Citrus Sinensis ID: 018622
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 353 | ||||||
| 194595409 | 527 | ADP-glucose pyrophosphorylase large subu | 0.994 | 0.666 | 0.988 | 0.0 | |
| 5917791 | 531 | ADP-glucose pyrophosphorylase large subu | 0.994 | 0.661 | 0.958 | 0.0 | |
| 255543725 | 531 | glucose-1-phosphate adenylyltransferase, | 0.994 | 0.661 | 0.849 | 0.0 | |
| 356545193 | 528 | PREDICTED: glucose-1-phosphate adenylylt | 0.994 | 0.664 | 0.843 | 1e-179 | |
| 356508352 | 519 | PREDICTED: glucose-1-phosphate adenylylt | 0.994 | 0.676 | 0.834 | 1e-178 | |
| 356538761 | 530 | PREDICTED: glucose-1-phosphate adenylylt | 0.994 | 0.662 | 0.831 | 1e-176 | |
| 356517038 | 519 | PREDICTED: glucose-1-phosphate adenylylt | 0.994 | 0.676 | 0.831 | 1e-176 | |
| 224080375 | 526 | predicted protein [Populus trichocarpa] | 0.994 | 0.667 | 0.834 | 1e-176 | |
| 224103389 | 527 | predicted protein [Populus trichocarpa] | 0.994 | 0.666 | 0.823 | 1e-175 | |
| 357473317 | 528 | Glucose-1-phosphate adenylyltransferase | 0.994 | 0.664 | 0.814 | 1e-174 |
| >gi|194595409|gb|ACF77017.1| ADP-glucose pyrophosphorylase large subunit [Citrus sinensis] | Back alignment and taxonomy information |
|---|
Score = 727 bits (1877), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 347/351 (98%), Positives = 349/351 (99%)
Query: 3 VLAATQTPGESGKNWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQS 62
VLAATQTPGESGKNWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQS
Sbjct: 177 VLAATQTPGESGKNWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQS 236
Query: 63 HVDRDADITISCAAVGESRASDYGLVKIDNMGRIAQFAEKPSGANLKAMQVDTSLLGFSP 122
HVDRDADITISCAAVGESRASDYGLVKIDNMGRIAQFAEKPSGANLKAMQVDTSLLGFSP
Sbjct: 237 HVDRDADITISCAAVGESRASDYGLVKIDNMGRIAQFAEKPSGANLKAMQVDTSLLGFSP 296
Query: 123 QEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIMEHDVQAYIFRDYWE 182
QEARKCPYVASMGVYVFKKDVL KLLRWRYPTSNDFGSEIIPAAIMEHDVQAYIFRDYWE
Sbjct: 297 QEARKCPYVASMGVYVFKKDVLLKLLRWRYPTSNDFGSEIIPAAIMEHDVQAYIFRDYWE 356
Query: 183 DIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLR 242
DIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCR+KDAIISHGCFLR
Sbjct: 357 DIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCRMKDAIISHGCFLR 416
Query: 243 ECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNC 302
ECTVEHSIVGERSR+DYGVELKDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNC
Sbjct: 417 ECTVEHSIVGERSRIDYGVELKDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNC 476
Query: 303 IIDKNVKIGKDVVIVNKDDVQEADRPELGFYIRSGITIIMEKATIEDGMVI 353
IIDKNVKIGKDVVIVNKD VQEADRPELGFYIRSGITIIMEKATIEDGMVI
Sbjct: 477 IIDKNVKIGKDVVIVNKDGVQEADRPELGFYIRSGITIIMEKATIEDGMVI 527
|
Source: Citrus sinensis Species: Citrus sinensis Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|5917791|gb|AAD56042.1|AF184598_1 ADP-glucose pyrophosphorylase large subunit [Citrus unshiu] | Back alignment and taxonomy information |
|---|
| >gi|255543725|ref|XP_002512925.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis] gi|223547936|gb|EEF49428.1| glucose-1-phosphate adenylyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356545193|ref|XP_003541029.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356508352|ref|XP_003522921.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356538761|ref|XP_003537869.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356517038|ref|XP_003527197.1| PREDICTED: glucose-1-phosphate adenylyltransferase large subunit 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224080375|ref|XP_002306116.1| predicted protein [Populus trichocarpa] gi|222849080|gb|EEE86627.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224103389|ref|XP_002313036.1| predicted protein [Populus trichocarpa] gi|222849444|gb|EEE86991.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357473317|ref|XP_003606943.1| Glucose-1-phosphate adenylyltransferase [Medicago truncatula] gi|355507998|gb|AES89140.1| Glucose-1-phosphate adenylyltransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 353 | ||||||
| TAIR|locus:2049364 | 523 | APL4 [Arabidopsis thaliana (ta | 0.994 | 0.671 | 0.763 | 1.1e-149 | |
| TAIR|locus:2136358 | 521 | APL3 [Arabidopsis thaliana (ta | 0.994 | 0.673 | 0.754 | 9e-148 | |
| TAIR|locus:2199241 | 518 | APL2 "ADPGLC-PPase large subun | 0.994 | 0.677 | 0.717 | 1.4e-142 | |
| TAIR|locus:2182132 | 522 | APL1 "ADP glucose pyrophosphor | 0.994 | 0.672 | 0.663 | 4e-129 | |
| TAIR|locus:2156263 | 520 | ADG1 "ADP glucose pyrophosphor | 0.980 | 0.665 | 0.509 | 8.4e-97 | |
| UNIPROTKB|P15280 | 514 | AGPS "Glucose-1-phosphate aden | 0.980 | 0.673 | 0.501 | 5.3e-95 | |
| TAIR|locus:2032003 | 476 | APS2 "AT1G05610" [Arabidopsis | 0.943 | 0.699 | 0.381 | 3.6e-57 | |
| TIGR_CMR|SO_1498 | 420 | SO_1498 "glucose-1-phosphate a | 0.838 | 0.704 | 0.341 | 9.2e-36 | |
| UNIPROTKB|Q9KLP4 | 407 | glgC2 "Glucose-1-phosphate ade | 0.756 | 0.656 | 0.313 | 1.8e-32 | |
| TIGR_CMR|VC_A0699 | 407 | VC_A0699 "glucose-1-phosphate | 0.756 | 0.656 | 0.313 | 1.8e-32 |
| TAIR|locus:2049364 APL4 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1461 (519.4 bits), Expect = 1.1e-149, P = 1.1e-149
Identities = 268/351 (76%), Positives = 311/351 (88%)
Query: 3 VLAATQTPGESGKNWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQS 62
VLAATQTPGE+GK WFQGTADAVR+F WVFEDAKNRNIEN+ IL GDHLYRM+YMDF+QS
Sbjct: 173 VLAATQTPGEAGKKWFQGTADAVRKFLWVFEDAKNRNIENILILSGDHLYRMNYMDFVQS 232
Query: 63 HVDRDADITISCAAVGESRASDYGLVKIDNMGRIAQFAEKPSGANLKAMQVDTSLLGFSP 122
HVD +ADIT+SCA V ESRAS++GLVKID GR+ F+EKP+G +LK+MQ DT++LG S
Sbjct: 233 HVDSNADITLSCAPVSESRASNFGLVKIDRGGRVIHFSEKPTGVDLKSMQTDTTMLGLSH 292
Query: 123 QEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIMEHDVQAYIFRDYWE 182
QEA PY+ASMGVY FK + L LL +YP+SNDFGSE+IPAAI +HDVQ YIFRDYWE
Sbjct: 293 QEATDSPYIASMGVYCFKTEALLNLLTRQYPSSNDFGSEVIPAAIRDHDVQGYIFRDYWE 352
Query: 183 DIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLR 242
DIGTIK+FYEAN+AL +E P F FYDP+TPFYTSPRFLPPTK + CR+ D+IISHGCFLR
Sbjct: 353 DIGTIKTFYEANLALVEERPKFEFYDPETPFYTSPRFLPPTKAEKCRMVDSIISHGCFLR 412
Query: 243 ECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNC 302
EC+V+ SI+GERSRLDYGVEL+DT+MLGADYYQTESEIASLLAEGKVPIG+G++TKIR C
Sbjct: 413 ECSVQRSIIGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKC 472
Query: 303 IIDKNVKIGKDVVIVNKDDVQEADRPELGFYIRSGITIIMEKATIEDGMVI 353
IIDKN KIGK+V+I+NK DVQEADRPE GFYIRSGIT+I+EKATI+DG VI
Sbjct: 473 IIDKNAKIGKNVIIMNKGDVQEADRPEEGFYIRSGITVIVEKATIQDGTVI 523
|
|
| TAIR|locus:2136358 APL3 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2199241 APL2 "ADPGLC-PPase large subunit" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2182132 APL1 "ADP glucose pyrophosphorylase large subunit 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156263 ADG1 "ADP glucose pyrophosphorylase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P15280 AGPS "Glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032003 APS2 "AT1G05610" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1498 SO_1498 "glucose-1-phosphate adenylyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KLP4 glgC2 "Glucose-1-phosphate adenylyltransferase 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_A0699 VC_A0699 "glucose-1-phosphate adenylyltransferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_IV001321 | glucose-1-phosphate adenylyltransferase (EC-2.7.7.27); This protein plays a role in synthesis of starch. It catalyzes the synthesis of the activated glycosyl donor, ADP- glucose from Glc-1-P and ATP (By similarity) (526 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.XV.361.1 | • | • | • | • | 0.958 | ||||||
