Citrus Sinensis ID: 018762

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350
MKKTSSFPVTPVSHSNPESIHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRVAEGSGTTSSNTFPSNTTDKKDDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDALRRRRWQAQSRHQPVTGESTQPDQLSSTTRQTPTESLHLESEVRDSESTWGS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHcccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccEEEccEccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccHHHcEEEEEEEccccccccEEEccccccHHHHHHHHHHHHHHHHccccEEEEccEEEEEccEEEEEEccccccccccccccccccEEccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
mkktssfpvtpvshsnpesihgglttdllnsakgaplpihrsrsvpllnkdgsirqmdslggvfrvipttprvaegsgttssntfpsnttdkkddggedipeeEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFsikgnktcEVCKQEVENLPVTLLRLQNvqasslpdsgaqvtryrvwqDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDALRRRRWQaqsrhqpvtgestqpdqlssttrqtpteslHLESevrdsestwgs
mkktssfpvtpvshsnpesiHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPttprvaegsgttssntfpsnttdkkddggedIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVqasslpdsgaqvtRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDALRRRRWQAqsrhqpvtgestqpdqlssttrqtpteslhlesevrdsestwgs
MKKTSSFPVTPVSHSNPESIHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRVAEgsgttssntfpsnttDKKDDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDALRRRRWQAQSRHQPVTGESTQPDQLSSTTRQTPTESLHLESEVRDSESTWGS
***********************************************************LGGVFRVI*************************************AVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDALRRRR***********************************************
****SSF***************************************************************************************************CRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDALRR*************************************************
******************SIHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRV*************************DIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDALRR*************************************************
*************************************P*HRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPR**************************DIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNV************TRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDALRRRRWQAQS******************************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKTSSFPVTPVSHSNPESIHGGLTTDLLNSAKGAPLPIHRSRSVPLLNKDGSIRQMDSLGGVFRVIPTTPRVAEGSGTTSSNTFPSNTTDKKDDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQASSLPDSGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTATTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDALRRRRWQAQSRHQPVTGESTQPDQLSSTTRQTPTESLHLESEVRDSESTWGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query350 2.2.26 [Sep-21-2011]
Q5XIV2790 Probable E3 ubiquitin-pro yes no 0.142 0.063 0.448 6e-07
Q8NA82808 Probable E3 ubiquitin-pro yes no 0.142 0.061 0.448 1e-06
Q6ZQ89 909 E3 ubiquitin-protein liga no no 0.171 0.066 0.360 4e-05
Q9WV66693 E3 ubiquitin-protein liga no no 0.205 0.103 0.264 4e-05
Q5XI50692 E3 ubiquitin-protein liga no no 0.154 0.078 0.338 4e-05
Q5R9W1 910 E3 ubiquitin-protein liga no no 0.171 0.065 0.360 5e-05
O60337 910 E3 ubiquitin-protein liga no no 0.171 0.065 0.360 5e-05
Q9H992704 E3 ubiquitin-protein liga no no 0.151 0.075 0.344 6e-05
Q5R9W2707 E3 ubiquitin-protein liga no no 0.151 0.074 0.344 6e-05
P90495333 E3 ubiquitin-protein liga no no 0.14 0.147 0.465 9e-05
>sp|Q5XIV2|MARHA_RAT Probable E3 ubiquitin-protein ligase MARCH10 OS=Rattus norvegicus GN=March10 PE=2 SV=1 Back     alignment and function desciption
 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 107 CRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGN--------KTCEVCKQ 156
           CRIC I  G   + L   CGC G L F H+EC  KW  +K          KTCE+CKQ
Sbjct: 641 CRICQIAGGSPANPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLSTVKTCEMCKQ 698
E3 ubiquitin-protein ligase (Probable). E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Rattus norvegicus (taxid: 10116)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8NA82|MARHA_HUMAN Probable E3 ubiquitin-protein ligase MARCH10 OS=Homo sapiens GN=MARCH10 PE=2 SV=3 Back     alignment and function description
>sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 Back     alignment and function description
>sp|Q9WV66|MARH7_MOUSE E3 ubiquitin-protein ligase MARCH7 OS=Mus musculus GN=March7 PE=2 SV=1 Back     alignment and function description
>sp|Q5XI50|MARH7_RAT E3 ubiquitin-protein ligase MARCH7 OS=Rattus norvegicus GN=March7 PE=2 SV=1 Back     alignment and function description
>sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo abelii GN=MARCH6 PE=2 SV=1 Back     alignment and function description
>sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens GN=MARCH6 PE=1 SV=2 Back     alignment and function description
>sp|Q9H992|MARH7_HUMAN E3 ubiquitin-protein ligase MARCH7 OS=Homo sapiens GN=MARCH7 PE=1 SV=1 Back     alignment and function description
>sp|Q5R9W2|MARH7_PONAB E3 ubiquitin-protein ligase MARCH7 OS=Pongo abelii GN=MARCH7 PE=2 SV=1 Back     alignment and function description
>sp|P90495|MIR1_HHV8P E3 ubiquitin-protein ligase MIR1 OS=Human herpesvirus 8 type P (isolate GK18) GN=K3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query350
255557024 512 protein binding protein, putative [Ricin 0.985 0.673 0.666 1e-133
359481363 516 PREDICTED: uncharacterized protein LOC10 0.991 0.672 0.669 1e-130
224069416444 predicted protein [Populus trichocarpa] 0.905 0.713 0.661 1e-121
356548242 507 PREDICTED: uncharacterized protein LOC10 0.925 0.639 0.605 1e-113
255578868 495 protein binding protein, putative [Ricin 0.931 0.658 0.598 1e-108
449462085 485 PREDICTED: uncharacterized protein LOC10 0.902 0.651 0.597 1e-106
297833742 488 zinc finger family protein [Arabidopsis 0.871 0.625 0.593 1e-106
449519046 485 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.902 0.651 0.594 1e-105
18398630 491 RING/U-box domain-containing protein [Ar 0.894 0.637 0.584 1e-105
297746250335 unnamed protein product [Vitis vinifera] 0.877 0.916 0.610 1e-105
>gi|255557024|ref|XP_002519545.1| protein binding protein, putative [Ricinus communis] gi|223541408|gb|EEF42959.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/351 (66%), Positives = 282/351 (80%), Gaps = 6/351 (1%)

