Citrus Sinensis ID: 018779
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 350 | ||||||
| 118489496 | 474 | unknown [Populus trichocarpa x Populus d | 0.957 | 0.706 | 0.682 | 1e-117 | |
| 359483352 | 473 | PREDICTED: dihydrolipoyllysine-residue s | 0.948 | 0.701 | 0.641 | 1e-113 | |
| 302144114 | 562 | unnamed protein product [Vitis vinifera] | 0.948 | 0.590 | 0.641 | 1e-113 | |
| 224116582 | 467 | predicted protein [Populus trichocarpa] | 0.942 | 0.706 | 0.628 | 1e-108 | |
| 356501546 | 464 | PREDICTED: dihydrolipoyllysine-residue s | 0.922 | 0.696 | 0.624 | 1e-107 | |
| 356552986 | 461 | PREDICTED: dihydrolipoyllysine-residue s | 0.925 | 0.702 | 0.622 | 1e-107 | |
| 255578100 | 469 | dihydrolipoamide succinyltransferase com | 0.934 | 0.697 | 0.592 | 1e-106 | |
| 449444056 | 469 | PREDICTED: dihydrolipoyllysine-residue s | 0.934 | 0.697 | 0.587 | 1e-103 | |
| 357445475 | 453 | Dihydrolipoyllysine-residue succinyltran | 0.928 | 0.717 | 0.583 | 1e-101 | |
| 357494607 | 455 | Dihydrolipoyllysine-residue succinyltran | 0.925 | 0.712 | 0.569 | 3e-99 |
| >gi|118489496|gb|ABK96550.1| unknown [Populus trichocarpa x Populus deltoides] | Back alignment and taxonomy information |
|---|
Score = 426 bits (1095), Expect = e-117, Method: Compositional matrix adjust.
Identities = 241/353 (68%), Positives = 269/353 (76%), Gaps = 18/353 (5%)
Query: 1 MIWGIVRRKITSAQVIGQSVSKI---GPRCHATAQKEAILTCRGFQR-VQRSSYHILSGN 56
MIWGI+RR + S+Q SVS+I R Q E + +G + V SY G+
Sbjct: 1 MIWGIIRRNLASSQ----SVSRIKHPAIRPRGYGQNELLSNGKGCRHAVGSFSYCTSLGS 56
Query: 57 YVC----STPRSEVIELIQKGSFIGSRSRLFSSDSGDLVDAVVPFMGESITDGTLAKFLK 112
C + PR E+ +++ FI RSR FSSD+GDLVDAVVPFMGESITDGTLAKFLK
Sbjct: 57 QCCRAYSNKPRREITAMLRPEYFIPLRSRSFSSDTGDLVDAVVPFMGESITDGTLAKFLK 116
Query: 113 QPGDRVEMDEPIAQIETDKVTIDVASPQAGVIQNLIAKEGETVEPGAKIAVISKSGEGVA 172
PGDRVE+DEPIAQIETDKVTIDVASP+AG IQ L+AKEGETVEPG KIAVISKSGEGV
Sbjct: 117 NPGDRVEVDEPIAQIETDKVTIDVASPEAGTIQQLVAKEGETVEPGTKIAVISKSGEGVP 176
Query: 173 QAA--SAEKAAAQPPPAEEKPSAEKQTPESEAAPAV-KDKTPSEPPPTAKKPTSPPSKPM 229
QAA S EK A+QPPP EK S K T ++E + K+KT P P A+ +P S P
Sbjct: 177 QAAPPSQEKTASQPPPPAEKESIGKGTTKTETSSLKGKEKTLFPPQPAAR---APSSPPK 233
Query: 230 ASEPQLPPKDRERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDYKDAF 289
SEPQLPPK+RERRVPMTRLRKRVATRLKDSQNTFA+LTTFNEVDMTNLMKLRSDYKDAF
Sbjct: 234 PSEPQLPPKERERRVPMTRLRKRVATRLKDSQNTFAMLTTFNEVDMTNLMKLRSDYKDAF 293
Query: 290 LEKHGVKLGLMSGFVKAAVSALQHQPVVNAVIDGDDIIYRDYIDISFAVGTKK 342
+EKHGVK G MSGFVKAAVSALQ+QPVVNAVIDGDDIIYRDYIDIS AVGT K
Sbjct: 294 VEKHGVKFGFMSGFVKAAVSALQYQPVVNAVIDGDDIIYRDYIDISIAVGTPK 346
|
Source: Populus trichocarpa x Populus deltoides Species: Populus trichocarpa x Populus deltoides Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359483352|ref|XP_002266593.2| PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302144114|emb|CBI23219.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224116582|ref|XP_002317337.1| predicted protein [Populus trichocarpa] gi|222860402|gb|EEE97949.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356501546|ref|XP_003519585.1| PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356552986|ref|XP_003544840.1| PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255578100|ref|XP_002529920.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase, putative [Ricinus communis] gi|223530597|gb|EEF32474.1| dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449444056|ref|XP_004139791.1| PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like [Cucumis sativus] gi|449517675|ref|XP_004165870.1| PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357445475|ref|XP_003593015.1| Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [Medicago truncatula] gi|355482063|gb|AES63266.1| Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [Medicago truncatula] gi|388493976|gb|AFK35054.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357494607|ref|XP_003617592.1| Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [Medicago truncatula] gi|355518927|gb|AET00551.1| Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 350 | ||||||
| TAIR|locus:2161670 | 464 | AT5G55070 [Arabidopsis thalian | 0.908 | 0.685 | 0.542 | 2.5e-74 | |
| TAIR|locus:2116432 | 464 | AT4G26910 [Arabidopsis thalian | 0.725 | 0.547 | 0.603 | 2e-72 | |
| DICTYBASE|DDB_G0275029 | 439 | odhB "dihydrolipoamide S-succi | 0.634 | 0.505 | 0.421 | 4.3e-38 | |
| TIGR_CMR|SPO_0343 | 398 | SPO_0343 "2-oxoglutarate dehyd | 0.645 | 0.567 | 0.388 | 8e-37 | |
| MGI|MGI:1926170 | 454 | Dlst "dihydrolipoamide S-succi | 0.228 | 0.176 | 0.637 | 3e-36 | |
| UNIPROTKB|F1NQH8 | 411 | DLST "Uncharacterized protein" | 0.228 | 0.194 | 0.612 | 5.8e-36 | |
| WB|WBGene00020950 | 463 | dlst-1 [Caenorhabditis elegans | 0.291 | 0.220 | 0.529 | 6.8e-36 | |
| RGD|1359615 | 454 | Dlst "dihydrolipoamide S-succi | 0.228 | 0.176 | 0.637 | 8e-36 | |
| UNIPROTKB|G3V6P2 | 454 | Dlst "Dihydrolipoyllysine-resi | 0.228 | 0.176 | 0.637 | 8e-36 | |
| UNIPROTKB|P11179 | 455 | DLST "Dihydrolipoyllysine-resi | 0.228 | 0.175 | 0.625 | 1.1e-35 |
| TAIR|locus:2161670 AT5G55070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 750 (269.1 bits), Expect = 2.5e-74, P = 2.5e-74
Identities = 185/341 (54%), Positives = 213/341 (62%)
Query: 8 RKITSAQVIGQSVSK----IGPRCHATAQKEAILTCRGFQRVQRSSYHILS--GNYVCST 61
R +SA +G+S+ + + H+ + E ++ RG S+H S G CS
Sbjct: 13 RGSSSASGLGKSLQSSRVAVSAQFHSVSATETLVP-RGNHA---HSFHHRSCPGCPDCS- 67
Query: 62 PRSEVIELIQKGSFIGSRSRLFSSDSGDLVDAVVPFMGESITDGTLAKFLKQPGDRVEMD 121
R+ +I Q G+ + R FSSDSGD+V+AVVP MGESITDGTLA FLK+PGDRVE D
Sbjct: 68 -RT-IINGYQ-GTALQRWVRPFSSDSGDVVEAVVPHMGESITDGTLAAFLKKPGDRVEAD 124
Query: 122 EPIAQIETDKVTIDVASPQAGVIQNLIAKEGETVEPGAKIAVISKSGEGVXXXXXXXXXX 181
E IAQIETDKVTID+ASP +GVIQ + KEG+TVEPG K+A IS S + V
Sbjct: 125 EAIAQIETDKVTIDIASPASGVIQEFLVKEGDTVEPGNKVARISTSADAVSHVAPSEKAP 184
Query: 182 XXXXXXXXXXXXXXXTPESEAAPAVKDXXXXXXXXXXXXXXXXXXXXMASEPQLPPKDRE 241
+P +E P V+ A EPQLPPKDRE
Sbjct: 185 EKPAPKP--------SPPAEK-PKVESTKVAEKPKAPSPPPPPPSKQSAKEPQLPPKDRE 235