| gw1.164.92.1 | • | • | • | • | 0.950 | ||||||
| gw1.XVII.1126.1 | • | • | • | • | 0.943 | ||||||
| estExt_fgenesh4_pg.C_LG_IX1158 | • | • | • | • | 0.932 | ||||||
| estExt_Genewise1_v1.C_LG_IV2986 | • | • | • | • | 0.930 | ||||||
| estExt_Genewise1_v1.C_LG_IV0101 | • | • | • | 0.914 | |||||||
| estExt_fgenesh4_pg.C_LG_XV1054 | • | • | 0.906 | ||||||||
| eugene3.00121193 | • | • | 0.905 | ||||||||
| estExt_fgenesh4_pm.C_LG_VIII0571 | • | • | 0.905 | ||||||||
| estExt_fgenesh4_pg.C_LG_X0989 | • | • | 0.905 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 353 | |||
| PLN02241 | 436 | PLN02241, PLN02241, glucose-1-phosphate adenylyltr | 0.0 | |
| PRK02862 | 429 | PRK02862, glgC, glucose-1-phosphate adenylyltransf | 0.0 | |
| TIGR02091 | 361 | TIGR02091, glgC, glucose-1-phosphate adenylyltrans | 1e-123 | |
| COG0448 | 393 | COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb | 2e-92 | |
| PRK00725 | 425 | PRK00725, glgC, glucose-1-phosphate adenylyltransf | 3e-68 | |
| PRK00844 | 407 | PRK00844, glgC, glucose-1-phosphate adenylyltransf | 3e-68 | |
| PRK05293 | 380 | PRK05293, glgC, glucose-1-phosphate adenylyltransf | 6e-65 | |
| pfam00483 | 247 | pfam00483, NTP_transferase, Nucleotidyl transferas | 3e-54 | |
| cd04651 | 104 | cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly | 3e-29 | |
| COG1208 | 358 | COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph | 4e-26 | |
| cd04181 | 217 | cd04181, NTP_transferase, NTP_transferases catalyz | 2e-22 | |
| TIGR02092 | 369 | TIGR02092, glgD, glucose-1-phosphate adenylyltrans | 7e-21 | |
| cd02508 | 200 | cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory | 2e-17 | |
| cd06915 | 223 | cd06915, NTP_transferase_WcbM_like, WcbM_like is a | 5e-10 | |
| cd06426 | 220 | cd06426, NTP_transferase_like_2, NTP_trnasferase_l | 6e-07 | |
| cd04189 | 236 | cd04189, G1P_TT_long, G1P_TT_long represents the l | 9e-06 | |
| cd05787 | 79 | cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit | 1e-05 | |
| TIGR01173 | 451 | TIGR01173, glmU, UDP-N-acetylglucosamine diphospho | 3e-05 | |
| cd06425 | 233 | cd06425, M1P_guanylylT_B_like_N, N-terminal domain | 9e-05 | |
| cd02540 | 229 | cd02540, GT2_GlmU_N_bac, N-terminal domain of bact | 2e-04 | |
| cd02541 | 267 | cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca | 3e-04 | |
| COG1207 | 460 | COG1207, GlmU, N-acetylglucosamine-1-phosphate uri | 4e-04 | |
| COG1209 | 286 | COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel | 4e-04 | |
| TIGR03992 | 393 | TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph | 6e-04 |
| >gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
Score = 678 bits (1752), Expect = 0.0
Identities = 258/352 (73%), Positives = 302/352 (85%), Gaps = 3/352 (0%)
Query: 3 VLAATQTPGESGKNWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQS 62
VLAATQTPGE G WFQGTADAVRQF W+FEDAKN+N+E V IL GDHLYRMDYMDF+Q
Sbjct: 87 VLAATQTPGEKG--WFQGTADAVRQFLWLFEDAKNKNVEEVLILSGDHLYRMDYMDFVQK 144
Query: 63 HVDRDADITISCAAVGESRASDYGLVKIDNMGRIAQFAEKPSGANLKAMQVDTSLLGFSP 122
H + ADITI+C V ESRASD+GL+KID+ GRI +F+EKP G LKAMQVDT++LG SP
Sbjct: 145 HRESGADITIACLPVDESRASDFGLMKIDDTGRIIEFSEKPKGDELKAMQVDTTVLGLSP 204
Query: 123 QEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME-HDVQAYIFRDYW 181
+EA++ PY+ASMG+YVFKKDVL KLLRWR+PT+NDFGSEIIP AI E ++VQAY+F YW
Sbjct: 205 EEAKEKPYIASMGIYVFKKDVLLKLLRWRFPTANDFGSEIIPGAIKEGYNVQAYLFDGYW 264
Query: 182 EDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFL 241
EDIGTIKSFYEAN+ALTK+ P F FYDP P YTSPRFLPP+KI++CRI D+IISHGCFL
Sbjct: 265 EDIGTIKSFYEANLALTKQPPKFSFYDPDAPIYTSPRFLPPSKIEDCRITDSIISHGCFL 324
Query: 242 RECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRN 301
REC +EHS+VG RSR+ GVE++DTVM+GADYY+TE EIASLLAEGKVPIG+G NTKIRN
Sbjct: 325 RECKIEHSVVGLRSRIGEGVEIEDTVMMGADYYETEEEIASLLAEGKVPIGIGENTKIRN 384
Query: 302 CIIDKNVKIGKDVVIVNKDDVQEADRPELGFYIRSGITIIMEKATIEDGMVI 353
IIDKN +IGK+VVI+NKD VQEADR E G+YIRSGI +I++ A I DG VI
Sbjct: 385 AIIDKNARIGKNVVIINKDGVQEADREEEGYYIRSGIVVILKNAVIPDGTVI 436
|
Length = 436 |
| >gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >gnl|CDD|233721 TIGR02092, glgD, glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch | Back alignment and domain information |
|---|
| >gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose | Back alignment and domain information |
|---|
| >gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 100.0 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 100.0 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 100.0 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 100.0 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 100.0 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 100.0 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 100.0 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 100.0 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 100.0 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 100.0 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 100.0 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 99.98 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.98 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.98 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.97 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.97 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.96 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.94 | |
| cd06428 | 257 | M1P_guanylylT_A_like_N N-terminal domain of M1P_gu | 99.92 | |
| COG1209 | 286 | RfbA dTDP-glucose pyrophosphorylase [Cell envelope | 99.92 | |
| cd06425 | 233 | M1P_guanylylT_B_like_N N-terminal domain of the M1 | 99.9 | |
| TIGR01105 | 297 | galF UTP-glucose-1-phosphate uridylyltransferase, | 99.9 | |
| PF00483 | 248 | NTP_transferase: Nucleotidyl transferase This Pros | 99.9 | |
| TIGR02623 | 254 | G1P_cyt_trans glucose-1-phosphate cytidylyltransfe | 99.89 | |
| PRK10122 | 297 | GalU regulator GalF; Provisional | 99.89 | |
| PRK13389 | 302 | UTP--glucose-1-phosphate uridylyltransferase subun | 99.89 | |
| TIGR01207 | 286 | rmlA glucose-1-phosphate thymidylyltransferase, sh | 99.87 | |
| cd02538 | 240 | G1P_TT_short G1P_TT_short is the short form of glu | 99.87 | |
| PRK15480 | 292 | glucose-1-phosphate thymidylyltransferase RfbA; Pr | 99.86 | |
| cd02541 | 267 | UGPase_prokaryotic Prokaryotic UGPase catalyses th | 99.86 | |
| cd02524 | 253 | G1P_cytidylyltransferase G1P_cytidylyltransferase | 99.85 | |
| TIGR01099 | 260 | galU UTP-glucose-1-phosphate uridylyltransferase. | 99.84 | |
| cd04189 | 236 | G1P_TT_long G1P_TT_long represents the long form o | 99.81 | |
| cd06422 | 221 | NTP_transferase_like_1 NTP_transferase_like_1 is a | 99.81 | |
| cd06915 | 223 | NTP_transferase_WcbM_like WcbM_like is a subfamily | 99.8 | |
| COG1210 | 291 | GalU UDP-glucose pyrophosphorylase [Cell envelope | 99.79 | |
| cd04181 | 217 | NTP_transferase NTP_transferases catalyze the tran | 99.79 | |
| cd06426 | 220 | NTP_transferase_like_2 NTP_trnasferase_like_2 is a | 99.77 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.7 | |
| cd04183 | 231 | GT2_BcE_like GT2_BcbE_like is likely involved in t | 99.69 | |
| cd02509 | 274 | GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf | 99.62 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.62 | |