Query: 2   KKTSSFPVTPVSHSNPESIHGGLTTDLLNSAKG-APLPIHRSRSVPLLNKDGSIRQMDSL 60
           K+TSS PVTP++HSNPES+HGG  T+  +SAKG A  PIHRSRSVP+++K+GS+RQ+D  
Sbjct: 164 KRTSSLPVTPIAHSNPESMHGGYATNPSSSAKGDAQKPIHRSRSVPMMDKEGSVRQIDPS 223

Query: 61  GGVFRVIPTTPRVAEGSGTTSSNTFPSNTTDKKDDGGEDIPEEEAVCRICFIELGEGFDA 120
           GG+FRV+PTTPR AE + TT+S+  P N  D  +D GEDIPEEEAVCRIC +ELGEG D 
Sbjct: 224 GGIFRVVPTTPRPAEVAVTTTSSASPRNDIDGNEDSGEDIPEEEAVCRICLVELGEGGDT 283

Query: 121 LKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQAS-SLPDS 179
           LKMEC CKGELA AH+ECAVKWFSIKGNKTC+VCKQEV+NL VTLLRLQN + + S P  
Sbjct: 284 LKMECSCKGELALAHQECAVKWFSIKGNKTCDVCKQEVKNLAVTLLRLQNARGNRSRP-- 341

Query: 180 GAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTAT 239
            A+V +YRVWQDVPILVIVSMLAYFCFLE+LLVGK+ SGAIAISLPFSCI+GLLAS T+T
Sbjct: 342 -AEVAQYRVWQDVPILVIVSMLAYFCFLEQLLVGKLGSGAIAISLPFSCIIGLLASMTST 400

Query: 240 TMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDAL 299
           TMVR+ ++W+YA IQFGLVVLSAHL+YSLLHMQAV+ VLL+TF GFG+TM+G+S++ +  
Sbjct: 401 TMVRRRYVWVYATIQFGLVVLSAHLYYSLLHMQAVLSVLLATFTGFGVTMSGSSVIAEIF 460