Query: 242 RRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKLGLMS 301
RRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRS YKDAFLEKHGVKLGLMS
Sbjct: 236 RRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFLEKHGVKLGLMS 295
Query: 302 GFVKAAVSALQHQPVVNAVXXXXXXXXXXXXXXSFAVGTKK 342
GF+KAAVSALQHQPVVNAV S AVGT K
Sbjct: 296 GFIKAAVSALQHQPVVNAVIDGDDIIYRDYVDISIAVGTSK 336
|
|
| TAIR|locus:2116432 AT4G26910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0275029 odhB "dihydrolipoamide S-succinyltransferase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0343 SPO_0343 "2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1926170 Dlst "dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NQH8 DLST "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00020950 dlst-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| RGD|1359615 Dlst "dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V6P2 Dlst "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11179 DLST "Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 350 | |||
| PLN02226 | 463 | PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E | 1e-123 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 1e-100 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 1e-99 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 2e-85 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 1e-61 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 5e-56 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 1e-43 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 4e-36 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 1e-30 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 8e-28 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 3e-26 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 4e-24 | |
| pfam00198 | 212 | pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases | 2e-21 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 2e-21 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 6e-21 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 9e-19 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 5e-16 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 1e-15 | |
| PRK11857 | 306 | PRK11857, PRK11857, dihydrolipoamide acetyltransfe | 1e-14 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 1e-14 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 1e-14 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 3e-14 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 5e-13 | |
| PRK14843 | 347 | PRK14843, PRK14843, dihydrolipoamide acetyltransfe | 9e-10 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 1e-09 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 2e-09 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 9e-09 | |
| TIGR02712 | 1201 | TIGR02712, urea_carbox, urea carboxylase | 1e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-07 | |
| PLN02528 | 416 | PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase | 1e-06 | |
| PRK09282 | 592 | PRK09282, PRK09282, pyruvate carboxylase subunit B | 4e-05 | |
| PRK12373 | 400 | PRK12373, PRK12373, NADH dehydrogenase subunit E; | 9e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 6e-04 | |
| PRK12999 | 1146 | PRK12999, PRK12999, pyruvate carboxylase; Reviewed | 6e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 7e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.001 | |
| PRK08225 | 70 | PRK08225, PRK08225, acetyl-CoA carboxylase biotin | 0.001 | |
| COG4770 | 645 | COG4770, COG4770, Acetyl/propionyl-CoA carboxylase | 0.002 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.002 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.002 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.003 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.003 | |
| cd06848 | 96 | cd06848, GCS_H, Glycine cleavage H-protein | 0.003 | |
| PLN02328 | 808 | PLN02328, PLN02328, lysine-specific histone demeth | 0.003 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.004 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.004 |
| >gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
Score = 361 bits (928), Expect = e-123
Identities = 189/263 (71%), Positives = 211/263 (80%), Gaps = 10/263 (3%)
Query: 81 RLFSSDSGDLVDAVVPFMGESITDGTLAKFLKQPGDRVEMDEPIAQIETDKVTIDVASPQ 140
R FSS+SGD V+AVVP MGESITDGTLA FLK+PG+RV+ DE IAQIETDKVTID+ASP
Sbjct: 82 RPFSSESGDTVEAVVPHMGESITDGTLATFLKKPGERVQADEAIAQIETDKVTIDIASPA 141
Query: 141 AGVIQNLIAKEGETVEPGAKIAVISKSGEGVAQAASAEKAAAQPPPAEEKPSAEKQTPES 200
+GVIQ + KEG+TVEPG K+A+ISKS + +Q ++K P P+ +KQ P+
Sbjct: 142 SGVIQEFLVKEGDTVEPGTKVAIISKSEDAASQVTPSQKIPETTDPKPSPPAEDKQKPKV 201
Query: 201 EAAP-AVKDKTPSEPPPTAKKPTSPPSKPMASEPQLPPKDRERRVPMTRLRKRVATRLKD 259
E+AP A K K PS PPP K A EPQLPPK+RERRVPMTRLRKRVATRLKD
Sbjct: 202 ESAPVAEKPKAPSSPPP---------PKQSAKEPQLPPKERERRVPMTRLRKRVATRLKD 252
Query: 260 SQNTFALLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKLGLMSGFVKAAVSALQHQPVVNA 319
SQNTFALLTTFNEVDMTNLMKLRS YKDAF EKHGVKLGLMSGF+KAAVSALQHQPVVNA
Sbjct: 253 SQNTFALLTTFNEVDMTNLMKLRSQYKDAFYEKHGVKLGLMSGFIKAAVSALQHQPVVNA 312
Query: 320 VIDGDDIIYRDYIDISFAVGTKK 342
VIDGDDIIYRDY+DIS AVGT K
Sbjct: 313 VIDGDDIIYRDYVDISIAVGTSK 335
|
Length = 463 |
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237082 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181304 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133457 cd06848, GCS_H, Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 350 | |||
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 100.0 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 100.0 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 100.0 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 100.0 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 100.0 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 100.0 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 100.0 | |
