDPSMSSMLENLANPTHKDQLEERMARIKEDPSLKPILDEIETG 177

Query: 181 GPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIVHH----- 235
           GP+AMM+YWNDKDVLQKLGEAMGLAV GDA  SADN+G DEAEE+ NEDESI HH     
Sbjct: 178 GPAAMMRYWNDKDVLQKLGEAMGLAVSGDAAASADNSGLDEAEELANEDESIAHHHSESI 237

Query: 236 ---TASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALD 292
              TASVGD EGLKNALA+GADKDEEDSEGRTALHFACGYGEVKCAQIL+EAGA VDALD
Sbjct: 238 VHDTASVGDVEGLKNALASGADKDEEDSEGRTALHFACGYGEVKCAQILVEAGATVDALD 297

Query: 293 KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAF 352
           KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLN+QH+VLKLLEKDAF
Sbjct: 298 KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNNQHEVLKLLEKDAF 357

Query: 353 L 353
           L
Sbjct: 358 L 358




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|37625031|gb|AAQ96339.1| putative ankyrin-repeat protein [Vitis aestivalis] Back     alignment and taxonomy information
>gi|255546638|ref|XP_002514378.1| ankyrin repeat domain protein, putative [Ricinus communis] gi|223546475|gb|EEF47974.1| ankyrin repeat domain protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|327344119|gb|AEA50964.1| putative PDF1-interacting protein 2, partial [Gossypium barbadense] Back     alignment and taxonomy information
>gi|449444443|ref|XP_004139984.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cucumis sativus] gi|449475676|ref|XP_004154520.1| PREDICTED: ankyrin repeat domain-containing protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224132484|ref|XP_002328292.1| predicted protein [Populus trichocarpa] gi|222837807|gb|EEE76172.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132478|ref|XP_002328290.1| predicted protein [Populus trichocarpa] gi|222837805|gb|EEE76170.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359806300|ref|NP_001241477.1| uncharacterized protein LOC100784610 [Glycine max] gi|255646471|gb|ACU23714.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359806322|ref|NP_001241225.1| uncharacterized protein LOC100797622 [Glycine max] gi|255639193|gb|ACU19895.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|118485011|gb|ABK94370.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query353
TAIR|locus:2827572344 AKR2B "ankyrin repeat-containi 0.838 0.860 0.726 8.2e-115
UNIPROTKB|Q746T3141 GSU3435 "Ankyrin repeat protei 0.320 0.801 0.380 3.7e-15
TIGR_CMR|GSU_3435141 GSU_3435 "ankyrin repeat prote 0.320 0.801 0.380 3.7e-15
TAIR|locus:2063804240 AT2G03430 "AT2G03430" [Arabido 0.328 0.483 0.383 4.8e-15
UNIPROTKB|Q08E43 288 ASB8 "Ankyrin repeat and SOCS 0.322 0.395 0.382 4.7e-14
UNIPROTKB|E2QST3 288 ASB8 "Uncharacterized protein" 0.322 0.395 0.382 4.7e-14
UNIPROTKB|I3LRC3 288 ASB8 "Uncharacterized protein" 0.322 0.395 0.382 4.7e-14
RGD|1309246 288 Asb8 "ankyrin repeat and SOCS 0.322 0.395 0.382 4.7e-14
MGI|MGI:1925791 288 Asb8 "ankyrin repeat and SOCS 0.322 0.395 0.382 4.7e-14
UNIPROTKB|Q9H765 288 ASB8 "Ankyrin repeat and SOCS 0.322 0.395 0.382 4.7e-14
TAIR|locus:2827572 AKR2B "ankyrin repeat-containing 2B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1132 (403.5 bits), Expect = 8.2e-115, P = 8.2e-115
 Identities = 218/300 (72%), Positives = 254/300 (84%)

Query:    54 NPFDFSAMSGLLNDPSIKELAEQIAKDPAFNSMAEQLQKTLHGANAEESIPQFDTTQYYS 113
             N FDFS M+G+LNDPSIKELAEQIAKDP+FN +AEQLQ+++   + E  +P FD  QY  
Sbjct:    49 NAFDFSGMAGILNDPSIKELAEQIAKDPSFNQLAEQLQRSVPTGSHEGGLPNFDPQQYMQ 108