Query: 300 R-RRRWQAQSRHQPVTGESTQPDQLSSTTRQTPTESLHLESEVRDSESTWG 349
           R +RRW AQ   Q  +  +TQPDQ  +   QT T   H + E   SES  G
Sbjct: 461 RCQRRWIAQVNEQHGSQGATQPDQTLAAAHQTETNPDHQQIETGGSESIPG 511

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359481363|ref|XP_002280929.2| PREDICTED: uncharacterized protein LOC100265508 [Vitis vinifera] gi|297741592|emb|CBI32724.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224069416|ref|XP_002326349.1| predicted protein [Populus trichocarpa] gi|222833542|gb|EEE72019.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356548242|ref|XP_003542512.1| PREDICTED: uncharacterized protein LOC100787963 [Glycine max] Back     alignment and taxonomy information
>gi|255578868|ref|XP_002530288.1| protein binding protein, putative [Ricinus communis] gi|223530186|gb|EEF32095.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449462085|ref|XP_004148772.1| PREDICTED: uncharacterized protein LOC101213858 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297833742|ref|XP_002884753.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297330593|gb|EFH61012.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449519046|ref|XP_004166546.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101231491 [Cucumis sativus] Back     alignment and taxonomy information
>gi|18398630|ref|NP_566355.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|15809927|gb|AAL06891.1| At3g09760/F8A24.19 [Arabidopsis thaliana] gi|21360565|gb|AAM47479.1| At3g09760/F8A24.19 [Arabidopsis thaliana] gi|66865928|gb|AAY57598.1| RING finger family protein [Arabidopsis thaliana] gi|332641288|gb|AEE74809.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297746250|emb|CBI16306.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query350
TAIR|locus:2075064491 AT3G09760 [Arabidopsis thalian 0.888 0.633 0.584 8.4e-97
TAIR|locus:2175158494 AT5G60580 [Arabidopsis thalian 0.925 0.655 0.557 1e-91
TAIR|locus:2081076426 AT3G06330 [Arabidopsis thalian 0.571 0.469 0.443 3.5e-43
TAIR|locus:2144890411 AT5G18760 "AT5G18760" [Arabido 0.545 0.464 0.454 1.9e-42
TAIR|locus:2065620207 AT2G37950 [Arabidopsis thalian 0.188 0.318 0.449 2.9e-12
TAIR|locus:2150084206 AT5G01070 [Arabidopsis thalian 0.165 0.281 0.437 1.3e-10
TAIR|locus:2166399204 AT5G05830 [Arabidopsis thalian 0.157 0.269 0.457 1.4e-08
TAIR|locus:2154523231 AT5G59000 "AT5G59000" [Arabido 0.317 0.480 0.300 2.5e-07
TAIR|locus:505006426218 PIT1 "pitchoun 1" [Arabidopsis 0.137 0.220 0.48 5.8e-07
TAIR|locus:2154109307 AT5G62460 [Arabidopsis thalian 0.311 0.355 0.298 7.1e-07
TAIR|locus:2075064 AT3G09760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 962 (343.7 bits), Expect = 8.4e-97, P = 8.4e-97
 Identities = 194/332 (58%), Positives = 239/332 (71%)

Query:     1 MKKTSSFPVTPVSHSNPESIHGGLTTDLLNSAK-GAPLPIHRSRSVPLLNKDGSIRQMDS 59
             +KKT S PVTP++HSNPES HG    DL+ S K G PLPIHRSRSVP  NKDGS RQ+  
Sbjct:   171 LKKTESLPVTPIAHSNPESTHGRFAVDLVTSTKKGPPLPIHRSRSVPAFNKDGSQRQL-- 228

Query:    60 LGGVFRVIPTTPRVAEXXXXXXXXXXXXXXXDKKDDGGEDIPEEEAVCRICFIELGEGFD 119
               GVFRVIPT P ++                D   DG ED+PEEEAVCRIC +ELGE  +
Sbjct:   229 --GVFRVIPT-PNMSPTRNTIKLN-------DANVDGAEDVPEEEAVCRICLVELGEDSE 278

Query:   120 ALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQAS-SLPD 178
             A KMEC C+GELA AH+EC +KWF+IKGN+TC+VCKQEV+NLPVTLLR+QN + S   PD
Sbjct:   279 AFKMECLCRGELALAHKECTIKWFTIKGNRTCDVCKQEVQNLPVTLLRMQNSRGSIGAPD 338