| KOG0558 | 474 | consensus Dihydrolipoamide transacylase (alpha-ket | 100.0 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 100.0 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 100.0 | |
| KOG0557 | 470 | consensus Dihydrolipoamide acetyltransferase [Ener | 100.0 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 100.0 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 100.0 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 100.0 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 100.0 | |
| PRK14843 | 347 | dihydrolipoamide acetyltransferase; Provisional | 99.95 | |
| PRK11857 | 306 | dihydrolipoamide acetyltransferase; Reviewed | 99.94 | |
| PF00198 | 231 | 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe | 99.94 | |
| PRK12270 | 1228 | kgd alpha-ketoglutarate decarboxylase; Reviewed | 99.87 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.81 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.78 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 99.75 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.75 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.63 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.6 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 99.6 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.59 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.54 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 99.48 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.47 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.44 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 99.43 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.42 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.38 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 99.37 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 99.33 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 99.31 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.27 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 99.24 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.23 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 99.14 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 99.09 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 99.07 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 99.05 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 98.95 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 98.84 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 98.78 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 98.5 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 98.47 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 98.23 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 98.14 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 98.1 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 98.1 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 98.01 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 98.01 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 98.0 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 97.97 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 97.9 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 97.87 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 97.84 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 97.75 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 97.7 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 97.7 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 97.67 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 97.64 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 97.6 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.57 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 97.56 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.5 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 97.5 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 97.44 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 97.41 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 97.37 | |
| PF00302 | 206 | CAT: Chloramphenicol acetyltransferase; InterPro: | 97.23 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 97.22 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 97.11 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 97.01 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 96.9 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 96.77 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.56 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 96.47 | |
| PRK13757 | 219 | chloramphenicol acetyltransferase; Provisional | 96.42 | |
| PRK06748 | 83 | hypothetical protein; Validated | 96.31 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 96.05 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 96.04 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 96.03 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 95.98 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 95.86 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 95.84 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 95.67 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 95.54 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 95.46 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 95.44 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 95.41 | |
| PRK07051 | 80 | hypothetical protein; Validated | 95.41 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 94.98 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 94.86 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 94.75 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 94.73 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 94.31 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 94.28 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 94.2 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 94.16 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 93.92 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 93.9 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 93.88 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 93.49 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 93.38 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 93.15 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 93.14 | |