| cd02523 | 229 | PC_cytidylyltransferase Phosphocholine cytidylyltr | 99.58 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.57 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.57 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 99.56 | |
| cd04197 | 217 | eIF-2B_epsilon_N The N-terminal domain of epsilon | 99.56 | |
| cd02508 | 200 | ADP_Glucose_PP ADP-glucose pyrophosphorylase is in | 99.54 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.53 | |
| PRK05450 | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 99.51 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.5 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.49 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.49 | |
| cd02517 | 239 | CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th | 99.49 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.48 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.47 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.47 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.46 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.46 | |
| cd02540 | 229 | GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | 99.46 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.46 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.43 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.42 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.42 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.41 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.4 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.39 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.37 | |
| PLN02296 | 269 | carbonate dehydratase | 99.36 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.36 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.36 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.36 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.35 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.35 | |
| PRK13368 | 238 | 3-deoxy-manno-octulosonate cytidylyltransferase; P | 99.35 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.34 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.34 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.34 | |
| cd02507 | 216 | eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma | 99.33 | |
| PLN02472 | 246 | uncharacterized protein | 99.31 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.31 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.3 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.29 | |
| COG0836 | 333 | {ManC} Mannose-1-phosphate guanylyltransferase [Ce | 99.29 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.29 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.29 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.29 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.26 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.26 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.26 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.25 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.25 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.25 | |
| cd04198 | 214 | eIF-2B_gamma_N The N-terminal domain of gamma subu | 99.24 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.24 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.22 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 99.19 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.19 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.19 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.18 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.16 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.16 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.16 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.16 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.15 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.15 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.15 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.15 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.14 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.13 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.13 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.13 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.12 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.11 | |
| PLN02296 | 269 | carbonate dehydratase | 99.1 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.09 | |
| PLN02472 | 246 | uncharacterized protein | 99.08 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.08 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.06 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.06 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.05 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.04 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.04 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.03 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 99.03 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.03 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.03 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.03 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 98.99 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 98.95 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 98.93 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 98.93 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 98.91 | |
| PLN02694 | 294 | serine O-acetyltransferase | 98.89 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 98.88 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 98.88 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 98.86 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.85 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 98.82 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 98.78 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 98.77 | |
| PLN02917 | 293 | CMP-KDO synthetase | 98.76 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 98.75 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 98.75 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 98.73 | |
| PLN02357 | 360 | serine acetyltransferase | 98.72 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.72 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 98.72 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 98.71 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 98.71 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 98.7 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.68 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 98.67 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 98.66 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 98.66 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 98.65 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 98.64 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 98.63 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 98.63 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.62 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 98.62 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.62 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 98.61 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 98.59 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.57 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.57 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.56 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.56 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 98.54 | |