Query:   179 SGAQVTRYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISLPFSCILGLLASTTA 238
               A+   Y +WQDVPILVIVSMLAYFCFLE+LL+ KM+SGAIA+SLPFSC+LGL AS TA
Sbjct:   339 --AEAAHYSLWQDVPILVIVSMLAYFCFLEQLLLTKMQSGAIAVSLPFSCVLGLFASMTA 396

Query:   239 TTMVRKSFIWLYAFIQFGLVVLSAHLFYSLLHMQAVIVVLLSTFAGFGITMAGTSILTDA 298
             TTMV K ++W+YA  QFGLVV  +H+F++L+ MQ V+ +LL+T  GFG+TM+GT   T  
Sbjct:   397 TTMVPKRYVWIYATTQFGLVVFFSHIFFTLVRMQPVVAILLATIVGFGLTMSGT---TGI 453

Query:   299 LRRRRWQAQSRHQPVTGESTQPDQ-LSSTTRQ 329
             +   +W+  +R   +   S+Q DQ L  TT Q
Sbjct:   454 VEFSKWRRSNRTAELPS-SSQVDQPLVETTDQ 484
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081076 AT3G06330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144890 AT5G18760 "AT5G18760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065620 AT2G37950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150084 AT5G01070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166399 AT5G05830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154523 AT5G59000 "AT5G59000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006426 PIT1 "pitchoun 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154109 AT5G62460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query350
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 3e-19
pfam1290647 pfam12906, RINGv, RING-variant domain 1e-15
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 1e-08
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 1e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 0.003
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 79.6 bits (197), Expect = 3e-19
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 106 VCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCK 155
           +CRIC  E  EG D L   C CKG L + H+EC  +W +  GNKTCE+CK
Sbjct: 1   ICRICHDEGDEG-DPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 350
KOG1609323 consensus Protein involved in mRNA turnover and st 99.74
PHA02825162 LAP/PHD finger-like protein; Provisional 99.63
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.63
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.62
PHA02862156 5L protein; Provisional 99.55
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.55
KOG3053293 consensus Uncharacterized conserved protein [Funct 99.27
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.65
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.64
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.09
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.04
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.93
PHA02929238 N1R/p28-like protein; Provisional 97.9
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.81
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.77
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.73
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.63
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.44
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 97.43
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.43
PHA02926242 zinc finger-like protein; Provisional 97.29
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.22
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.11
COG52191525 Uncharacterized conserved protein, contains RING Z 97.07
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.03
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.97
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.85
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 96.69
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.69
PF0967993 TraQ: Type-F conjugative transfer system pilin cha 96.64
PF1463444 zf-RING_5: zinc-RING finger domain 96.48
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.15
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.02
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 95.86
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 95.63
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.45
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 95.33
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 95.22
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.08
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 94.29
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 93.75
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 93.4
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 93.18
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 93.13
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 93.13
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 92.81
KOG4445368 consensus Uncharacterized conserved protein, conta 92.65
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 91.38
KOG1941518 consensus Acetylcholine receptor-associated protei 90.94
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 90.02
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 89.42
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 88.65
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 88.01
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 87.46
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 85.96
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 84.82
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 84.43
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 84.06
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 83.53
PF10272358 Tmpp129: Putative transmembrane protein precursor; 83.28
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 83.16
COG5236 493 Uncharacterized conserved protein, contains RING Z 81.11
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 80.97
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 80.44
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 80.15
PLN02189 1040 cellulose synthase 80.14
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information 
Probab=99.74  E-value=1.2e-18  Score=164.33  Aligned_cols=204  Identities=28%  Similarity=0.405  Sum_probs=139.0