| COG4845 | 219 | Chloramphenicol O-acetyltransferase [Defense mecha | 93.1 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 93.1 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 93.06 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 93.02 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 92.9 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 92.9 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 92.81 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 92.8 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 92.71 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 92.51 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 92.31 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 92.27 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 92.14 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 92.12 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 92.08 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 92.08 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 91.64 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 91.63 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 91.51 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 91.42 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 91.13 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 91.08 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 90.52 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 90.38 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 90.16 | |
| PF02749 | 88 | QRPTase_N: Quinolinate phosphoribosyl transferase, | 89.95 | |
| KOG3373 | 172 | consensus Glycine cleavage system H protein (lipoa | 89.93 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 89.52 | |
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 89.48 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 89.15 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 89.05 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 88.3 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 88.18 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 88.05 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 88.0 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 87.93 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 87.28 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 86.85 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 86.34 | |
| COG4072 | 161 | Uncharacterized protein conserved in archaea [Func | 86.28 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 86.14 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 86.13 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 84.31 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 84.18 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 84.06 | |
| TIGR00164 | 189 | PS_decarb_rel phosphatidylserine decarboxylase pre | 83.89 | |
| cd00210 | 124 | PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s | 83.59 | |
| COG2190 | 156 | NagE Phosphotransferase system IIA components [Car | 83.5 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 83.2 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 83.2 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 83.09 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 83.03 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 82.66 | |
| TIGR00830 | 121 | PTBA PTS system, glucose subfamily, IIA component. | 82.57 | |
| PRK05305 | 206 | phosphatidylserine decarboxylase; Provisional | 82.33 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 82.28 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 81.95 | |
| PF00358 | 132 | PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph | 81.77 |
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.4e-57 Score=452.65 Aligned_cols=329 Identities=62% Similarity=0.902 Sum_probs=236.4
Q ss_pred Ccc-ceeeeccc---chhhhccccccccCccccchhh---hh--hhhcccceeeeccceee--cCCcccccCCCchhhhh
Q 018779 1 MIW-GIVRRKIT---SAQVIGQSVSKIGPRCHATAQK---EA--ILTCRGFQRVQRSSYHI--LSGNYVCSTPRSEVIEL 69 (350)
Q Consensus 1 ~~~-~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~---~~--~~~~~~~~~~~~~s~~~--~~~~~~~~~~~~~~~~~ 69 (350)
||+ +++||.-+ |+++.+.+++.-+-..++.|.. +. ++|.+...| |||- +.++-.|..+.+...
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~-- 74 (463)
T PLN02226 1 MMLRAVIRRASTRGSSPSLFGKSLQSSRVAASSPSLLSGSETGALLHRGNHAH----SFHNLALPGNSGISRSASLVS-- 74 (463)
T ss_pred CcHHHHHHhhccCCCChhhhhhhhhhchhhccCcccccccccchhhhcccccc----chhhcccCCccccCCchhhhh--
Confidence 554 55665544 8999998888776554333332 22 444443332 3443 344445555543222
Q ss_pred hhcCCccccccccccCCCCceEEEEccCCCCCCCeEEEEEEEcCCCCeecCCCeEEEEEcCCeeceecCCCCeEEEEEee
Q 018779 70 IQKGSFIGSRSRLFSSDSGDLVDAVVPFMGESITDGTLAKFLKQPGDRVEMDEPIAQIETDKVTIDVASPQAGVIQNLIA 149 (350)
Q Consensus 70 ~~~~~~~~~~~r~~~~~~~~~~~i~~P~lG~~m~eg~I~~w~v~~Gd~V~~gd~l~evetdKa~~ei~ap~~G~l~~i~~ 149 (350)
.+.++|.|.|....+.+++|+||+||++|+||+|++|+|++||.|++||+||+|||||+.+||+||++|+|.+|++
T Consensus 75 ----~~~~~~~~~~~~~~~~m~~i~mP~lg~~~~eG~I~~w~v~~GD~V~~Gq~L~~VEtdK~~~eI~Ap~~G~v~~ilv 150 (463)
T PLN02226 75 ----STLQRWVRPFSSESGDTVEAVVPHMGESITDGTLATFLKKPGERVQADEAIAQIETDKVTIDIASPASGVIQEFLV 150 (463)
T ss_pred ----hhhhhcccccccccCCceEEecCCCCCCcceEEEEEEEeCCCCEecCCCEEEEEEecceeeEEecCCCeEEEEEEe
Confidence 2345788999888777799999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCEeCCCCEEEEEEeCCCccccccccccccCCCCCCCCCCCCcCCCCCcccCcccccCC-CCCCCCCCCCCCCCCCCC
Q 018779 150 KEGETVEPGAKIAVISKSGEGVAQAASAEKAAAQPPPAEEKPSAEKQTPESEAAPAVKDKT-PSEPPPTAKKPTSPPSKP 228 (350)
Q Consensus 150 ~eG~~v~vG~~la~i~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~asP~vr~~~-~s~~~~~~~~~~~~~~~~ 228 (350)
++||.|++|++|++|+.+++..+...+..+.+....+.+..+........+.++|++|+.. ++++.+ .. .