| PLN02739 | 355 | serine acetyltransferase | 98.54 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 98.52 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 98.51 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 98.5 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 98.5 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 98.45 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 98.45 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 98.45 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 98.45 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 98.45 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 98.44 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 98.43 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 98.42 | |
| PLN02357 | 360 | serine acetyltransferase | 98.41 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.39 | |
| PLN02694 | 294 | serine O-acetyltransferase | 98.37 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 98.37 | |
| PLN02739 | 355 | serine acetyltransferase | 98.35 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 98.3 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 98.27 | |
| PRK13412 | 974 | fkp bifunctional fucokinase/L-fucose-1-P-guanylylt | 98.26 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.22 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.14 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.14 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 98.13 | |
| COG1213 | 239 | Predicted sugar nucleotidyltransferases [Cell enve | 98.1 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 98.07 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.05 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 97.96 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 97.88 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 97.81 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 97.73 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 97.72 | |
| cd02513 | 223 | CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- | 97.68 | |
| TIGR00453 | 217 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 97.32 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.31 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 97.3 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.29 | |
| TIGR00466 | 238 | kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe | 97.28 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 97.2 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 96.98 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 96.96 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 96.92 | |
| PRK00155 | 227 | ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl | 96.91 | |
| cd02516 | 218 | CDP-ME_synthetase CDP-ME synthetase is involved in | 96.79 | |
| TIGR03584 | 222 | PseF pseudaminic acid CMP-transferase. The sequenc | 96.76 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 96.7 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 96.64 | |
| COG1212 | 247 | KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase | 96.2 | |
| PRK09382 | 378 | ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp | 96.19 | |
| PRK13385 | 230 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 94.95 | |
| TIGR03310 | 188 | matur_ygfJ molybdenum hydroxylase accessory protei | 94.24 | |
| PLN02474 | 469 | UTP--glucose-1-phosphate uridylyltransferase | 93.93 | |
| PF12804 | 160 | NTP_transf_3: MobA-like NTP transferase domain; PD | 92.17 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 91.99 | |
| PRK00317 | 193 | mobA molybdopterin-guanine dinucleotide biosynthes | 90.99 | |
| PRK02726 | 200 | molybdopterin-guanine dinucleotide biosynthesis pr | 85.93 | |
| cd04182 | 186 | GT_2_like_f GT_2_like_f is a subfamily of the glyc | 84.66 | |
| COG1083 | 228 | NeuA CMP-N-acetylneuraminic acid synthetase [Cell | 84.37 |
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-54 Score=395.51 Aligned_cols=304 Identities=37% Similarity=0.682 Sum_probs=271.2
Q ss_pred CeeecCcccCCCCCCccccccHHHHHHHHHHhhhhccCCCCeEEEEeCCeEEecCHHHHHHHHHHCCCcEEEEEEEeCCC
Q 018622 1 MFVLAATQTPGESGKNWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQSHVDRDADITISCAAVGES 80 (353)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~lGT~~al~~a~~~i~~~~~~~~~~flV~~gD~i~~~dl~~~~~~h~~~~a~~tll~~~~~~~ 80 (353)
++|+||+++. .++.|+.|||+|++|...++.+ .+.+++++++||+++++|+++|+++|.++++++|+++.+++.+
T Consensus 85 v~ilp~~~~~--~~~~wy~Gtadai~Qnl~~i~~---~~~eyvlIlsgDhIYkmDy~~ml~~H~~~gadiTv~~~~Vp~~ 159 (393)
T COG0448 85 VFILPAQQRE--GGERWYEGTADAIYQNLLIIRR---SDPEYVLILSGDHIYKMDYSDMLDFHIESGADVTVAVKEVPRE 159 (393)
T ss_pred EEEeCchhcc--CCCcceeccHHHHHHhHHHHHh---cCCCEEEEecCCEEEecCHHHHHHHHHHcCCCEEEEEEECChH
Confidence 4899999992 3557999999999999999984 6789999999999999999999999999999999999999988
Q ss_pred CCCcceEEEECCCCCeeEEEeCCCccccccccccccccCCCccccccCCcccceeeEEecHHHHHHHHHhhCC---CCCc
Q 018622 81 RASDYGLVKIDNMGRIAQFAEKPSGANLKAMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYP---TSND 157 (353)
Q Consensus 81 ~~~~~g~v~~d~~g~V~~~~ekp~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Giyi~~~~vl~~~l~~~~~---~~~~ 157 (353)
++++||++.+|++|+|+.|.|||..... ...++++|+|+|++++|.++|++... +..|
T Consensus 160 eas~fGim~~D~~~~i~~F~eKp~~~~~-------------------~~~laSMgiYIf~~~~L~~~L~~~~~~~~~~~D 220 (393)
T COG0448 160 EASRFGVMNVDENGRIIEFVEKPADGPP-------------------SNSLASMGIYIFNTDLLKELLEEDAKDPNSSHD 220 (393)
T ss_pred hhhhcCceEECCCCCEEeeeeccCcCCc-------------------ccceeeeeeEEEcHHHHHHHHHHHhcccCcccc
Confidence 8899999999999999999999987221 12389999999999999988886542 3468
Q ss_pred hhhhhhhhhhhcCcEEEEEecceEeEcCCHHHHHHHHHhhccCCCcccccCCCCceecCCCCCCCeEEec-eeeeceEEC
Q 018622 158 FGSEIIPAAIMEHDVQAYIFRDYWEDIGTIKSFYEANMALTKESPAFHFYDPKTPFYTSPRFLPPTKIDN-CRIKDAIIS 236 (353)
Q Consensus 158 ~~~d~l~~l~~~~~i~~~~~~g~w~dIgtp~~y~~a~~~ll~~~~~~~~~~~~~~i~~~~~i~~~~~i~~-~~i~~~~ig 236 (353)
|.++++|.+++++++++|+++|||.||||.++|++||++|++..+.+.+++++|+|++.....||+++.. +.+.+|.|+
T Consensus 221 fgkdiIp~~~~~~~v~AY~f~gYw~dVgTi~syy~aNmdLl~~~~~~~lyd~~w~IyT~~~~~pPak~~~~s~v~nSLv~ 300 (393)
T COG0448 221 FGKDIIPKLLERGKVYAYEFSGYWRDVGTIDSYYEANMDLLSPQPELNLYDRNWPIYTKNKNLPPAKFVNDSEVSNSLVA 300 (393)
T ss_pred chHHHHHHHHhcCCEEEEeccchhhhcccHHHHHHhhHHhcCCCCcccccCCCCceeecCCCCCCceEecCceEeeeeee
Confidence 9999999999999999999999999999999999999999997778889999999999999999999975 888999999
Q ss_pred CCcEECceEEeeeEEcCCcEECCCCEEeceEEECCccccchhHHHHhhcCCCcceEeCCCeEEcceEeCCCCEECCCeEE
Q 018622 237 HGCFLRECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVI 316 (353)
Q Consensus 237 ~~~~i~~~~v~~~~ig~~~~ig~~~~i~~~v~~~~~~~~~~~~~~~~~~~~~~~~~ig~~~~i~~~iig~~~~Ig~~~~i 316 (353)
.||+|.+ +|.||+|+++++|+++|.|++|+++++ +.||++|+|++|||+++|.|++|++|
T Consensus 301 ~GciI~G-~V~nSVL~~~v~I~~gs~i~~svim~~-------------------~~IG~~~~l~~aIIDk~v~I~~g~~i 360 (393)
T COG0448 301 GGCIISG-TVENSVLFRGVRIGKGSVIENSVIMPD-------------------VEIGEGAVLRRAIIDKNVVIGEGVVI 360 (393)
T ss_pred CCeEEEe-EEEeeEEecCeEECCCCEEEeeEEeCC-------------------cEECCCCEEEEEEeCCCcEeCCCcEE
Confidence 9999996 999999999999999999999999999 89999999999999999999999999
Q ss_pred ccCCCcccccCCCCceEEccCeEEecCCcEECCCcc
Q 018622 317 VNKDDVQEADRPELGFYIRSGITIIMEKATIEDGMV 352 (353)
Q Consensus 317 ~~~~~~~~~~~~~~~~~i~~~~~vig~~~~i~~g~v 352 (353)
++.. ++..+.. ..+. +++.+|++++.++.+..
T Consensus 361 ~~~~--~~~d~~~-~~~~-~~ivVv~k~~~~~~~~~ 392 (393)
T COG0448 361 GGDK--PEEDRKR-FRSE-EGIVVVPKGMVIKLDIM 392 (393)
T ss_pred cCCc--chhcccc-cccc-CCcEEEecccEeccccc
Confidence 9874 2222222 3444 77788899998877653
|
|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins | Back alignment and domain information |
|---|
| >TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit | Back alignment and domain information |
|---|
| >PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry | Back alignment and domain information |
|---|
| >TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >PRK10122 GalU regulator GalF; Provisional | Back alignment and domain information |
|---|
| >PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional | Back alignment and domain information |
|---|
| >TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form | Back alignment and domain information |
|---|
| >cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional | Back alignment and domain information |
|---|
| >cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose | Back alignment and domain information |
|---|
| >cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose | Back alignment and domain information |
|---|
| >TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase | Back alignment and domain information |
|---|
| >cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases | Back alignment and domain information |
|---|
| >COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars | Back alignment and domain information |
|---|
| >cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule | Back alignment and domain information |
|---|
| >cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PLN02917 CMP-KDO synthetase | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety | Back alignment and domain information |
|---|
| >TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production | Back alignment and domain information |
|---|
| >TIGR03584 PseF pseudaminic acid CMP-transferase | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional | Back alignment and domain information |
|---|
| >PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family | Back alignment and domain information |
|---|
| >PLN02474 UTP--glucose-1-phosphate uridylyltransferase | Back alignment and domain information |
|---|
| >PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed | Back alignment and domain information |
|---|
| >PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional | Back alignment and domain information |
|---|
| >cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function | Back alignment and domain information |
|---|
| >COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 353 | ||||
| 1yp2_A | 451 | Crystal Structure Of Potato Tuber Adp-Glucose Pyrop | 1e-105 | ||
| 3brk_X | 420 | Crystal Structure Of Adp-Glucose Pyrophosphorylase | 6e-29 |
| >pdb|1YP2|A Chain A, Crystal Structure Of Potato Tuber Adp-Glucose Pyrophosphorylase Length = 451 | Back alignment and structure |
|
| >pdb|3BRK|X Chain X, Crystal Structure Of Adp-Glucose Pyrophosphorylase From Agrobacterium Tumefaciens Length = 420 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 353 | |||
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 0.0 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 1e-137 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 1e-13 | |
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 2e-11 | |
| 1jyk_A | 254 | LICC protein, CTP:phosphocholine cytidylytransfera | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 6e-05 |
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 | Back alignment and structure |
|---|
Score = 513 bits (1324), Expect = 0.0
Identities = 176/353 (49%), Positives = 251/353 (71%), Gaps = 7/353 (1%)
Query: 3 VLAATQTPGESGKNWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQS 62
VLAA Q+P +WFQGTADAVRQ+ W+FE+ + IL GDHLYRMDY FIQ+
Sbjct: 104 VLAAQQSP--ENPDWFQGTADAVRQYLWLFEE---HTVLEYLILAGDHLYRMDYEKFIQA 158
Query: 63 HVDRDADITISCAAVGESRASDYGLVKIDNMGRIAQFAEKPSGANLKAMQVDTSLLGFSP 122
H + DADIT++ + E RA+ +GL+KID GRI +FAEKP G L+AM+VDT++LG
Sbjct: 159 HRETDADITVAALPMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDD 218
Query: 123 QEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAI-MEHDVQAYIFRDYW 181
+ A++ P++ASMG+YV KDV+ LLR ++P +NDFGSE+IP A + VQAY++ YW
Sbjct: 219 KRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSLGMRVQAYLYDGYW 278
Query: 182 EDIGTIKSFYEANMALTK-ESPAFHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCF 240
EDIGTI++FY AN+ +TK P F FYD P YT PR+LPP+K+ + + D++I GC
Sbjct: 279 EDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCV 338
Query: 241 LRECTVEHSIVGERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIR 300
++ C + HS+VG RS + G ++D++++GADYY+T+++ L A+G VPIG+G+N I+
Sbjct: 339 IKNCKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIK 398
Query: 301 NCIIDKNVKIGKDVVIVNKDDVQEADRPELGFYIRSGITIIMEKATIEDGMVI 353
IIDKN +IG +V I+NKD+VQEA R G++I+SGI +++ A I G++I
Sbjct: 399 RAIIDKNARIGDNVKIINKDNVQEAARETDGYFIKSGIVTVIKDALIPSGIII 451
|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 | Back alignment and structure |
|---|
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 | Back alignment and structure |
|---|
| >1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 100.0 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 100.0 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 100.0 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 100.0 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 100.0 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.97 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.97 | |
| 3juk_A | 281 | UDP-glucose pyrophosphorylase (GALU); transfer; HE | 99.87 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.87 | |
| 3pnn_A | 303 | Conserved domain protein; structural genomics, PSI | 99.84 | |
| 4ecm_A | 269 | Glucose-1-phosphate thymidylyltransferase; HET: DA | 99.83 | |
| 2e3d_A | 302 | UTP--glucose-1-phosphate uridylyltransferase; UDP- | 99.8 | |
| 1tzf_A | 259 | Glucose-1-phosphate cytidylyltransferase; nucleoti | 99.79 | |
| 2ux8_A | 297 | Glucose-1-phosphate uridylyltransferase; UGPG, GAL | 99.78 | |
| 2pa4_A | 323 | UTP-glucose-1-phosphate uridylyltransferase; phosp | 99.76 | |
| 4evw_A | 255 | Nucleoside-diphosphate-sugar pyrophosphorylase; st | 99.74 | |
| 1fxo_A | 293 | Glucose-1-phosphate thymidylyltransferase; rhamnos | 99.73 | |
| 1lvw_A | 295 | Glucose-1-phosphate thymidylyltransferase; protein | 99.71 | |
| 2qh5_A | 308 | PMI, ALGA, mannose-6-phosphate isomerase; structur | 99.7 | |
| 1mc3_A | 296 | Glucose-1-phosphate thymidylyltransferase; glucose | 99.7 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.67 | |
| 2x65_A | 336 | Mannose-1-phosphate guanylyltransferase; nucleotid | 99.64 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.58 | |
| 2cu2_A | 337 | Putative mannose-1-phosphate guanylyl transferase; | 99.58 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.57 | |
| 3oam_A | 252 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 99.57 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.55 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.55 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.54 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.54 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.54 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.53 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.51 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.51 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.5 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.49 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.48 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.47 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.46 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.46 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.45 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.45 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.44 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.44 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.43 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.43 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.42 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.4 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.4 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.39 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.38 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.37 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.36 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.36 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.35 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.35 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.35 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.34 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.34 | |