Q ss_pred             CCCCCCCCCCCeeeecccccccCC-CccccccccCCccccccHHHHHHHHHhcCCcccccccccccccceeeeeecccCC
Q 018762           95 DGGEDIPEEEAVCRICFIELGEGF-DALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVENLPVTLLRLQNVQA  173 (350)
Q Consensus        95 ~~~e~i~eee~~CRICl~e~~e~~-e~lilPC~CkGsl~~vH~~CL~kWl~~kg~~~CeICk~~y~~vp~~l~ri~~~~~  173 (350)
                      ++.++.++++..||||+++..+.. ..++.||.|+|+++++|+.|+++|+..|++..||+|++.+.+......+......
T Consensus        69 ~~~~~~~~~~~~cRIc~~~~~~~~~~~l~~pC~C~g~l~~vH~~cl~~W~~~~~~~~CeiC~~~~~~~~~~~~~~~~~~~  148 (323)
T KOG1609|consen   69 ESLEESPSSGPICRICHEEDEESNGLLLISPCSCKGSLAYVHRSCLEKWFSIKGNITCEICKSFFINVGTKLKPLIVISK  148 (323)
T ss_pred             CccccCCCCCCcEEEEecccccccccccccCccccCcHHHHHHHHHHhhhccccCeeeecccccceecceeecceeehhh
Confidence            344455666789999998764321 2789999999999999999999999999999999999999987543332221110


Q ss_pred             CCCCCCccccc----ccceecccchhhHHHHHHHHHHHHhHhhcccccchhhhhh-hhHHHHHHHHHHHhhhhhhhhhhH
Q 018762          174 SSLPDSGAQVT----RYRVWQDVPILVIVSMLAYFCFLEELLVGKMKSGAIAISL-PFSCILGLLASTTATTMVRKSFIW  248 (350)
Q Consensus       174 ~n~~~~~~~~~----~~r~Wq~~pvLViismL~yFcfLeqLlv~~~g~~Ai~is~-Pf~~iLGlL~s~~a~~~~~~~~iw  248 (350)
                      ...+.......    ....|..+.+.+.+..+..+++.+..+....+........ +..+.+|++...+.+.+....|+|
T Consensus       149 ~~~~~~~~~~~~~~~~~~~~~~~~i~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~  228 (323)
T KOG1609|consen  149 VRSGALSERTLSGMILLKVALLVAIIVSVLPLLLGLLFELVLGVPSLVVESPLANPLALVALGLLGFKIWIFIILSGYIF  228 (323)
T ss_pred             hhhHhhhheeeehhhhhhhhhhheeeEEeehhhhhhhHHHhccccccccCCCccCchhheeecceechHHHHHHHHHHHH
Confidence            00000000000    1112222223333455677777777766666664444444 556679999888888999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhhhccc---hhhhhhhh-hhhccceEeeehhHHHHHH
Q 018762          249 LYAFIQFGLVVLSAHLFYSLLHM---QAVIVVLL-STFAGFGITMAGTSILTDA  298 (350)
Q Consensus       249 ~yA~~qf~lv~l~~~ify~~~~~---~~v~ai~l-a~~~Gfgi~~~~~~~~~~~  298 (350)
                      .+..+.+.++.++..+|+....+   ..+....+ +...|++++.+...+++..
T Consensus       229 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  282 (323)
T KOG1609|consen  229 ILKSLKVKLVLIRAVIFLLLIKVVLAAVVILQLLLQRLVGYLLANSLTPLYIVS  282 (323)
T ss_pred             HHHHHHHHHhHhhhhccchhhhhhhhhHHHHHHHHhcceeEEEecccceeeecc
Confidence            99999999999999988887776   33333322 2389999999888777775

>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF09679 TraQ: Type-F conjugative transfer system pilin chaperone (TraQ); InterPro: IPR014112 This entry represents TraQ, a protein that makes a specific interaction with pilin (TraA) to aid its transfer through the inner membrane during the process of F-type conjugative pilus assembly [, ] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query350
1vyx_A60 Solution Structure Of The Kshv K3 N-Terminal Domain 9e-07
2d8s_A80 Solution Structure Of The Ring Domain Of The Human 6e-05
>pdb|1VYX|A Chain A, Solution Structure Of The Kshv K3 N-Terminal Domain Length = 60 Back     alignment and structure 
Iteration: 1

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 31/58 (53%), Gaps = 9/58 (15%)
Query: 98  EDIPEEEAVCRICFIELG-EGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVC 154
           ED+P    VC IC  ELG E F A    CGC GEL   HR C   W +I  N  C++C
Sbjct: 4   EDVP----VCWICNEELGNERFRA----CGCTGELENVHRSCLSTWLTISRNTACQIC 53
>pdb|2D8S|A Chain A, Solution Structure Of The Ring Domain Of The Human Cellular Modulator Of Immune Recognition Protein Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query350
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 2e-21
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 1e-20
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-06
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 6e-06
3nw0_A238 Non-structural maintenance of chromosomes element 9e-05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 8e-04
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
 Score = 85.7 bits (212), Expect = 2e-21
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 94  DDGGEDIPEEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEV 153
             G    P  + +CRIC  E G+    L   C C G L F H+ C  +W      + CE+
Sbjct: 5   SSGTSITPSSQDICRICHCE-GDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCEL 63