T Consensus 151 ~eGd~V~vG~~L~~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~asp~~r~~~~~~~~~~----~~-----~ 221 (463)
T PLN02226 151 KEGDTVEPGTKVAIISKSEDAASQVTPSQKIPETTDPKPSPPAEDKQKPKVESAPVAEKPKAPSSPPP----PK-----Q 221 (463)
T ss_pred CCCCEecCCCEEEEeccCCccccccCccCCCCCCCCCCCCCccccccccCCCcchhhccccCCCCCCC----Cc-----c
Confidence 9999999999999997543221100000000000000000000001112345677776532 111100 00 0
Q ss_pred CCCCCCCCCCCCcceeeCchHHHHHHHHHHhccccccEEEEEeEEechHHHHHHHHHHHHHhhhCCCcccHHHHHHHHHH
Q 018779 229 MASEPQLPPKDRERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKLGLMSGFVKAAV 308 (350)
Q Consensus 229 ~~~~~~~~~~~~~~~vpls~~Rk~IA~~m~~S~~~iPh~t~~~evD~t~L~~lR~~lk~~~~~~~gvkls~~~fliKAva 308 (350)
....+..+....++.+||++|||.||++|++||+++||||++.|+|+|+|+++|+++|+.+.+++|+|+||++||+||++
T Consensus 222 ~~~~~~~~~~~~~~~ipls~~Rk~IA~~M~~S~~tiPh~t~~~evDvt~L~~lR~~l~~~~~~~~g~klS~~~~liKAva 301 (463)
T PLN02226 222 SAKEPQLPPKERERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFYEKHGVKLGLMSGFIKAAV 301 (463)
T ss_pred cccCcccccCCCceeeeChHHHHHHHHHHHHHHhcCCEEEEEEEEEcHHHHHHHHHHHhhhhhhcCCcccHHHHHHHHHH
Confidence 00000000111245689999999999999999999999999999999999999999998776667999999999999999
Q ss_pred HHHhhCCcceeEEeCCeEEEcCCccEEEEeecCCceeecC
Q 018779 309 SALQHQPVVNAVIDGDDIIYRDYIDISFAVGTKKVCDNSF 348 (350)
Q Consensus 309 ~AL~~~P~lNa~~d~~~I~~~~~vnIGIAVdT~~GLi~~~ 348 (350)
+||++||++|++|+++.|+++++||||||||+++||++|-
T Consensus 302 ~AL~~~P~lNa~~~~~~i~~~~~vnIGvAV~t~~GLvVPV 341 (463)
T PLN02226 302 SALQHQPVVNAVIDGDDIIYRDYVDISIAVGTSKGLVVPV 341 (463)
T ss_pred HHHHhCCHhheEEcCCEEEEeCcccEEEEEECCCCEEecc
Confidence 9999999999999999999999999999999999999983
|
|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >PRK14843 dihydrolipoamide acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11857 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 | Back alignment and domain information |
|---|
| >PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >PRK13757 chloramphenicol acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PF02749 QRPTase_N: Quinolinate phosphoribosyl transferase, N-terminal domain; InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG4072 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein | Back alignment and domain information |
|---|
| >cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit | Back alignment and domain information |
|---|
| >COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >TIGR00830 PTBA PTS system, glucose subfamily, IIA component | Back alignment and domain information |
|---|
| >PRK05305 phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 350 | ||||
| 1c4t_A | 233 | Catalytic Domain From Trimeric Dihydrolipoamide Suc | 1e-21 | ||
| 1ghj_A | 79 | Solution Structure Of The Lipoyl Domain Of The 2- O | 8e-10 | ||
| 1pmr_A | 80 | Lipoyl Domain From The Dihydrolipoyl Succinyltransf | 1e-08 | ||
| 2l5t_A | 77 | Solution Nmr Structure Of E2 Lipoyl Domain From The | 2e-06 | ||
| 1b5s_A | 242 | Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt | 4e-06 | ||
| 3duf_I | 428 | Snapshots Of Catalysis In The E1 Subunit Of The Pyr | 4e-06 | ||
| 1lab_A | 80 | Three-Dimensional Structure Of The Lipoyl Domain Fr | 7e-06 | ||
| 3mae_A | 256 | Crystal Structure Of Probable Dihydrolipamide Acety | 3e-05 | ||
| 1zy8_L | 229 | The Crystal Structure Of Dihydrolipoamide Dehydroge | 8e-05 | ||
| 1dpb_A | 243 | Crystallographic And Enzymatic Investigations On Th | 9e-05 | ||
| 1dpc_A | 243 | Crystallographic And Enzymatic Investigations On Th | 9e-05 | ||
| 1dpd_A | 243 | Crystallographic And Enzymatic Investigations On Th | 1e-04 | ||
| 2dnc_A | 98 | Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain | 3e-04 | ||
| 1eaa_A | 243 | Atomic Structure Of The Cubic Core Of The Pyruvate | 3e-04 |
| >pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 | Back alignment and structure |
|
| >pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 | Back alignment and structure |
| >pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 | Back alignment and structure |
| >pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 | Back alignment and structure |
| >pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 | Back alignment and structure |
| >pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 | Back alignment and structure |
| >pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 | Back alignment and structure |
| >pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 | Back alignment and structure |
| >pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 | Back alignment and structure |
| >pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 | Back alignment and structure |
| >pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 350 | |||
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 7e-80 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 3e-63 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 4e-58 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 9e-46 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 2e-38 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 9e-34 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 2e-32 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 7e-30 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 4e-29 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 3e-28 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 7e-26 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 1e-22 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 5e-22 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 5e-16 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 1e-14 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 3e-14 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 2e-13 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 8e-13 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 3e-12 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 3e-12 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 8e-11 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 1e-10 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 2e-10 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 3e-09 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 1e-08 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 3e-07 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 2e-06 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 2e-06 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 2e-06 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 2e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-05 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 4e-06 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 7e-06 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 2e-05 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 3e-05 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 3e-05 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 4e-05 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 8e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
Score = 249 bits (638), Expect = 7e-80
Identities = 64/299 (21%), Positives = 113/299 (37%), Gaps = 48/299 (16%)
Query: 91 VDAVVPFMGESITDGTLAKFLKQPGDRVEMDEPIAQIETDKVTIDVASPQAGVIQNLIAK 150
+ +P +GE I +G + K+ +PGD V D+ + +++ DK +++ SP G + ++
Sbjct: 3 FEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVP 62
Query: 151 EGETVEPGAKIAVISKSGEGVAQAASAEKAAAQPPPAEEKPSAEKQTPESEAAPAVKDK- 209
EG G + + G E+ A+ E S E++ +
Sbjct: 63 EGTVATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAE 122
Query: 210 ---------TPS-----------------------------------EPPPTAKKPTSPP 225
PS P
Sbjct: 123 AGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAEEKA 182
Query: 226 SKPMASEPQLPPKDRERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDY 285
+ A + E R M+ +R+ +A + S++T +T +E D+T L+ R +
Sbjct: 183 APAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHRKKF 242
Query: 286 KDAFLEKHGVKLGLMSGFVKAAVSALQHQPVVNAVIDGD--DIIYRDYIDISFAVGTKK 342
K + G+KL + VKA VSAL+ PV+N ID + +II + Y +I A T +
Sbjct: 243 KAIA-AEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDR 300
|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 | Back alignment and structure |
|---|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Length = 217 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 350 | |||
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 100.0 | |
| 3mae_A | 256 | 2-oxoisovalerate dehydrogenase E2 component, dihyd | 99.96 | |
| 1scz_A | 233 | E2, dihydrolipoamide succinyltransferase; COA-depe | 99.95 | |
| 3l60_A | 250 | Branched-chain alpha-keto acid dehydrogenase; stru | 99.94 | |
| 3rqc_A | 224 | Probable lipoamide acyltransferase; alpha beta fol | 99.94 | |
| 1dpb_A | 243 | Dihydrolipoyl-transacetylase; dihydrolipoamide ace | 99.94 | |
| 2ii3_A | 262 | Lipoamide acyltransferase component of branched-C | 99.93 | |
| 3b8k_A | 239 | PDCE2;, dihydrolipoyllysine-residue acetyltransfer | 99.93 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.84 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.83 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.83 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.83 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.82 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.78 | |
| 1q23_A | 219 | Chloramphenicol acetyltransferase; CAT I, trimer, | 99.78 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.78 | |
| 3cla_A | 213 | Type III chloramphenicol acetyltransferase; transf | 99.77 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.76 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.75 | |
| 2i9d_A | 217 | Chloramphenicol acetyltransferase; structural geno | 99.75 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.74 | |
| 2xt6_A | 1113 | 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET | 99.72 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.7 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.67 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.58 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.47 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.45 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.43 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.41 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.38 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 99.35 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.34 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 99.33 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 99.25 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.19 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 99.17 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 99.16 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 98.98 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 98.92 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 98.87 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 98.84 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 98.43 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 98.42 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 98.42 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 98.16 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 98.1 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 98.09 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 98.05 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 97.84 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 97.8 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 97.69 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 97.62 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 97.49 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 97.42 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 96.86 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 96.79 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 96.78 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 96.58 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 96.45 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 96.35 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 96.31 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 96.1 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 95.84 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 95.69 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 95.35 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 95.35 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 95.28 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 95.09 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 95.02 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 94.86 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 94.82 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 94.71 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 94.65 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 94.16 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 94.1 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 93.87 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 93.85 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 93.55 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 93.05 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 92.99 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 92.93 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 92.85 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 92.79 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 92.72 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 92.39 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 92.38 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 92.19 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 92.11 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 92.07 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 91.42 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 90.49 | |
| 2auk_A | 190 | DNA-directed RNA polymerase beta' chain; sandwich- | 90.27 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 88.6 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 88.53 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 85.27 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 85.1 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 84.96 | |
| 3lu0_D | 1407 | DNA-directed RNA polymerase subunit beta'; E. coli | 84.44 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 83.9 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 82.06 |
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-52 Score=418.89 Aligned_cols=259 Identities=24% Similarity=0.365 Sum_probs=15.1
Q ss_pred ceEEEEccCCCCCCCeEEEEEEEcCCCCeecCCCeEEEEEcCCeeceecCCCCeEEEEEeeCCCCEeCCCCEEEEEEeCC
Q 018779 89 DLVDAVVPFMGESITDGTLAKFLKQPGDRVEMDEPIAQIETDKVTIDVASPQAGVIQNLIAKEGETVEPGAKIAVISKSG 168 (350)
Q Consensus 89 ~~~~i~~P~lG~~m~eg~I~~w~v~~Gd~V~~gd~l~evetdKa~~ei~ap~~G~l~~i~~~eG~~v~vG~~la~i~~~~ 168 (350)
|.++|+||+||++|+||+|++|+|++||.|++||+||+|||||++++|+||++|+|.++++++||.|.+|++|+.|+.++
T Consensus 1 M~~~i~mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vEt~K~~~~i~ap~~G~v~~i~v~~G~~V~~G~~l~~i~~~~ 80 (428)
T 3dva_I 1 MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPG 80 (428)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred CCeeEEcCCCCCCCccEEEEEEEcCCCCEECCCCEEEEEEeCCeeEEEecCCCeEEEEEEeCCCCEeCCCCEEEEEecCC
Confidence 45789999999999999999999999999999999999999999999999999999999999999999999999998755
Q ss_pred Ccccccc--c--cc---cccC-CCCCC----CCCC--C--C-cCCCCCcccCcccccC-----------CCCCCCCCCCC
Q 018779 169 EGVAQAA--S--AE---KAAA-QPPPA----EEKP--S--A-EKQTPESEAAPAVKDK-----------TPSEPPPTAKK 220 (350)
Q Consensus 169 ~~~~~~~--p--~~---~~~~-~~~~~----~~~~--~--~-~~~~~~~~asP~vr~~-----------~~s~~~~~~~~ 220 (350)
+...... + .. +.+. .+++. ..+. . . ......+.++|++|++ .++|+.+...+
T Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~asP~~R~lA~e~gvdl~~v~gtG~~GrI~k 160 (428)
T 3dva_I 81 YENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLK 160 (428)
T ss_dssp -----------------------------------------------CCCCCHHHHHHHHHTTCCGGGSCCCSTTSCCCT
T ss_pred ccccccccccccccccCCCcccCCccccccCCCccccccccccccccccccCHHHHHHHHHcCCCHHHCCCCCCCCceeH
Confidence 4321110 0 00 0000 00000 0000 0 0 0111235789999875 35676665433
Q ss_pred CCCC---------CCCCC----CCCCCC----CCCCCcceeeCchHHHHHHHHHHhccccccEEEEEeEEechHHHHHHH
Q 018779 221 PTSP---------PSKPM----ASEPQL----PPKDRERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRS 283 (350)
Q Consensus 221 ~~~~---------~~~~~----~~~~~~----~~~~~~~~vpls~~Rk~IA~~m~~S~~~iPh~t~~~evD~t~L~~lR~ 283 (350)
.+.. .+... ...+.. ......+++||++|||+||++|++||+++||||++.|||||+|+++|+
T Consensus 161 ~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~s~~Rk~ia~~m~~S~~~~P~~~~~~evDvt~l~~~rk 240 (428)
T 3dva_I 161 EDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHRK 240 (428)
T ss_dssp TTTTTTSCC-----------------------------------------------------------------------
T ss_pred HHHHHHhhccccccccccccccccCCCCccccccCCccccccCcHHHHHHHHHHHHhcccCCeEEEEEEEeHHHHHHHHH
Confidence 2210 00000 000000 011235789999999999999999999999999999999999999999
Q ss_pred HHHHHHhhhCCCcccHHHHHHHHHHHHHhhCCcceeEEeC--CeEEEcCCccEEEEeecCCceeecC
Q 018779 284 DYKDAFLEKHGVKLGLMSGFVKAAVSALQHQPVVNAVIDG--DDIIYRDYIDISFAVGTKKVCDNSF 348 (350)
Q Consensus 284 ~lk~~~~~~~gvkls~~~fliKAva~AL~~~P~lNa~~d~--~~I~~~~~vnIGIAVdT~~GLi~~~ 348 (350)
++|+.+ ++.|+|+||++||+||+++||++||.||++|++ ++|+++++|||||||+|++||++|.