| 3k8d_A | 264 | 3-deoxy-manno-octulosonate cytidylyltransferase; K | 99.33 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.33 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.32 | |
| 3tqd_A | 256 | 3-deoxy-manno-octulosonate cytidylyltransferase; c | 99.32 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.31 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.31 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.31 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.31 | |
| 1jyk_A | 254 | LICC protein, CTP:phosphocholine cytidylytransfera | 99.31 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.3 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.28 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.28 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.27 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.27 | |
| 2y6p_A | 234 | 3-deoxy-manno-octulosonate cytidylyltransferase; l | 99.26 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.26 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.26 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.24 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.24 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.23 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.22 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.21 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.19 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.16 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.14 | |
| 4fcu_A | 253 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 99.14 | |
| 1vic_A | 262 | 3-deoxy-manno-octulosonate cytidylyltransferase; s | 99.14 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.13 | |
| 2icy_A | 469 | Probable UTP-glucose-1-phosphate uridylyltransfera | 99.12 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.12 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.11 | |
| 1h7e_A | 245 | 3-deoxy-manno-octulosonate cytidylyltransferase; n | 99.09 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.09 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.07 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.06 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.05 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.05 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.05 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.04 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.04 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.04 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.03 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.01 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 98.99 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 98.98 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 98.96 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 98.96 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 98.93 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 98.93 | |
| 2xme_A | 232 | CTP-inositol-1-phosphate cytidylyltransferase; CDP | 98.92 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 98.9 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 98.89 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 98.88 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 98.88 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 98.85 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 98.83 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 98.83 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 98.8 | |
| 2dpw_A | 232 | Hypothetical protein TTHA0179; transferase, struct | 98.79 | |
| 2i5k_A | 488 | UTP--glucose-1-phosphate uridylyltransferase; LEFT | 98.77 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 98.76 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 98.75 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 98.75 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 98.72 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 98.72 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 98.71 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 98.7 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 98.7 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 98.7 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 98.68 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 98.67 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 98.6 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 98.58 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 98.51 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.5 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 98.49 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 98.47 | |
| 2vsh_A | 236 | TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly | 98.46 | |
| 2xwl_A | 223 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 98.43 | |
| 1ezi_A | 228 | CMP-N-acetylneuraminic acid synthetase; homodimer, | 98.41 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.37 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 98.35 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.34 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 98.26 | |
| 1jv1_A | 505 | Glcnac1P uridyltransferase isoform 1: AGX1; nucleo | 98.25 | |
| 3f1c_A | 246 | Putative 2-C-methyl-D-erythritol 4-phosphate cytid | 98.22 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.22 | |
| 1qwj_A | 229 | Cytidine monophospho-N-acetylneuraminic acid synth | 98.18 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 98.13 | |
| 1vgw_A | 231 | 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; | 98.07 | |
| 2yc3_A | 228 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran | 98.01 | |
| 2px7_A | 236 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans | 97.83 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 97.81 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 97.6 | |
| 2oeg_A | 505 | UTP-glucose-1-phosphate uridylyltransferase 2, put | 97.37 | |
| 1i52_A | 236 | 4-diphosphocytidyl-2-C-methylerythritol synthase; | 97.25 | |
| 3oc9_A | 405 | UDP-N-acetylglucosamine pyrophosphorylase; structu | 97.18 | |
| 2wee_A | 197 | MOBA-related protein; unknown function; 1.65A {Myc | 97.03 | |
| 2waw_A | 199 | MOBA relate protein; unknown function; HET: PGE; 1 | 96.99 | |
| 1vpa_A | 234 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; | 96.95 | |
| 3q80_A | 231 | 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; | 96.79 | |
| 2e8b_A | 201 | Probable molybdopterin-guanine dinucleotide biosy | 96.74 | |
| 3d5n_A | 197 | Q97W15_sulso; NESG, SSR125, structural genomics, P | 96.3 | |
| 2yqc_A | 486 | UDP-N-acetylglucosamine pyrophosphorylase; uridine | 96.06 | |
| 1e5k_A | 201 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.21 | |
| 3rsb_A | 196 | Adenosylcobinamide-phosphate guanylyltransferase; | 94.88 | |
| 1w55_A | 371 | ISPD/ISPF bifunctional enzyme; biosynthetic pathwa | 90.51 | |
| 3ngw_A | 208 | Molybdopterin-guanine dinucleotide biosynthesis P | 88.56 | |
| 3gue_A | 484 | UTP-glucose-1-phosphate uridylyltransferase 2; pho | 83.04 | |
| 3r3i_A | 528 | UTP--glucose-1-phosphate uridylyltransferase; ross | 82.05 |
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=7.1e-45 Score=355.23 Aligned_cols=336 Identities=51% Similarity=0.978 Sum_probs=275.5
Q ss_pred CccccccHHHHHHHHHHhhhhccCCCCeEEEEeCCeEEecCHHHHHHHHHHCCCcEEEEEEEeCCCCCCcceEEEECCCC
Q 018622 15 KNWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQSHVDRDADITISCAAVGESRASDYGLVKIDNMG 94 (353)
Q Consensus 15 ~~~~lGT~~al~~a~~~i~~~~~~~~~~flV~~gD~i~~~dl~~~~~~h~~~~a~~tll~~~~~~~~~~~~g~v~~d~~g 94 (353)
++|++||+++|+.++.++++ ..+++|+|++||++++.+|.+++++|+++++++|+++.+.+.+.+.+||++.+|+++
T Consensus 114 ~~~~~Gt~~al~~a~~~~~~---~~~~~~lv~~~D~~~~~~l~~l~~~~~~~~~~~tl~~~~~~~~~~~~~g~v~~d~~~ 190 (451)
T 1yp2_A 114 PDWFQGTADAVRQYLWLFEE---HTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRATAFGLMKIDEEG 190 (451)
T ss_dssp CCCCCSHHHHHHHTHHHHTT---SCCSEEEEECSCEECCCCHHHHHHHHHHTTCSEEEEEEEECHHHHTTSEEEEECTTS
T ss_pred cccccCcHHHHHHHHHHHHh---cCCCeEEEecCcEEEcCCHHHHHHHHHHcCCcEEEEEEEcChhhcccCCEEEECCCC
Confidence 46789999999999999862 234789999999999999999999999999999999888752225789999999889
Q ss_pred CeeEEEeCCCccccccccccccccCCCccccccCCcccceeeEEecHHHHHHHHHhhCCCCCchhhhhhhhhhhc-CcEE
Q 018622 95 RIAQFAEKPSGANLKAMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME-HDVQ 173 (353)
Q Consensus 95 ~V~~~~ekp~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Giyi~~~~vl~~~l~~~~~~~~~~~~d~l~~l~~~-~~i~ 173 (353)
+|+.|.|||..+...++.++.+++..++...+..++++++|+|+|++++|..++++..+...++.+++|+.++++ .++.