Query: 154 CKQE 157
           CK E
Sbjct: 64  CKYE 67
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query350
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.7
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.67
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.88
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.8
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.77
2ect_A78 Ring finger protein 126; metal binding protein, st 98.74
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.72
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.69
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.58
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.56
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.54
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.52
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.52
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.45
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.42
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.41
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.38
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.37
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.35
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.31
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.31
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.27
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.27
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.26
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.26
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.25
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.25
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.24
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.23
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.17
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.16
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.11
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.05
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.94
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.92
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.87
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.87
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.82
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.81
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.78
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.75
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.75
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.72
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.7
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.7
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.6
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.58
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.56
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.48
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.47
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.35
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.33
2ea5_A68 Cell growth regulator with ring finger domain prot 97.33
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.28
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.18
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.13
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.12
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.07
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.01
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.93
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.67
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 96.54
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.42
2f42_A179 STIP1 homology and U-box containing protein 1; cha 96.41
3nw0_A238 Non-structural maintenance of chromosomes element 96.13
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 96.06
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 95.98
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 95.42
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 95.23
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.37
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 94.36
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 87.25
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 86.94
1weu_A91 Inhibitor of growth family, member 4; structural g 86.0
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 84.29
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 81.01
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.70  E-value=5.8e-18  Score=127.16  Aligned_cols=56  Identities=38%  Similarity=0.805  Sum_probs=49.5

Q ss_pred             CCCCeeeecccccccCCCccccccccCCccccccHHHHHHHHHhcCCcccccccccccc
Q 018762          102 EEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVEN  160 (350)
Q Consensus       102 eee~~CRICl~e~~e~~e~lilPC~CkGsl~~vH~~CL~kWl~~kg~~~CeICk~~y~~  160 (350)
                      +++..||||+++.   ++.+++||+|+|++++||++||++|+..+++.+||+|+++|+.
T Consensus         4 ~~~~~CrIC~~~~---~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~   59 (60)
T 1vyx_A            4 EDVPVCWICNEEL---GNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEEC---SCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCEeEEeecCC---CCceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence            3567999999763   3457899999999999999999999999999999999999973
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 350
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 1e-09
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-06
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 6e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.002
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 51.8 bits (123), Expect = 1e-09
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query: 102 EEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQE 157
           E+  VC IC  ELG         CGC GEL   HR C   W +I  N  C++C   
Sbjct: 4   EDVPVCWICNEELGNER---FRACGCTGELENVHRSCLSTWLTISRNTACQICGVV 56
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query350
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.52
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.9
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.64
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.62
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.52
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.49
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.48
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.42
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.8
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.73
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.72
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.61
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.35
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.3
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.16
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.13
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.64
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 89.84
d1wema_76 Death associated transcription factor 1, Datf1 (DI 89.41
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 88.38
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 86.58
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 84.26
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 83.4
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.52  E-value=2.9e-15  Score=109.60  Aligned_cols=56  Identities=38%  Similarity=0.805  Sum_probs=49.4

Q ss_pred             CCCCeeeecccccccCCCccccccccCCccccccHHHHHHHHHhcCCcccccccccccc
Q 018762          102 EEEAVCRICFIELGEGFDALKMECGCKGELAFAHRECAVKWFSIKGNKTCEVCKQEVEN  160 (350)
Q Consensus       102 eee~~CRICl~e~~e~~e~lilPC~CkGsl~~vH~~CL~kWl~~kg~~~CeICk~~y~~  160 (350)
                      |+..+|+||++++   ++.++.||.|+|..|+||+.||.+|+..+++.+||+|+++|+.
T Consensus         4 ed~~~C~IC~~~~---~~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~   59 (60)
T d1vyxa_           4 EDVPVCWICNEEL---GNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEEC---SCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCCCccCCccC---CCceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeec
Confidence            3567999999764   3467799999999999999999999999999999999999973
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure