Citrus Sinensis ID: 018603
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 353 | ||||||
| 296085908 | 494 | unnamed protein product [Vitis vinifera] | 0.654 | 0.467 | 0.544 | 2e-54 | |
| 224150739 | 330 | predicted protein [Populus trichocarpa] | 0.790 | 0.845 | 0.431 | 1e-52 | |
| 449527097 | 247 | PREDICTED: double-stranded RNA-binding p | 0.427 | 0.611 | 0.664 | 4e-52 | |
| 449446736 | 446 | PREDICTED: uncharacterized protein LOC10 | 0.427 | 0.338 | 0.664 | 8e-52 | |
| 238480134 | 329 | double-stranded-RNA-binding protein 4 [A | 0.847 | 0.908 | 0.397 | 3e-47 | |
| 22331912 | 355 | double-stranded-RNA-binding protein 4 [A | 0.847 | 0.842 | 0.374 | 3e-47 | |
| 18389232 | 355 | unknown protein [Arabidopsis thaliana] | 0.847 | 0.842 | 0.374 | 4e-47 | |
| 224125924 | 240 | predicted protein [Populus trichocarpa] | 0.430 | 0.633 | 0.630 | 2e-46 | |
| 7362760 | 345 | putative protein [Arabidopsis thaliana] | 0.818 | 0.837 | 0.365 | 3e-45 | |
| 224146035 | 281 | predicted protein [Populus trichocarpa] | 0.492 | 0.619 | 0.537 | 3e-44 |
| >gi|296085908|emb|CBI31232.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 219 bits (557), Expect = 2e-54, Method: Compositional matrix adjust.
Identities = 129/237 (54%), Positives = 152/237 (64%), Gaps = 6/237 (2%)
Query: 5 SSSESAVQVNARETDRTTQVNATISTVNDVHKSRDMQHLYKNQLQSYTQKKNLPLPMYSC 64
SSS S + N T T QV MQHLYK QLQ+Y QK+NLPLPMYS
Sbjct: 124 SSSASNIVNNVPATKGTLQVQIQ----ETCQTPEGMQHLYKTQLQTYAQKRNLPLPMYSF 179
Query: 65 EREGPPHASRFKCKVTIDGQTYESHQFFPTLKEAEHEAAKVALMSLSLDKFQQDDSVLYK 124
E GP H RFK KVTI+ QTYES FFPTLK+AEH AAK+ALMSLS FQ+DD +YK
Sbjct: 180 ESIGPSHNCRFKSKVTIEEQTYESPDFFPTLKDAEHAAAKLALMSLSPAGFQEDDYGVYK 239
Query: 125 NVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVA 184
N+LQE+A+KE Y LPVY+T++SG SH PTF+STVE+ GE F GQ AK+KK AEM+AAK A
Sbjct: 240 NLLQEMARKEGYQLPVYSTEKSGVSHMPTFLSTVEIEGETFVGQKAKTKKLAEMNAAKAA 299
Query: 185 YMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNV--TADLHHNIQTAGRLVFNPNS 239
Y LKE + +SP Q SSS S TADL NI + LV P++
Sbjct: 300 YTHLKERRSNLNHKSLSPSGQELRGVESSSFNSESSGTADLQQNIISKLTLVLKPSA 356
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224150739|ref|XP_002337003.1| predicted protein [Populus trichocarpa] gi|222837556|gb|EEE75921.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449527097|ref|XP_004170549.1| PREDICTED: double-stranded RNA-binding protein 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449446736|ref|XP_004141127.1| PREDICTED: uncharacterized protein LOC101222879 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|238480134|ref|NP_001154686.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|197267565|dbj|BAG69145.1| dsRNA-binding protein [Arabidopsis thaliana] gi|332646874|gb|AEE80395.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22331912|ref|NP_191839.2| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|42572769|ref|NP_974480.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|75244610|sp|Q8H1D4.1|DRB4_ARATH RecName: Full=Double-stranded RNA-binding protein 4; AltName: Full=dsRNA-binding protein 4; Short=AtDRB4 gi|23297784|gb|AAN13025.1| unknown protein [Arabidopsis thaliana] gi|332646872|gb|AEE80393.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|332646873|gb|AEE80394.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18389232|gb|AAL67059.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224125924|ref|XP_002319709.1| predicted protein [Populus trichocarpa] gi|222858085|gb|EEE95632.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|7362760|emb|CAB83130.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224146035|ref|XP_002325855.1| predicted protein [Populus trichocarpa] gi|222862730|gb|EEF00237.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 353 | ||||||
| TAIR|locus:2081620 | 355 | DRB4 "double-stranded-RNA-bind | 0.705 | 0.701 | 0.444 | 1.6e-51 | |
| TAIR|locus:2163016 | 393 | DRB5 "dsRNA-binding protein 5" | 0.419 | 0.376 | 0.451 | 1.8e-31 | |
| TAIR|locus:2057491 | 434 | DRB2 "dsRNA-binding protein 2" | 0.456 | 0.370 | 0.446 | 2.6e-31 | |
| TAIR|locus:2829928 | 359 | DRB3 "dsRNA-binding protein 3" | 0.419 | 0.412 | 0.464 | 3.3e-31 | |
| TAIR|locus:2024407 | 419 | HYL1 "HYPONASTIC LEAVES 1" [Ar | 0.453 | 0.381 | 0.375 | 1.2e-21 | |
| UNIPROTKB|Q0IQN6 | 424 | DRB8 "Double-stranded RNA-bind | 0.436 | 0.363 | 0.398 | 1.6e-21 | |
| RGD|3402 | 513 | Eif2ak2 "eukaryotic translatio | 0.487 | 0.335 | 0.291 | 9e-07 | |