Query:   114 TMQQVMQNPQFMTMAERLGNALMQDPSMSHMMESLTNPTKKDQIEERMAKIKEDPSLKPI 173
             TMQQVM+NP+F TMAERLGNAL+QDP MS  +E+L NP   +Q  ERMA++KEDP LKPI
Sbjct:   109 TMQQVMENPEFRTMAERLGNALVQDPQMSPFLEALGNPAASEQFAERMAQMKEDPELKPI 168

Query:   174 LDEIESGGPSAMMKYWNDKDVLQKLGEAMGLAVGGDATTSADNAGADEAEEVGNEDESIV 233
             L EI++GGPSAMMKYWNDKDVL KLGEAMG+AVG D T +A+    +EAEE G E+ESIV
Sbjct:   169 LAEIDAGGPSAMMKYWNDKDVLAKLGEAMGIAVGADQTVAAE---PEEAEE-GEEEESIV 224

Query:   234 HHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDK 293
             H TAS+GD EGLK ALA+G +KDEEDSEGRTALHFACGYGEV+CAQ+LL+AGAN +A+DK
Sbjct:   225 HQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEVRCAQVLLDAGANANAIDK 284

Query:   294 NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDAFL 353
             NKNT LHYAAGYGRKECV+LLLENGAAVT QNMD K PIDVA+LN+Q DV+KLLEKDAFL
Sbjct:   285 NKNTPLHYAAGYGRKECVSLLLENGAAVTQQNMDNKNPIDVARLNNQLDVVKLLEKDAFL 344




GO:0005737 "cytoplasm" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0005886 "plasma membrane" evidence=IDA
UNIPROTKB|Q746T3 GSU3435 "Ankyrin repeat protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3435 GSU_3435 "ankyrin repeat protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2063804 AT2G03430 "AT2G03430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E43 ASB8 "Ankyrin repeat and SOCS box protein 8" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QST3 ASB8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRC3 ASB8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1309246 Asb8 "ankyrin repeat and SOCS box-containing 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1925791 Asb8 "ankyrin repeat and SOCS box-containing 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H765 ASB8 "Ankyrin repeat and SOCS box protein 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-35
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-27
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-21
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-21
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-15
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 8e-14
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-13
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-13
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-12
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-12
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 6e-12
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-11
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-11
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-11
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-11
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-10
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-09
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-09
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-08
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-08
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 9e-08
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-07
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 9e-07
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-06
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-06
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-06
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-05
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-05
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 3e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 6e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-05
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 2e-04
smart0024830 smart00248, ANK, ankyrin repeats 2e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 3e-04
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-04
smart0024830 smart00248, ANK, ankyrin repeats 4e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-04
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 7e-04
PHA02917 661 PHA02917, PHA02917, ankyrin-like protein; Provisio 7e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.001
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.002
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.002
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.002
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.002
PHA02716 764 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provi 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  124 bits (313), Expect = 4e-35
 Identities = 51/121 (42%), Positives = 76/121 (62%)

Query: 227 NEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGA 286
            +  + +H  AS G  E +K  L  GAD + +D++GRT LH A   G ++  ++LLE GA
Sbjct: 5   EDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGA 64

Query: 287 NVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKL 346
           +V+A DK+ NT LH AA  G  + V LLL++GA V  ++ DG+TP+ +A  N   +V+KL
Sbjct: 65  DVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKL 124