T Consensus 241 ~~~~~~-~~~g~kls~~~~~ikAva~Al~~~P~~Na~~~~~~~~i~~~~~v~igiAV~t~~GL~vPv 306 (428)
T 3dva_I 241 KFKAIA-AEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPV 306 (428)
T ss_dssp -------------------------------------------------------------------
T ss_pred HhhhhH-hhcCCCcCHHHHHHHHHHHHHHhCHHhhheEecCCCeEEEcCccCeEEEEEcCCceEEee
Confidence 999764 356999999999999999999999999999998 7899999999999999999999874
|
| >3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A | Back alignment and structure |
|---|
| >3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 | Back alignment and structure |
|---|
| >3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A | Back alignment and structure |
|---|
| >2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* | Back alignment and structure |
|---|
| >3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 350 | ||||
| d1scza_ | 233 | c.43.1.1 (A:) Dihydrolipoamide succinyltransferase | 2e-30 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 1e-21 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 7e-21 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 2e-20 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 1e-19 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 2e-19 | |
| d1b5sa_ | 242 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 5e-17 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 1e-15 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 1e-14 | |
| d1dpba_ | 243 | c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { | 5e-14 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 3e-13 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 2e-12 | |
| d1q23a_ | 214 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 1e-11 | |
| d3claa_ | 213 | c.43.1.1 (A:) Chloramphenicol acetyltransferase, C | 2e-11 | |
| d1bdoa_ | 80 | b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox | 1e-06 |
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide succinyltransferase species: Escherichia coli [TaxId: 562]
Score = 113 bits (285), Expect = 2e-30
Identities = 59/102 (57%), Positives = 79/102 (77%)
Query: 241 ERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKLGLM 300
E+RVPMTRLRKRVA RL +++N+ A+LTTFNEV+M +M LR Y +AF ++HG++LG M
Sbjct: 4 EKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFM 63
Query: 301 SGFVKAAVSALQHQPVVNAVIDGDDIIYRDYIDISFAVGTKK 342
S +VKA V AL+ P VNA IDGDD++Y +Y D+S AV T +
Sbjct: 64 SFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPR 105
|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 350 | |||
| d1scza_ | 233 | Dihydrolipoamide succinyltransferase {Escherichia | 99.96 | |
| d1b5sa_ | 242 | Dihydrolipoamide acetyltransferase {Bacillus stear | 99.94 | |
| d1dpba_ | 243 | Dihydrolipoamide acetyltransferase {Azotobacter vi | 99.94 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.93 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.91 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.91 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.9 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.89 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.87 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.86 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.83 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.66 | |
| d3claa_ | 213 | Chloramphenicol acetyltransferase, CAT {Escherichi | 99.61 | |
| d1q23a_ | 214 | Chloramphenicol acetyltransferase, CAT {Escherichi | 99.61 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.48 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 97.27 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 97.19 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 97.16 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 96.67 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 96.53 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.45 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.11 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 95.88 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 95.37 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 95.23 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.13 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 94.56 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 92.9 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 91.4 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 90.73 | |
| d1qpoa2 | 115 | Quinolinic acid phosphoribosyltransferase (Nicotin | 89.12 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 87.91 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 87.04 | |
| d1uoua3 | 105 | Thymidine phosphorylase {Human (Homo sapiens) [Tax | 86.95 | |
| d1qapa2 | 122 | Quinolinic acid phosphoribosyltransferase (Nicotin | 86.37 | |
| d1o4ua2 | 103 | Quinolinic acid phosphoribosyltransferase (Nicotin | 85.94 | |
| d2tpta3 | 105 | Thymidine phosphorylase {Escherichia coli [TaxId: | 85.33 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 84.72 |
| >d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: CoA-dependent acyltransferases superfamily: CoA-dependent acyltransferases family: CAT-like domain: Dihydrolipoamide succinyltransferase species: Escherichia coli [TaxId: 562]
Probab=99.96 E-value=5.4e-30 Score=235.60 Aligned_cols=108 Identities=55% Similarity=0.872 Sum_probs=104.5
Q ss_pred CcceeeCchHHHHHHHHHHhccccccEEEEEeEEechHHHHHHHHHHHHHhhhCCCcccHHHHHHHHHHHHHhhCCccee
Q 018779 240 RERRVPMTRLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSDYKDAFLEKHGVKLGLMSGFVKAAVSALQHQPVVNA 319 (350)
Q Consensus 240 ~~~~vpls~~Rk~IA~~m~~S~~~iPh~t~~~evD~t~L~~lR~~lk~~~~~~~gvkls~~~fliKAva~AL~~~P~lNa 319 (350)
.++++||++|||+||++|++||+++||||++.|||+|+|+++|+++++.+.++.|.|+||++||+||++.||++||.+|+
T Consensus 3 ~ee~vpls~~rk~ia~~m~~S~~~iP~~~~~~evd~t~l~~~r~~~~~~~~~~~~~klt~~~~likA~a~aL~~~P~~Na 82 (233)
T d1scza_ 3 SEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNA 82 (233)
T ss_dssp SCCCCCCCHHHHHHHHHHHHHHTTSCEEEEEEEEECHHHHHHHHHHHHHHHHHHSSCCCSHHHHHHHHHHHHHHCTTTTC
T ss_pred CCcccCCcHHHHHHHHHHHHHhccCCeEEEEEEEEHHHHHHHHHHHHHhhHhhcCCccCHHHHHHHHHHHHHHhCchhhe
Confidence 45789999999999999999999999999999999999999999999888778899999999999999999999999999
Q ss_pred EEeCCeEEEcCCccEEEEeecCCceeec
Q 018779 320 VIDGDDIIYRDYIDISFAVGTKKVCDNS 347 (350)
Q Consensus 320 ~~d~~~I~~~~~vnIGIAVdT~~GLi~~ 347 (350)
+|++++|++++++||||||++++||++|
T Consensus 83 ~~~~~~i~~~~~vnIgiAv~~~~GL~vP 110 (233)
T d1scza_ 83 SIDGDDVVYHNYFDVSMAVSTPRGLVTP 110 (233)
T ss_dssp EEETTEEECCSSCCEEECEEETTEEECC
T ss_pred EEcCCeEEEeccceEEEEEEcCCCeEEe
Confidence 9999999999999999999999999998
|
| >d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d1qpoa2 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qapa2 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1o4ua2 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|