| UNIPROTKB|P19525 | 551 | EIF2AK2 "Interferon-induced, d | 0.492 | 0.315 | 0.278 | 1e-06 | |
| UNIPROTKB|I3L6S9 | 242 | EIF2AK2 "Uncharacterized prote | 0.492 | 0.719 | 0.282 | 1.3e-06 | |
| UNIPROTKB|A0JNE6 | 533 | EIF2AK2 "Uncharacterized prote | 0.484 | 0.320 | 0.275 | 2.1e-06 |
| TAIR|locus:2081620 DRB4 "double-stranded-RNA-binding protein 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 501 (181.4 bits), Expect = 1.6e-51, Sum P(2) = 1.6e-51
Identities = 116/261 (44%), Positives = 156/261 (59%)
Query: 40 MQHLYKNQLQSYTQKKNLPLPMYSCEREGPPHASRFKCKVTIDGQTYESHQFFPTLKEAE 99
M H+YK QLQ+Y + NL LP+Y+ EREGPPHA RF+C VT GQT++S +FFPTLK AE
Sbjct: 1 MDHVYKGQLQAYALQHNLELPVYANEREGPPHAPRFRCNVTFCGQTFQSSEFFPTLKSAE 60
Query: 100 HEAAKVALMSLSLDKFQQDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVE 159
H AAK+A+ SL+ + D V YKN+LQE+AQKE+ LP Y T SG SHAPTF STVE
Sbjct: 61 HAAAKIAVASLTPQSPEGID-VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVE 119
Query: 160 VGGEVFSGQGAKSKKQAEMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNV 219
G+VFSG+ AK+KK AEMSAAKVA+M +K N +Q + P + Q D +S+ S
Sbjct: 120 FAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNGNSNQTGSPTLPS-ERQEDVNSNVKSS-- 176
Query: 220 TADLHHNIQTAGRLVFNPNSMPK---VQAEEIRELTTV---NTEVAGYDLXXXXXXXXXX 273
++H Q + ++V P++ K V +E +L N + L
Sbjct: 177 PQEIHS--QPSSKVVMTPDTPSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDG 234
Query: 274 XXXXXXXXGVEKGMPSSSLPL 294
G++ + SSSLP+
Sbjct: 235 TLSALTTDGMKMNIASSSLPI 255
|
|
| TAIR|locus:2163016 DRB5 "dsRNA-binding protein 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057491 DRB2 "dsRNA-binding protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2829928 DRB3 "dsRNA-binding protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024407 HYL1 "HYPONASTIC LEAVES 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0IQN6 DRB8 "Double-stranded RNA-binding protein 8" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| RGD|3402 Eif2ak2 "eukaryotic translation initiation factor 2-alpha kinase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P19525 EIF2AK2 "Interferon-induced, double-stranded RNA-activated protein kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L6S9 EIF2AK2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A0JNE6 EIF2AK2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_scaffold_6651000001 | hypothetical protein (330 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 353 | |||
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 2e-18 | |
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 1e-17 | |
| TIGR02191 | 220 | TIGR02191, RNaseIII, ribonuclease III, bacterial | 1e-16 | |
| PRK00102 | 229 | PRK00102, rnc, ribonuclease III; Reviewed | 2e-16 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 2e-15 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 2e-15 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 3e-15 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 3e-14 | |
| COG0571 | 235 | COG0571, Rnc, dsRNA-specific ribonuclease [Transcr | 2e-13 | |
| TIGR02191 | 220 | TIGR02191, RNaseIII, ribonuclease III, bacterial | 4e-12 | |
| PRK00102 | 229 | PRK00102, rnc, ribonuclease III; Reviewed | 9e-12 | |
| COG0571 | 235 | COG0571, Rnc, dsRNA-specific ribonuclease [Transcr | 1e-11 | |
| PRK12371 | 235 | PRK12371, PRK12371, ribonuclease III; Reviewed | 3e-05 | |
| PHA03103 | 183 | PHA03103, PHA03103, double-strand RNA-binding prot | 5e-04 | |
| TIGR04238 | 201 | TIGR04238, seadorna_dsRNA, seadornavirus double-st | 5e-04 |
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
Score = 78.1 bits (193), Expect = 2e-18
Identities = 30/68 (44%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
Query: 123 YKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGG-EVFSGQGAKSKKQAEMSA 180
K++LQELAQK LP Y ++ G HAP F V VGG G+G SKK+A+ +A
Sbjct: 2 PKSLLQELAQKRGKPLPEYELVEEEGPDHAPRFTVEVTVGGKITGEGEG-SSKKEAKQNA 60
Query: 181 AKVAYMRL 188
A+ A +L
Sbjct: 61 AEAALRKL 68
|
Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III, RNases H1, and dsRNA dependent adenosine deaminases. Length = 68 |
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|171444 PRK12371, PRK12371, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222987 PHA03103, PHA03103, double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234517 TIGR04238, seadorna_dsRNA, seadornavirus double-stranded RNA-binding protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 99.94 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 99.72 | |
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 99.71 | |
| PRK14718 | 467 | ribonuclease III; Provisional | 99.71 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 99.66 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 99.64 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 99.62 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 99.61 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 99.6 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 99.59 | |
| PRK00102 | 229 | rnc ribonuclease III; Reviewed | 99.56 | |
| TIGR02191 | 220 | RNaseIII ribonuclease III, bacterial. This family | 99.53 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 99.5 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 99.49 | |
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 99.48 | |
| PRK14718 | 467 | ribonuclease III; Provisional | 99.47 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 99.45 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 99.45 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 99.43 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 99.41 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 99.4 | |
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 99.39 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 99.37 | |
| PRK00102 | 229 | rnc ribonuclease III; Reviewed | 99.37 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 99.36 | |
| TIGR02191 | 220 | RNaseIII ribonuclease III, bacterial. This family | 99.31 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 99.19 | |
| KOG4334 | 650 | consensus Uncharacterized conserved protein, conta | 99.05 | |
| KOG1817 | 533 | consensus Ribonuclease [RNA processing and modific | 98.74 | |
| KOG1817 | 533 | consensus Ribonuclease [RNA processing and modific | 98.24 | |
| KOG3769 | 333 | consensus Ribonuclease III domain proteins [Transl | 97.88 | |
| KOG3769 | 333 | consensus Ribonuclease III domain proteins [Transl | 97.87 | |
| KOG4334 | 650 | consensus Uncharacterized conserved protein, conta | 97.87 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 97.81 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 97.74 | |
| KOG3792 | 816 | consensus Transcription factor NFAT, subunit NF90 | 97.22 | |
| PF03368 | 90 | Dicer_dimer: Dicer dimerisation domain; InterPro: | 96.37 | |
| PF14954 | 252 | LIX1: Limb expression 1 | 95.46 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 94.54 | |
| PF03368 | 90 | Dicer_dimer: Dicer dimerisation domain; InterPro: | 93.25 | |
| KOG2334 | 477 | consensus tRNA-dihydrouridine synthase [Translatio | 91.69 | |
| PF14954 | 252 | LIX1: Limb expression 1 | 87.79 | |
| KOG2334 | 477 | consensus tRNA-dihydrouridine synthase [Translatio | 86.71 | |
| KOG3792 | 816 | consensus Transcription factor NFAT, subunit NF90 | 81.47 |
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.6e-25 Score=216.08 Aligned_cols=148 Identities=30% Similarity=0.350 Sum_probs=131.2
Q ss_pred CCHHHHHHHHHHHcCCCCCeeee-eecCCCCCccEEEEEEEccEeeecccccCCcchhHHHHHHHHHHHhhcccC-----
Q 018603 42 HLYKNQLQSYTQKKNLPLPMYSC-EREGPPHASRFKCKVTIDGQTYESHQFFPTLKEAEHEAAKVALMSLSLDKF----- 115 (353)
Q Consensus 42 ~npKS~LqE~~QK~gl~~P~Y~l-~~~Gp~h~~~F~~~V~I~g~~~~ag~Gg~SKK~Akq~AAk~AL~~L~~~~~----- 115 (353)
+.|++.|||||.++++. |.|++ .++||.|++.|+++|.++. ....|. |.+||.|++.||..+|..|.....
T Consensus 38 KS~IS~l~E~~~r~~~~-v~fevl~eeGp~H~~~fv~rvtvg~-~~a~Ge-G~sKK~AKh~AA~~~L~~lk~l~~l~~v~ 114 (339)
T KOG3732|consen 38 KSPISLLQEYGLRRGLT-PVYEVLREEGPPHMPNFVFRVTVGE-ITATGE-GKSKKLAKHRAAEALLKELKKLPPLANVR 114 (339)
T ss_pred CChHHHHHHHHHHhCCC-cceeeeeccCCccCCCeEEEEEEee-eEEecC-CCchhHHHHHHHHHHHHHHhcCCCccccc
Confidence 99999999999999987 68988 5799999999999999995 445677 599999999999999999986531
Q ss_pred -------C---------------CCcchhHHHHHHHHHHHhcCCCCceEE-eccCCCCCCeEEEEEEECCEEeeecccCC
Q 018603 116 -------Q---------------QDDSVLYKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKS 172 (353)
Q Consensus 116 -------~---------------~d~~~n~ks~LqE~~qk~~~~~P~Y~~-~~~Gp~H~~~F~~~V~I~G~~~~~G~G~S 172 (353)
. .+...||+++|+||||+++|..|.|++ .+.|++|.++|+++|.+.+.. ..|.|.|
T Consensus 115 k~~~~~~~~~~~~~~~~q~~d~~~~~~~NPI~~L~e~~q~k~~k~P~yelv~E~G~~~~rEFv~q~sv~~~~-~~GkG~s 193 (339)
T KOG3732|consen 115 KDSLKFAKMKSSGVKKDQPGDPEYGQVLNPIGRLQELAQAKKWKLPEYELVQESGVPHRREFVIQCSVENFT-EEGKGPS 193 (339)
T ss_pred cCcccccccccCCccccCCCCcccccccChHHHHHHHHHHhCCCCCceEEEeccCCCccceEEEEEEeccee-eecCCch
Confidence 0 013789999999999999999999997 689999999999999998866 5799999
Q ss_pred HHHHHHHHHHHHHHHhhCCCC
Q 018603 173 KKQAEMSAAKVAYMRLKEPNP 193 (353)
Q Consensus 173 KK~AKq~AA~~AL~~L~~~~~ 193 (353)
||.||++||..||+.|....+
T Consensus 194 KKiAKRnAAeamLe~l~~~~~ 214 (339)
T KOG3732|consen 194 KKIAKRNAAEAMLESLGFVKP 214 (339)
T ss_pred HHHHHHHHHHHHHHHhccCCC
Confidence 999999999999999997654
|
|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >PRK14718 ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >PRK00102 rnc ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >TIGR02191 RNaseIII ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >PRK14718 ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PRK00102 rnc ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >TIGR02191 RNaseIII ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1817 consensus Ribonuclease [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1817 consensus Ribonuclease [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] | Back alignment and domain information |
|---|
| >PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases | Back alignment and domain information |
|---|
| >PF14954 LIX1: Limb expression 1 | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases | Back alignment and domain information |
|---|
| >KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14954 LIX1: Limb expression 1 | Back alignment and domain information |
|---|
| >KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 353 | ||||
| 3adg_A | 73 | Structure Of Arabidopsis Hyl1 And Its Molecular Imp | 2e-10 | ||
| 2l2n_A | 103 | Backbone 1h, 13c, And 15n Chemical Shift Assignment | 4e-10 | ||
| 2l2n_A | 103 | Backbone 1h, 13c, And 15n Chemical Shift Assignment | 5e-04 | ||
| 2l2m_A | 77 | Solution Structure Of The Second Dsrbd Of Hyl1 Leng | 2e-07 | ||
| 3adj_A | 76 | Structure Of Arabidopsis Hyl1 And Its Molecular Imp | 3e-07 | ||
| 2l3j_A | 236 | The Solution Structure Of The Adar2 Dsrbm-Rna Compl | 3e-05 | ||
| 2l3c_A | 74 | Solution Structure Of Adar2 Dsrbm1 Bound To Lsl Rna | 1e-04 | ||
| 2b7t_A | 73 | Structure Of Adar2 Dsrbm1 Length = 73 | 2e-04 |
| >pdb|3ADG|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 73 | Back alignment and structure |
|
| >pdb|2L2N|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For The First Dsrbd Of Protein Hyl1 Length = 103 | Back alignment and structure |
| >pdb|2L2N|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For The First Dsrbd Of Protein Hyl1 Length = 103 | Back alignment and structure |
| >pdb|2L2M|A Chain A, Solution Structure Of The Second Dsrbd Of Hyl1 Length = 77 | Back alignment and structure |
| >pdb|3ADJ|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 76 | Back alignment and structure |
| >pdb|2L3J|A Chain A, The Solution Structure Of The Adar2 Dsrbm-Rna Complex Reveals A Sequence-Specific Read Out Of The Minor Groove Length = 236 | Back alignment and structure |
| >pdb|2L3C|A Chain A, Solution Structure Of Adar2 Dsrbm1 Bound To Lsl Rna Length = 74 | Back alignment and structure |
| >pdb|2B7T|A Chain A, Structure Of Adar2 Dsrbm1 Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 353 | |||
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 8e-44 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 1e-19 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 6e-13 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 3e-27 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 1e-18 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 5e-26 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 8e-23 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 1e-25 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 4e-23 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 6e-21 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 2e-18 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 5e-19 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 2e-11 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 7e-19 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 2e-12 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 4e-18 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 1e-12 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 1e-17 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 2e-11 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 3e-17 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 7e-11 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 4e-17 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 1e-12 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 4e-17 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 6e-12 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 1e-16 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 4e-12 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 1e-16 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 3e-11 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 3e-16 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 2e-11 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 8e-16 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 9e-12 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 9e-16 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 6e-11 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 2e-15 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 4e-09 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 2e-15 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 3e-15 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 4e-15 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 3e-10 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 1e-14 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 1e-08 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 2e-14 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 4e-09 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 1e-13 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 9e-11 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 1e-13 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 1e-09 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 2e-13 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 9e-11 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 2e-13 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 4e-06 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 3e-13 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 8e-10 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 3e-13 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 3e-10 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 5e-13 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 1e-07 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 5e-10 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 3e-09 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 4e-05 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 8e-10 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 2e-07 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 1e-04 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 3e-04 |
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
Score = 148 bits (375), Expect = 8e-44
Identities = 42/165 (25%), Positives = 76/165 (46%), Gaps = 16/165 (9%)
Query: 44 YKNQLQSYTQKKNLPLPMYSCEREGPPHASRFKCKVTIDGQTYESHQFFPTLKEAEHEAA 103
+ +L +Y QK+ + L GPPH RF +V IDG+ + + + KEA++ AA
Sbjct: 15 FMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGR-SKKEAKNAAA 73
Query: 104 KVALMSLS-------------LDKFQQDDSVLYKNVLQELAQKEAYALPVYNTKQSGESH 150
K+A+ L+ + + Y ++ +AQK+ + Y SG
Sbjct: 74 KLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVN-YEQCASGVHG 132
Query: 151 APTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRLK-EPNPS 194
F ++G + +S +K++A+ AAK+AY+++ E S
Sbjct: 133 PEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETGS 177
|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Length = 114 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Length = 114 | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Length = 756 | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 88 | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 88 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B Length = 117 | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 Length = 94 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.97 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 99.95 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.92 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 99.81 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 99.8 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 99.79 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 99.78 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 99.78 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 