Query: 347 L 347
           L
Sbjct: 125 L 125


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165231 PHA02917, PHA02917, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165089 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 353
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.95
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.95
PHA02791284 ankyrin-like protein; Provisional 99.91
PHA02791284 ankyrin-like protein; Provisional 99.91
PHA02859209 ankyrin repeat protein; Provisional 99.91
PHA02875 413 ankyrin repeat protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.9
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02875 413 ankyrin repeat protein; Provisional 99.89
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.89
PHA02878 477 ankyrin repeat protein; Provisional 99.89
PHA02874 434 ankyrin repeat protein; Provisional 99.88
KOG0508 615 consensus Ankyrin repeat protein [General function 99.88
PHA02878 477 ankyrin repeat protein; Provisional 99.88
PHA02874 434 ankyrin repeat protein; Provisional 99.88
PHA03100 480 ankyrin repeat protein; Provisional 99.88
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.87
PHA02859209 ankyrin repeat protein; Provisional 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.87
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.86
PHA03095 471 ankyrin-like protein; Provisional 99.86
PHA03100 480 ankyrin repeat protein; Provisional 99.86
PHA03095 471 ankyrin-like protein; Provisional 99.86
PHA02946 446 ankyin-like protein; Provisional 99.86
KOG0510 929 consensus Ankyrin repeat protein [General function 99.86
PHA02795 437 ankyrin-like protein; Provisional 99.86
PHA02884 300 ankyrin repeat protein; Provisional 99.86
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.85
PHA02989 494 ankyrin repeat protein; Provisional 99.85
PHA02798 489 ankyrin-like protein; Provisional 99.85
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.85
KOG0508 615 consensus Ankyrin repeat protein [General function 99.85
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.85
PHA02946 446 ankyin-like protein; Provisional 99.84
PHA02876 682 ankyrin repeat protein; Provisional 99.83
PHA02798 489 ankyrin-like protein; Provisional 99.83
PHA02989 494 ankyrin repeat protein; Provisional 99.82
KOG0514452 consensus Ankyrin repeat protein [General function 99.82
PHA02876 682 ankyrin repeat protein; Provisional 99.82
PHA02730 672 ankyrin-like protein; Provisional 99.82
PHA02917 661 ankyrin-like protein; Provisional 99.82
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.81
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.81
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.81
PHA02917 661 ankyrin-like protein; Provisional 99.81
PHA02795 437 ankyrin-like protein; Provisional 99.8
PHA02743166 Viral ankyrin protein; Provisional 99.8
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.79
KOG0510 929 consensus Ankyrin repeat protein [General function 99.78
PHA02730 672 ankyrin-like protein; Provisional 99.78
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.77
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.77
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.77
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.76
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.75
PHA02884 300 ankyrin repeat protein; Provisional 99.74
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.73
PHA02736154 Viral ankyrin protein; Provisional 99.72
PHA02792 631 ankyrin-like protein; Provisional 99.71
PHA02741169 hypothetical protein; Provisional 99.71
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.7
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.69
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.69
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.69
PHA02792 631 ankyrin-like protein; Provisional 99.69
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.69
KOG0514452 consensus Ankyrin repeat protein [General function 99.67
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.66
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.59
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.58
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.57
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.57
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.56
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.55
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.54
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.54
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.5
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.5
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.49
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.47
KOG0515 752 consensus p53-interacting protein 53BP/ASPP, conta 99.4
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.39
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.32
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.29
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.26
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.12
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.98
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.97
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.96
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.95
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.93
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.91
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.9
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.89
KOG0522 560 consensus Ankyrin repeat protein [General function 98.87
PF1360630 Ank_3: Ankyrin repeat 98.82
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.78
PF1360630 Ank_3: Ankyrin repeat 98.71
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.65
KOG0522 560 consensus Ankyrin repeat protein [General function 98.61
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.58
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.57
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.55
KOG0511 516 consensus Ankyrin repeat protein [General function 98.34
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.34
KOG2384 223 consensus Major histocompatibility complex protein 98.3
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.25
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.17
KOG0511 516 consensus Ankyrin repeat protein [General function 98.13
KOG2384223 consensus Major histocompatibility complex protein 98.13
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.91
KOG2505 591 consensus Ankyrin repeat protein [General function 97.37
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.04
KOG2505591 consensus Ankyrin repeat protein [General function 96.9
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.85
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 95.32
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.04
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.5
smart0072741 STI1 Heat shock chaperonin-binding motif. 92.18
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 89.64
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.93
PTZ0045890 acyl CoA binding protein; Provisional 82.7
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 81.56
KOG0817142 consensus Acyl-CoA-binding protein [Lipid transpor 81.27
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.95  E-value=1.1e-28  Score=204.86  Aligned_cols=131  Identities=34%  Similarity=0.490  Sum_probs=112.3

Q ss_pred             hhhhcCCCCCcHHHHHHHcCCHHHHHHHHHc-CCCCCCCCCCCCcHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCCcHH
Q 018578          221 EAEEVGNEDESIVHHTASVGDAEGLKNALAA-GADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKNTAL  299 (353)
Q Consensus       221 ~~~~~~~~g~t~Lh~Aa~~g~~~~v~~Ll~~-g~d~~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~gadi~~~d~~G~TpL  299 (353)
                      ..+..+..||||||+||..|+.++|+.|+.. |+|+|..+..|.|+||||+..|+.+|+++|+++|+.++.+|..|.|||
T Consensus        64 ~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtpl  143 (226)
T KOG4412|consen   64 KPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTNGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPL  143 (226)
T ss_pred             CCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCCCcceehhhhcCChhhHHHHHHhcCCCCcccccccCchh
Confidence            3455588888888888888888888888887 888888888888888888888888888888888888888888888888


Q ss_pred             HHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCcHHHHHHHHhcC
Q 018578          300 HYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDA  351 (353)
Q Consensus       300 h~A~~~g~~~~v~~Ll~~gad~~~~d~~g~TpL~~A~~~g~~~iv~~Ll~~~  351 (353)
                      |-|+..|.++++++|+..|+.+|.+|+.|+||||.|...|+.++..+|+++|
T Consensus       144 HRAAavGklkvie~Li~~~a~~n~qDk~G~TpL~~al~e~~~d~a~lLV~~g  195 (226)
T KOG4412|consen  144 HRAAAVGKLKVIEYLISQGAPLNTQDKYGFTPLHHALAEGHPDVAVLLVRAG  195 (226)
T ss_pred             HHHHhccchhhHHHHHhcCCCCCcccccCccHHHHHHhccCchHHHHHHHhc
Confidence            8888888888888888888888888888888888888888888888888765



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PTZ00458 acyl CoA binding protein; Provisional Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0817 consensus Acyl-CoA-binding protein [Lipid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 4e-20
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-19
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-19
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-18
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-04
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 6e-17
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-15
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-15
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-15
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-14
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-14
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-14
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 8e-14
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-13
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-13
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-13
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-13
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-13
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-13
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-13
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-13
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 6e-13
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 8e-13
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-12
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-12
3b7b_A 237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-12
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 5e-12
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 5e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-12
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 7e-12
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 7e-12
3deo_A183 Structural Basis For Specific Substrate Recognition 7e-12
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 8e-12
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 9e-12
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-11
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 2e-11
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-11
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 5e-11
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-10
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-10
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 5e-10
1uoh_A226 Human Gankyrin Length = 226 5e-10
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 5e-10
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 8e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-09
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 5e-09
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 9e-09
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 1e-08
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-08
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-08
3uxg_A172 Crystal Structure Of Rfxank Length = 172 2e-08
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-08
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 4e-08
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-07
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 4e-08
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 5e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 5e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-07
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 6e-08
3d9h_A 285 Crystal Structure Of The Splice Variant Of Human As 8e-08
3zkj_A 261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 9e-08
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-07
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-07
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-07
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 5e-07
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 1e-06
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 1e-06
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 1e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-06
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 1e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 1e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-06
2b0o_E301 Crystal Structure Of Uplc1 Gap Domain Length = 301 2e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-06
3lvq_E 497 The Crystal Structure Of Asap3 In Complex With Arf6 2e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-06
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 3e-06
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 1e-05
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-05
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-05
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-05
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-05
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 2e-05
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 3e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 5e-05
1ycs_B239 P53-53bp2 Complex Length = 239 5e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-04
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 1e-04
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 2e-04
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 2e-04
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 3e-04
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 3e-04
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 3e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 4e-04
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 6e-04
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure

Iteration: 1

Score = 95.5 bits (236), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 49/117 (41%), Positives = 75/117 (64%) Query: 233 VHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALD 292 +H+ A G E +K ++ GAD + +DS+GRT LH+A G + ++L+ GA+V+A D Sbjct: 41 LHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKD 100 Query: 293 KNKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEK 349 + T LHYAA G KE V LL+ GA V + DG+TP+D+A+ + +++KLLEK Sbjct: 101 SDGRTPLHYAAKEGHKEIVKLLISKGADVNTSDSDGRTPLDLAREHGNEEIVKLLEK 157
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-35
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-27
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-21
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-34
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-22
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-18
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 7e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-33
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-24
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 1e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-08
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 4e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-33
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-32
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-24
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 4e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-28
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-23
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-32
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-26
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-24
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-21
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-31
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-28
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-23
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-31
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-28
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 9e-23
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-21
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-20
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-17
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-07
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-04
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-31
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-27
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-26
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-21
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-31
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-24
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-23
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-31
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 2e-27
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 4e-27
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-21
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-31
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 5e-25
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-23
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 7e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-07
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-31
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-29
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-28
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-27
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-25
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-23
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-19
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-30
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-30
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-30
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-30
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-26
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-25
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-16
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-30
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-29
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-29
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-29
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-29
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-29
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-28
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-27
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-27
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-23
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-30
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-26
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-30
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-29
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-27
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-22
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-29
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-19
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-29
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-29
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-29
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-29
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-27
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-24
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-24
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-22
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-09
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-07
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 4e-29
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-29
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-25
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-23
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-21
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 6e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-25
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-23
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-28
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-15
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-28
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-25
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-21
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-28
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-24
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-23
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-19
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-18
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-28
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-25
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-22
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-17
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-28
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-26
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-25
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-28
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-25
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-24
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-24
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 5e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-27
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-24
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-24
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-26
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-09
3t8k_A 186 Uncharacterized protein; structural genomics, PSI- 2e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-26
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-16
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-26
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-26
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-24
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-26
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-26
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-22
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-20
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-25
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-20
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-16
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-25
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-23
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-23
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-22
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-22
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-23
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-22
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-04
2rfa_A232 Transient receptor potential cation channel subfa 4e-22
2rfa_A232 Transient receptor potential cation channel subfa 6e-22
2rfa_A232 Transient receptor potential cation channel subfa 7e-22
2rfa_A 232 Transient receptor potential cation channel subfa 4e-20
2rfa_A232 Transient receptor potential cation channel subfa 2e-17
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-21
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-20
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-05
2pnn_A273 Transient receptor potential cation channel subfa 4e-19
2pnn_A273 Transient receptor potential cation channel subfa 4e-15
2pnn_A273 Transient receptor potential cation channel subfa 3e-14
2pnn_A 273 Transient receptor potential cation channel subfa 7e-11
2pnn_A273 Transient receptor potential cation channel subfa 1e-09
2pnn_A 273 Transient receptor potential cation channel subfa 3e-04
2etb_A256 Transient receptor potential cation channel subfam 9e-19
2etb_A256 Transient receptor potential cation channel subfam 2e-16
2etb_A256 Transient receptor potential cation channel subfam 4e-15
2etb_A256 Transient receptor potential cation channel subfam 2e-07
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-18
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-05
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 5e-18
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 2e-15
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-15
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-17
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-16
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
 Score =  124 bits (314), Expect = 3e-35
 Identities = 39/118 (33%), Positives = 59/118 (50%)

Query: 234 HHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDK 293
           H  +  GD   ++  L  G+D + +D  G T LH AC +G +K  ++LL+  A V+    
Sbjct: 15  HIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGY 74

Query: 294 NKNTALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDA 351
             ++ LH AA  G  + V LLL  GA+    N+ G  P+D     S   +L L EK+ 
Sbjct: 75  QNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLPEKNE 132


>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query353
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.95
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
2rfa_A232 Transient receptor potential cation channel subfa 99.94
2rfa_A232 Transient receptor potential cation channel subfa 99.94
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
3hra_A201 Ankyrin repeat family protein; structural protein; 99.94
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.94
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.94
2etb_A256 Transient receptor potential cation channel subfam 99.94
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.93
3hra_A201 Ankyrin repeat family protein; structural protein; 99.93
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.93
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
2pnn_A273 Transient receptor potential cation channel subfa 99.93
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.93
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.93
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.93
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
2etb_A256 Transient receptor potential cation channel subfam 99.92
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.92
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.92
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.92
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.92
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.92
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.92
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.91
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.91
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.91
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.91
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.91
2pnn_A273 Transient receptor potential cation channel subfa 99.91
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.91
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.91
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.91
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.91
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.91
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.9
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.9
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.9
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.9
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.9
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.89
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.87
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.86
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.84
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.84
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.84
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.82
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.79
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.78
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.76
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 99.75
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 95.89
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 94.04
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 90.16
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 87.17
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 84.23
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 83.47
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 83.22
3fp5_A106 Acyl-COA binding protein; ACBP, cacao disease, fat 80.82
2lbb_A96 Acyl COA binding protein; protein binding, structu 80.82
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.97  E-value=1.6e-30  Score=222.55  Aligned_cols=134  Identities=40%  Similarity=0.625  Sum_probs=127.3

Q ss_pred             cCcchhhhcCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCC
Q 018578          217 AGADEAEEVGNEDESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKN  296 (353)
Q Consensus       217 ~~~~~~~~~~~~g~t~Lh~Aa~~g~~~~v~~Ll~~g~d~~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~gadi~~~d~~G~  296 (353)
                      .|.++ +..+..|+||||+|+..++.+++++|++.|++++.+|..|+||||+||..|+.++|++|+++|+++|.+|..|+
T Consensus        26 ~Gadv-n~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~~G~  104 (169)
T 4gpm_A           26 NGADV-NASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGR  104 (169)
T ss_dssp             TTCCT-TCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSC
T ss_pred             CCCCC-CCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCC
Confidence            34443 45688899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCcHHHHHHHHhcC
Q 018578          297 TALHYAAGYGRKECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKDA  351 (353)
Q Consensus       297 TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~g~TpL~~A~~~g~~~iv~~Ll~~~  351 (353)
                      ||||+|+..|+.++|++|+++|++++.+|.+|+||||+|+.+|+.+++++|+++|
T Consensus       105 TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~iv~~Ll~~G  159 (169)
T 4gpm_A          105 TPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQG  159 (169)
T ss_dssp             CHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHTC-
T ss_pred             CHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCCHHHHHHHHHCC
Confidence            9999999999999999999999999999999999999999999999999999987