T Consensus 191 ~v~~~~ekp~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Giy~~~~~~l~~~l~~~~~~~~~~~~~~l~~~i~~g~~v~ 270 (451)
T 1yp2_A 191 RIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEVIPGATSLGMRVQ 270 (451)
T ss_dssp BEEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHHHHHHTTCTTCCCTTTTHHHHHHHTTCCEE
T ss_pred CEEEEEECCCchhhccccccccccccccccccCCcceEEeeEEEEcHHHHHHHHHhhcccccchHhhHHHHHHhcCCceE
Confidence 999999999865433333333333322211111246899999999999987677654334456677899998887 7999
Q ss_pred EEEecceEeEcCCHHHHHHHHHhhccCC-CcccccCCCCceecCCCCCCCeEEeceeeeceEECCCcEECceEEeeeEEc
Q 018622 174 AYIFRDYWEDIGTIKSFYEANMALTKES-PAFHFYDPKTPFYTSPRFLPPTKIDNCRIKDAIISHGCFLRECTVEHSIVG 252 (353)
Q Consensus 174 ~~~~~g~w~dIgtp~~y~~a~~~ll~~~-~~~~~~~~~~~i~~~~~i~~~~~i~~~~i~~~~ig~~~~i~~~~v~~~~ig 252 (353)
+|.++++|.|+|||++|++++++++.+. +...++++.+.+++++.++++++|.++.|.++.||++|+|+++.+.+++||
T Consensus 271 ~~~~~~~w~digt~~~l~~a~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~~i~~~~I~~~~Ig~~~~I~~~~i~~~~Ig 350 (451)
T 1yp2_A 271 AYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVG 350 (451)
T ss_dssp EEECCSCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCCCCCCCEEEEEEEEEEEEECTTCEEEEEEEESCEEC
T ss_pred EEEeCCEEEECCCHHHHHHHHHHHhcccccchhccCCCCeeccCCccCCCeEEcceEEeCeEECCCCEEcceEEeccEEC
Confidence 9999999999999999999999999876 556678899999999999999999778888999999999997788899999
Q ss_pred CCcEECCCCEEeceEEECCccccchhHHHHhhcCCCcceEeCCCeEEcceEeCCCCEECCCeEEccCCCcccccCCCCce
Q 018622 253 ERSRLDYGVELKDTVMLGADYYQTESEIASLLAEGKVPIGVGRNTKIRNCIIDKNVKIGKDVVIVNKDDVQEADRPELGF 332 (353)
Q Consensus 253 ~~~~ig~~~~i~~~v~~~~~~~~~~~~~~~~~~~~~~~~~ig~~~~i~~~iig~~~~Ig~~~~i~~~~~~~~~~~~~~~~ 332 (353)
++|.||++|.|.++++++++.+............+.+.+.||+++.|.+++||++|.||+++++.+..++....+||+++
T Consensus 351 ~~~~Ig~~~~I~~~~~~~~~~~~~~~~~~~~~~~g~~~~~Ig~~~~i~~~~Ig~~~~IG~~~~i~~~~~~~~~~~ig~~~ 430 (451)
T 1yp2_A 351 LRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSVPIGIGKNCHIKRAIIDKNARIGDNVKIINKDNVQEAARETDGY 430 (451)
T ss_dssp TTCEECTTCEEESCEECCCSSCCCHHHHHHHHTTTCCCSEECTTCEEESEEECTTCEECTTCEECCSSCCSCEEEGGGTE
T ss_pred CCCEECCCCEEcCceEECCCCcccccccccccccCceeEEECCCCEEeccEeCCCcEECCCCEEeCCcccccCceeCCCE
Confidence 99999999999999999885444443332222223233799999999999999999999999999988776666899999
Q ss_pred EEccCeEEecCCcEECCCccC
Q 018622 333 YIRSGITIIMEKATIEDGMVI 353 (353)
Q Consensus 333 ~i~~~~~vig~~~~i~~g~vv 353 (353)
+|+.++++||++++||+||+|
T Consensus 431 ~ig~~~v~Ig~~a~i~agsvv 451 (451)
T 1yp2_A 431 FIKSGIVTVIKDALIPSGIII 451 (451)
T ss_dssp EEETTEEEECTTCEECTTCBC
T ss_pred EEcCCEEEECCCcEECCCccC
Confidence 999998889999999999987
|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* | Back alignment and structure |
|---|
| >2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} | Back alignment and structure |
|---|
| >1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* | Back alignment and structure |
|---|
| >2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... | Back alignment and structure |
|---|
| >1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A | Back alignment and structure |
|---|
| >1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 | Back alignment and structure |
|---|
| >2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* | Back alignment and structure |
|---|
| >2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* | Back alignment and structure |
|---|
| >1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* | Back alignment and structure |
|---|
| >3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A | Back alignment and structure |
|---|
| >2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* | Back alignment and structure |
|---|
| >2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* | Back alignment and structure |
|---|
| >1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A | Back alignment and structure |
|---|
| >3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A | Back alignment and structure |
|---|
| >2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} | Back alignment and structure |
|---|
| >1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 | Back alignment and structure |
|---|
| >3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* | Back alignment and structure |
|---|
| >2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* | Back alignment and structure |
|---|
| >1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* | Back alignment and structure |
|---|
| >3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* | Back alignment and structure |
|---|
| >3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 353 | ||||
| d1yp2a2 | 307 | c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr | 6e-42 | |
| d1yp2a1 | 135 | b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt | 7e-34 | |
| d1fxoa_ | 292 | c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa | 1e-13 | |
| d1lvwa_ | 295 | c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri | 5e-09 | |
| d1mc3a_ | 291 | c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | 5e-08 | |
| d1tzfa_ | 259 | c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf | 2e-05 |
| >d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: glucose-1-phosphate thymidylyltransferase domain: Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain species: Potato (Solanum tuberosum) [TaxId: 4113]
Score = 146 bits (368), Expect = 6e-42
Identities = 110/205 (53%), Positives = 145/205 (70%), Gaps = 5/205 (2%)
Query: 16 NWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQSHVDRDADITISCA 75
+WFQGTADAVRQ+ W+F + + IL GDHLYRMDY FIQ+H + DADIT++
Sbjct: 106 DWFQGTADAVRQYLWLF---EEHTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAAL 162
Query: 76 AVGESRASDYGLVKIDNMGRIAQFAEKPSGANLKAMQVDTSLLGFSPQEARKCPYVASMG 135
+ E RA+ +GL+KID GRI +FAEKP G L+AM+VDT++LG + A++ P++ASMG
Sbjct: 163 PMDEKRATAFGLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMG 222
Query: 136 VYVFKKDVLFKLLRWRYPTSNDFGSEIIPAAIME-HDVQAYIFRDYWEDIGTIKSFYEAN 194
+YV KDV+ LLR ++P +NDFGSE+IP A VQAY++ YWEDIGTI++FY AN
Sbjct: 223 IYVISKDVMLNLLRDKFPGANDFGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNAN 282
Query: 195 MALTK-ESPAFHFYDPKTPFYTSPR 218
+ +TK P F FYD P YT PR
Sbjct: 283 LGITKKPVPDFSFYDRSAPIYTQPR 307
|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 | Back information, alignment and structure |
|---|
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 | Back information, alignment and structure |
|---|
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 | Back information, alignment and structure |
|---|
| >d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| d1yp2a2 | 307 | Glucose-1-phosphate adenylyltransferase small subu | 99.93 | |
| d1fxoa_ | 292 | RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | 99.91 | |
| d1mc3a_ | 291 | RffH {Escherichia coli [TaxId: 562]} | 99.88 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.87 | |
| d1lvwa_ | 295 | RmlA (RfbA) {Archaeon Methanobacterium thermoautot | 99.75 | |
| d2cu2a2 | 268 | Putative mannose-1-phosphate guanylyl transferase | 99.68 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.54 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.45 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.45 | |
| d1tzfa_ | 259 | Glucose-1-phosphate cytidylyltransferase RfbF {Sal | 99.44 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.31 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.3 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.23 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.23 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.22 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.21 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.2 | |
| d1g97a2 | 250 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.2 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.14 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.12 | |
| d1jyka_ | 229 | CTP:phosphocholine cytidylytransferase LicC {Strep | 99.12 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.12 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.07 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.06 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.06 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.02 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 98.97 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 98.97 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 98.95 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 98.87 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 98.82 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 98.76 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.63 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 98.63 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 98.53 | |
| d2oi6a2 | 248 | N-acetylglucosamine 1-phosphate uridyltransferase | 98.53 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 98.44 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 98.39 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.37 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 98.21 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 98.12 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 98.07 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 97.46 | |
| d1vica_ | 255 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 96.47 | |
| d1h7ea_ | 245 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 96.39 | |
| d1vh1a_ | 246 | CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn | 96.26 | |
| d2icya2 | 378 | UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c | 94.21 | |
| d1i52a_ | 225 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 91.73 | |
| d1w77a1 | 226 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 91.57 | |
| d1vgwa_ | 226 | 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) | 91.4 | |
| d1eyra_ | 225 | CMP acylneuraminate synthetase {Neisseria meningit | 86.99 |
| >d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: glucose-1-phosphate thymidylyltransferase domain: Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=99.93 E-value=1.8e-25 Score=204.41 Aligned_cols=210 Identities=55% Similarity=1.009 Sum_probs=169.0
Q ss_pred eecCcccCCCCCCccccccHHHHHHHHHHhhhhccCCCCeEEEEeCCeEEecCHHHHHHHHHHCCCcEEEEEEEeCCCCC
Q 018622 3 VLAATQTPGESGKNWFQGTADAVRQFTWVFEDAKNRNIENVAILCGDHLYRMDYMDFIQSHVDRDADITISCAAVGESRA 82 (353)
Q Consensus 3 ~~~~~~~~~~~~~~~~lGT~~al~~a~~~i~~~~~~~~~~flV~~gD~i~~~dl~~~~~~h~~~~a~~tll~~~~~~~~~ 82 (353)
++++...+ .+..+.+||++|+++++.++++ ...++|+|++||++++.|+..+++.|+.+++++++++...+.++.
T Consensus 95 ~~~~~~~~--~~~~~~~g~~~ai~~~~~~i~~---~~~~~~iv~~~D~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~ 169 (307)
T d1yp2a2 95 VLAAQQSP--ENPDWFQGTADAVRQYLWLFEE---HTVLEYLILAGDHLYRMDYEKFIQAHRETDADITVAALPMDEKRA 169 (307)
T ss_dssp EEESCSST--TSCCCCCSHHHHHHHTHHHHTT---SCCSEEEEECSCEECCCCHHHHHHHHHHTTCSEEEEEEEECHHHH
T ss_pred eeceeeec--cccccccchhHHHHHhHHhhhc---cccceEEEecCcceeccchhhhhhhhhhccccceEEEEecccccc
Confidence 34455552 2457789999999999999984 345789999999999999999999999999999998887765556
Q ss_pred CcceEEEECCCCCeeEEEeCCCccccccccccccccCCCccccccCCcccceeeEEecHHHHHHHHHhhCCCCCchhhhh
Q 018622 83 SDYGLVKIDNMGRIAQFAEKPSGANLKAMQVDTSLLGFSPQEARKCPYVASMGVYVFKKDVLFKLLRWRYPTSNDFGSEI 162 (353)
Q Consensus 83 ~~~g~v~~d~~g~V~~~~ekp~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Giyi~~~~vl~~~l~~~~~~~~~~~~d~ 162 (353)
.+||++.+|++|+|..|.|||..+.......+...+............++++|+|+|++++|..+++...+...++..++
T Consensus 170 ~~~gvv~~d~~~~v~~~~Ek~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~giyi~~~~~l~~~~~~~~~~~~~~~~d~ 249 (307)
T d1yp2a2 170 TAFGLMKIDEEGRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFIASMGIYVISKDVMLNLLRDKFPGANDFGSEV 249 (307)
T ss_dssp TTSEEEEECTTSBEEEEEESCCHHHHHHTCCCGGGGSCCHHHHHHCCEEEEEEEEEEEHHHHHHHHHTTCTTCCCTTTTH
T ss_pred cccceEEECCCCcEEEEEECCCCcccccccccccccccccchhhcccchhhCceEEECHHHHHHHhhhccccccchHHHH
Confidence 78999999999999999999986654433344433333333323345688999999999999888776656666788899
Q ss_pred hhhhhhc-CcEEEEEecceEeEcCCHHHHHHHHHhhccCCC-cccccCCCCceecCC
Q 018622 163 IPAAIME-HDVQAYIFRDYWEDIGTIKSFYEANMALTKESP-AFHFYDPKTPFYTSP 217 (353)
Q Consensus 163 l~~l~~~-~~i~~~~~~g~w~dIgtp~~y~~a~~~ll~~~~-~~~~~~~~~~i~~~~ 217 (353)
++.++++ .++.+|+++|+|.|+|||++|++|+++++.+.. ...+++++++|++.+
T Consensus 250 i~~li~~g~~v~~~~~~g~W~Digt~~~~~~a~~~ll~~~~~~~~~~~~~~~i~~~~ 306 (307)
T d1yp2a2 250 IPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPIYTQP 306 (307)
T ss_dssp HHHHHHTTCCEEEEECCSCCEECSSHHHHHHHHHGGGCSSSCSSCSCCSSSCCCCCC
T ss_pred HHHHHHCCCcEEEEEeCCeEEECcCHHHHHHHHHHHhcCCCchhhccCCCCCccCCC
Confidence 9998877 589999999999999999999999999998763 446778899999875
|
| >d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|