99.77 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 99.76 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 99.75 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 99.75 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 99.75 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 99.75 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 99.74 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 99.74 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 99.73 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 99.73 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 99.72 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 99.7 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 99.7 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 99.7 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 99.7 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 99.68 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 99.67 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 99.67 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.67 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 99.67 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 99.66 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 99.66 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 99.64 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 99.64 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 99.64 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 99.64 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 99.64 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 99.63 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 99.63 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 99.62 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 99.62 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 99.61 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 99.61 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 99.58 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 99.58 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 99.57 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 99.57 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 99.57 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 99.56 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 99.54 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 99.54 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 99.54 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 99.52 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 99.51 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 99.5 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 99.5 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 99.49 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 99.49 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 99.49 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 99.46 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 99.45 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 99.45 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 99.42 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 99.39 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 99.33 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 99.31 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.24 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 99.0 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 98.94 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 98.67 | |
| 2kou_A | 102 | Dicer-like protein 4; ATP-binding, endonuclease, h | 95.49 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 92.74 | |
| 2kou_A | 102 | Dicer-like protein 4; ATP-binding, endonuclease, h | 90.13 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 90.02 | |
| 2db2_A | 119 | KIAA0890 protein; DSRM domain, structural genomics | 80.14 |
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
Probab=99.97 E-value=6.6e-32 Score=242.13 Aligned_cols=150 Identities=27% Similarity=0.402 Sum_probs=134.9
Q ss_pred cCCCHHHHHHHHHHHcCCCCCeeee-eecCCCCCccEEEEEEEccEeeecccccCCcchhHHHHHHHHHHHhhcccCC--
Q 018603 40 MQHLYKNQLQSYTQKKNLPLPMYSC-EREGPPHASRFKCKVTIDGQTYESHQFFPTLKEAEHEAAKVALMSLSLDKFQ-- 116 (353)
Q Consensus 40 ~~~npKS~LqE~~QK~gl~~P~Y~l-~~~Gp~h~~~F~~~V~I~g~~~~ag~Gg~SKK~Akq~AAk~AL~~L~~~~~~-- 116 (353)
...|||+.||||||++++. |.|.+ .+.||+|.+.|++.|.|+|..++.|. |.+||+|+|.||+.||+.|......
T Consensus 11 ~~~n~ks~LqE~~q~~~~~-p~Y~~~~~~Gp~h~~~F~~~v~v~g~~~~~G~-G~sKK~Aeq~AA~~al~~L~~~~~~~~ 88 (179)
T 1qu6_A 11 SAGFFMEELNTYRQKQGVV-LKYQELPNSGPPHDRRFTFQVIIDGREFPEGE-GRSKKEAKNAAAKLAVEILNKEKKAVS 88 (179)
T ss_dssp SSCSHHHHHHHHHHHHTCC-CEEEEEESCBTTTBCCEEEEEESSSSCCCEEE-CCSSHHHHHHHHHHHHHHHHSCCSCCS
T ss_pred CCCCHHHHHHHHHHhCCCC-CeEEEeeccCCCCCCeEEEEEEECCEEEEecC-CCCHHHHHHHHHHHHHHHHhcccccCC
Confidence 4579999999999999987 89998 47899999999999999999898888 5999999999999999999864321
Q ss_pred -----------CCcchhHHHHHHHHHHHhcCCCCceEEeccCCCCCCeEEEEEEECCEEeeecccCCHHHHHHHHHHHHH
Q 018603 117 -----------QDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAY 185 (353)
Q Consensus 117 -----------~d~~~n~ks~LqE~~qk~~~~~P~Y~~~~~Gp~H~~~F~~~V~I~G~~~~~G~G~SKK~AKq~AA~~AL 185 (353)
.....||+++||||||++++.+ .|++.+.||+|.+.|+++|.|+|+.|+.|.|+|||+||+.||+.||
T Consensus 89 p~~~~~~~~~e~~~~~n~~~~L~E~~qk~~~~~-~Y~~~~~G~~h~~~F~~~v~v~~~~~~~g~g~sKK~Ak~~AA~~al 167 (179)
T 1qu6_A 89 PLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTV-NYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAY 167 (179)
T ss_dssp CSSCCCSCSSCCCCCCCCHHHHHHHHHHSCCEE-EEEEEEECSSSSSEEEEEEEEETTBCCEEEESSHHHHHHHHHHHHH
T ss_pred CccCCCCCcccccCCCCHHHHHHHHHHhcCCcc-eEEecCcCCCCCCeEEEEEEECCEEEeeEEECCHHHHHHHHHHHHH
Confidence 0135799999999999999986 9999889999999999999999999889999999999999999999
Q ss_pred HHhhCCC
Q 018603 186 MRLKEPN 192 (353)
Q Consensus 186 ~~L~~~~ 192 (353)
+.|....
T Consensus 168 ~~L~~~~ 174 (179)
T 1qu6_A 168 LQILSEE 174 (179)
T ss_dssp HHHHHCC
T ss_pred HHHhccc
Confidence 9997654
|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A | Back alignment and structure |
|---|
| >2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A | Back alignment and structure |
|---|
| >2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2db2_A KIAA0890 protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 353 | ||||
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 5e-16 | |
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 1e-14 | |
| d1x48a1 | 76 | d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p | 3e-15 | |
| d1x48a1 | 76 | d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p | 4e-14 | |
| d2dmya1 | 84 | d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin | 2e-14 | |
| d2dmya1 | 84 | d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin | 5e-11 | |
| d2nuga2 | 68 | d.50.1.1 (A:151-218) RNase III, C-terminal domain | 3e-14 | |
| d2nuga2 | 68 | d.50.1.1 (A:151-218) RNase III, C-terminal domain | 5e-12 | |
| d1whna_ | 128 | d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, | 1e-13 | |
| d1whna_ | 128 | d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, | 3e-13 | |
| d1qu6a1 | 90 | d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p | 5e-13 | |
| d1qu6a1 | 90 | d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p | 7e-12 | |
| d2b7va1 | 71 | d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R | 4e-12 | |
| d2b7va1 | 71 | d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R | 2e-09 | |
| d1x49a1 | 85 | d.50.1.1 (A:8-92) dsRNA-dependent protein kinase p | 9e-12 | |
| d1x49a1 | 85 | d.50.1.1 (A:8-92) dsRNA-dependent protein kinase p | 3e-11 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 1e-11 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 2e-11 | |
| d1ekza_ | 76 | d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros | 4e-11 | |
| d1ekza_ | 76 | d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros | 2e-08 | |
| d2b7ta1 | 73 | d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (R | 6e-11 | |
| d2b7ta1 | 73 | d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (R | 2e-10 | |
| d1di2a_ | 69 | d.50.1.1 (A:) Double-stranded RNA-binding protein | 2e-10 | |
| d1di2a_ | 69 | d.50.1.1 (A:) Double-stranded RNA-binding protein | 2e-10 | |
| d1uila_ | 113 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 4e-09 | |
| d1uila_ | 113 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 2e-08 | |
| d1whqa_ | 99 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 4e-09 | |
| d1whqa_ | 99 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 1e-07 | |
| d1t4oa_ | 81 | d.50.1.1 (A:) RNase III, C-terminal domain {Baker' | 4e-09 | |
| d1t4oa_ | 81 | d.50.1.1 (A:) RNase III, C-terminal domain {Baker' | 6e-08 | |
| d2cpna1 | 76 | d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu | 4e-09 | |
| d2cpna1 | 76 | d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu | 4e-07 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 5e-09 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 8e-09 | |
| d2dixa1 | 73 | d.50.1.1 (A:7-79) Interferon-inducible double stra | 4e-08 | |
| d2dixa1 | 73 | d.50.1.1 (A:7-79) Interferon-inducible double stra | 1e-06 | |
| d1uhza_ | 89 | d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul | 3e-07 | |
| d1uhza_ | 89 | d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul | 4e-05 |
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: dsRBD-like superfamily: dsRNA-binding domain-like family: Double-stranded RNA-binding domain (dsRBD) domain: RNase III, C-terminal domain species: Thermotoga maritima [TaxId: 2336]
Score = 69.5 bits (170), Expect = 5e-16
Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
Query: 123 YKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAA 181
YK LQE+ Q E P Y + FV V V G+ + ++KK+AE AA
Sbjct: 2 YKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAA 61
Query: 182 KVAYMRL 188
++AY +L
Sbjct: 62 RIAYEKL 68
|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 99.8 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.77 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 99.77 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 99.77 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 99.77 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.76 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 99.75 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.75 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 99.74 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.72 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.71 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 99.7 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.7 | |
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 99.67 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 99.64 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 99.62 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 99.6 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 99.6 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 99.6 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.59 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.59 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.59 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.58 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 99.57 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 99.56 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.56 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.54 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 99.54 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 99.53 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 99.51 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.5 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.49 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.38 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 99.34 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.18 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 99.18 |
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: dsRBD-like superfamily: dsRNA-binding domain-like family: Double-stranded RNA-binding domain (dsRBD) domain: RNase III, C-terminal domain species: Thermotoga maritima [TaxId: 2336]
Probab=99.80 E-value=5.1e-20 Score=138.51 Aligned_cols=67 Identities=34% Similarity=0.489 Sum_probs=64.6
Q ss_pred hHHHHHHHHHHHhcCCCCceEE-eccCCCCCCeEEEEEEECCEEeeecccCCHHHHHHHHHHHHHHHh
Q 018603 122 LYKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRL 188 (353)
Q Consensus 122 n~ks~LqE~~qk~~~~~P~Y~~-~~~Gp~H~~~F~~~V~I~G~~~~~G~G~SKK~AKq~AA~~AL~~L 188 (353)
|||+.||||||++++.+|.|++ ...||+|.+.|++.|.|+|+.++.|.|+|||+|||.||+.||+.|
T Consensus 1 d~Ks~LqE~~Qk~~~~~P~Y~~~~~~g~~h~~~F~~~v~v~~~~~~~g~g~sKK~Aeq~AA~~aL~~L 68 (69)
T d1o0wa2 1 DYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKL 68 (69)
T ss_dssp CHHHHHHHHHHHHHSSCCEEEEEEEECCTTSCEEEEEEEETTEEEEEEEESSHHHHHHHHHHHHHHHH
T ss_pred ChHHHHHHHHHHcCCCCCEEEEEEeeCCCCCceEEEEEEECCEEEEEEEeCCHHHHHHHHHHHHHHHh
Confidence 7999999999999999999997 678999999999999999999999999999999999999999987
|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|