>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 Back     alignment and structure
>2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 353
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-22
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-22
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-20
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-16
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-22
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-17
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-20
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-17
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-10
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-08
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-19
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-11
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-07
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-19
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-15
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-10
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-13
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-05
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.004
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-16
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-05
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-10
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-12
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 8e-12
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 9e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-11
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-11
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-10
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-08
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-08
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-08
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.003
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-06
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 95.0 bits (235), Expect = 2e-22
 Identities = 28/84 (33%), Positives = 41/84 (48%)

Query: 264 TALHFACGYGEVKCAQILLEAGANVDALDKNKNTALHYAAGYGRKECVALLLENGAAVTL 323
           T LH A   G +   + LL+ GA+ +  +    T LH AA  G  E    LL+N A V  
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61

Query: 324 QNMDGKTPIDVAKLNSQHDVLKLL 347
           +  D +TP+  A      +++KLL
Sbjct: 62  KAKDDQTPLHCAARIGHTNMVKLL 85


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query353
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.95
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.94
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.92
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.9
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.87
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.87
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.87
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.86
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.86
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.86
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.86
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.86
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.85
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.84
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.8
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.8
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.79
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.77
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.76
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.72
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Cell cycle inhibitor p16ink4A
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=9.1e-28  Score=193.06  Aligned_cols=121  Identities=26%  Similarity=0.390  Sum_probs=115.3

Q ss_pred             CCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCC-cHHHHHHHcCC
Q 018578          229 DESIVHHTASVGDAEGLKNALAAGADKDEEDSEGRTALHFACGYGEVKCAQILLEAGANVDALDKNKN-TALHYAAGYGR  307 (353)
Q Consensus       229 g~t~Lh~Aa~~g~~~~v~~Ll~~g~d~~~~d~~g~t~Lh~Aa~~g~~~~v~~Ll~~gadi~~~d~~G~-TpLh~A~~~g~  307 (353)
                      +.++||+|+..|++++|++|+++|++++.++..|.||||+| ..|+.+++++|+++|++++.++..|. ||||+|+.+|+
T Consensus         3 ~~~~L~~Aa~~G~~~~v~~Ll~~gad~n~~~~~g~t~l~~a-~~g~~~~v~~Ll~~ga~~~~~~~~~~~~~L~~A~~~g~   81 (125)
T d1bi7b_           3 SADWLATAAARGRVEEVRALLEAGANPNAPNSYGRRPIQVM-MMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGF   81 (125)
T ss_dssp             STTHHHHHHHHTCHHHHHHHHTTTCCTTCCCSSSCCTTTSS-CTTCHHHHHHHHTTTCCCCCCCTTTCCCHHHHHHHHTC
T ss_pred             ChhHHHHHHHCCCHHHHHHHHHcCCcccccccccccccccc-cccccccccccccccccccccccccccccccccccccc
Confidence            56899999999999999999999999999999999999976 47999999999999999999999876 69999999999


Q ss_pred             HHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCcHHHHHHHHhc
Q 018578          308 KECVALLLENGAAVTLQNMDGKTPIDVAKLNSQHDVLKLLEKD  350 (353)
Q Consensus       308 ~~~v~~Ll~~gad~~~~d~~g~TpL~~A~~~g~~~iv~~Ll~~  350 (353)
                      .+++++|+++|++++.+|..|+||||+|+.+|+.+++++|+..
T Consensus        82 ~~~v~~Ll~~ga~~~~~d~~G~T~l~~A~~~g~~~~v~~Llsa  124 (125)
T d1bi7b_          82 LDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAA  124 (125)
T ss_dssp             HHHHHHHHHHTCCSSCCCTTCCCHHHHHHHHTCHHHHHHHSSC
T ss_pred             ccccccccccccccccccCCCCCHHHHHHHcCCHHHHHHHHhc
Confidence            9999999999999999999999999999999999999999864



>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure