Citrus Sinensis ID: 019054


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDGISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYLDICWEKEGIDEGKSSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKKVSR
ccccEEEEEEEEccEEEcEEEEEEccccccHHHHHHHHHHHcccccccccccccccccccccEEEcccEEEcccccccccccccccccccccccccccccccccEEEccccccccccccEEEEccccccccccccEEEEEEEcHHHHHHHHHccccccccccccEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcc
ccccEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHccccEccccccEccccccEEEEEEcccEEEEccccccccccccccccccEcccccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHcccEcccccEcccEEEEEEEEccccccccccccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHc
marprcfldISIGVELEGRIIVEIYNDVIPKTAENFRALCtgekgigpntgvplhykgvRFHRVIKGFMiqggdisagdgtggesiyglkfedenfeLKHERKGMLSmanagpntngsqffitttrtshldgkhVVFGRVIKGMGVVRSIEHvmtgdndcpiadvtitdcgeipegaddgisnffndgdsypdwpadldqtpnELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYLDICwekegidegkssslrktksqiftnssacklKLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESFEKALklepndggiKKELAVAKKKVSR
marprcfldisigvelegRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHvmtgdndcpiaDVTITDCGEIPEGADDGISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYLDICWekegidegkssslrktksqiftnssacklkLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESFEKAlklepndggikkelavakkkvsr
MARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQggdisagdgtggESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDGISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYLDICWEKEGIDEGKSSSLRKTKSQIFTNSSACklklgdlkgalldTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKKVSR
****RCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENF*********************SQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDGISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYLDICWEKEGI**************IFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESF**************************
*ARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVR***************DVTITDCGEIPEGADDGISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYLDICWEKEGI*EGKSSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKK***
MARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDGISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYLDICWEKEGIDEGKSSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKEL*********
*ARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDGISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYLDICWEKEGIDEGKSSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKKVSR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDGISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYLDICWEKEGIDEGKSSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKKVSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query347 2.2.26 [Sep-21-2011]
Q9C566361 Peptidyl-prolyl cis-trans yes no 0.997 0.958 0.815 1e-171
Q6DGG0370 Peptidyl-prolyl cis-trans yes no 0.976 0.916 0.5 7e-91
Q9CR16370 Peptidyl-prolyl cis-trans yes no 0.976 0.916 0.497 2e-90
P26882370 Peptidyl-prolyl cis-trans yes no 0.982 0.921 0.488 7e-90
Q08752370 Peptidyl-prolyl cis-trans yes no 0.982 0.921 0.491 9e-89
P0C1I1364 Peptidyl-prolyl cis-trans N/A no 0.953 0.909 0.511 1e-88
Q9P3X9375 41 kDa peptidyl-prolyl ci N/A no 0.962 0.890 0.491 2e-83
Q4HXF6372 Peptidyl-prolyl cis-trans yes no 0.965 0.900 0.492 2e-79
Q4WIF3377 Peptidyl-prolyl cis-trans yes no 0.968 0.891 0.477 9e-79
Q5B4E7372 Peptidyl-prolyl cis-trans yes no 0.974 0.908 0.488 2e-78
>sp|Q9C566|CYP40_ARATH Peptidyl-prolyl cis-trans isomerase CYP40 OS=Arabidopsis thaliana GN=CYP40 PE=2 SV=1 Back     alignment and function desciption
 Score =  602 bits (1553), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 282/346 (81%), Positives = 307/346 (88%)

Query: 1   MARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVR 60
           M R +CF+DISIG ELEGRI++E+Y+DV+PKTAENFR LCTGEKG+GPNTGVPLHYKG R
Sbjct: 1   MGRSKCFMDISIGGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNR 60

Query: 61  FHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQF 120
           FHRVIKGFMIQGGDISA DGTGGESIYGLKF+DENFELKHERKGMLSMAN+GPNTNGSQF
Sbjct: 61  FHRVIKGFMIQGGDISANDGTGGESIYGLKFDDENFELKHERKGMLSMANSGPNTNGSQF 120

Query: 121 FITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDG 180
           FITTTRTSHLDGKHVVFGRV KGMGVVRSIEHV   +  CP  DV I DCGEIPEGADDG
Sbjct: 121 FITTTRTSHLDGKHVVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEIPEGADDG 180

Query: 181 ISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALR 240
           I +FF DGD YPDWP DL+++P ELSWWM  VD +K  GNEH+KKQDYKMALRKYRKALR
Sbjct: 181 ICDFFKDGDVYPDWPIDLNESPAELSWWMETVDFVKAHGNEHFKKQDYKMALRKYRKALR 240

Query: 241 YLDICWEKEGIDEGKSSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKA 300
           YLDICWEKEGIDE  S++LRKTKSQIFTNS+ACKLK GD KGALLDTEFAMRD D+NVKA
Sbjct: 241 YLDICWEKEGIDEETSTALRKTKSQIFTNSAACKLKFGDAKGALLDTEFAMRDEDNNVKA 300

Query: 301 LFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKKVS 346
           LFRQGQAYMALN+VDAA ES EKAL+ EPND GIKKE A   KK++
Sbjct: 301 LFRQGQAYMALNNVDAAAESLEKALQFEPNDAGIKKEYAAVMKKIA 346




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Involved in promoting the expression of the juvenile phase of vegetative development, and, to a lower extent, in regulating the positioning of floral buds, floral morphogenesis and the expression of HSPs.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q6DGG0|PPID_RAT Peptidyl-prolyl cis-trans isomerase D OS=Rattus norvegicus GN=Ppid PE=1 SV=3 Back     alignment and function description
>sp|Q9CR16|PPID_MOUSE Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus GN=Ppid PE=1 SV=3 Back     alignment and function description
>sp|P26882|PPID_BOVIN Peptidyl-prolyl cis-trans isomerase D OS=Bos taurus GN=PPID PE=1 SV=6 Back     alignment and function description
>sp|Q08752|PPID_HUMAN Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens GN=PPID PE=1 SV=3 Back     alignment and function description
>sp|P0C1I1|PPID_RHIO9 Peptidyl-prolyl cis-trans isomerase D OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp12 PE=3 SV=1 Back     alignment and function description
>sp|Q9P3X9|PPID_NEUCR 41 kDa peptidyl-prolyl cis-trans isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-41 PE=1 SV=1 Back     alignment and function description
>sp|Q4HXF6|PPID_GIBZE Peptidyl-prolyl cis-trans isomerase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CPR6 PE=3 SV=1 Back     alignment and function description
>sp|Q4WIF3|PPID_ASPFU Peptidyl-prolyl cis-trans isomerase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpr6 PE=3 SV=1 Back     alignment and function description
>sp|Q5B4E7|PPID_EMENI Peptidyl-prolyl cis-trans isomerase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpr6 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
225428707361 PREDICTED: peptidyl-prolyl cis-trans iso 0.997 0.958 0.855 0.0
255561673361 peptidyl-prolyl cis-trans isomerase d, p 0.997 0.958 0.864 1e-179
356521481361 PREDICTED: peptidyl-prolyl cis-trans iso 0.997 0.958 0.855 1e-178
224103535370 predicted protein [Populus trichocarpa] 0.997 0.935 0.843 1e-178
449438434361 PREDICTED: peptidyl-prolyl cis-trans iso 0.997 0.958 0.843 1e-177
363807868361 uncharacterized protein LOC100804110 [Gl 0.997 0.958 0.846 1e-176
224123292370 predicted protein [Populus trichocarpa] 0.997 0.935 0.841 1e-176
355329950362 cyclophilin 40 [Nicotiana tabacum] 0.997 0.955 0.841 1e-176
449517543361 PREDICTED: LOW QUALITY PROTEIN: peptidyl 0.997 0.958 0.841 1e-176
224081585361 predicted protein [Populus trichocarpa] 0.997 0.958 0.846 1e-176
>gi|225428707|ref|XP_002284980.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Vitis vinifera] gi|297741330|emb|CBI32461.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/346 (85%), Positives = 326/346 (94%)

Query: 1   MARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVR 60
           M RPRC+LDISIG ELEGR++VE+YND++P+TAENFRALCTGEKGIGPNTGVPLHYKGV 
Sbjct: 1   MGRPRCYLDISIGEELEGRVVVELYNDIVPRTAENFRALCTGEKGIGPNTGVPLHYKGVC 60

Query: 61  FHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQF 120
           FHRVI+GFMIQGGDISAG+GTGGESIYGLKFEDENFELKHERKGMLSMAN+G NTNGSQF
Sbjct: 61  FHRVIRGFMIQGGDISAGNGTGGESIYGLKFEDENFELKHERKGMLSMANSGANTNGSQF 120

Query: 121 FITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDG 180
           FITTTRTSHLDGKHVVFG+V+KGMGVVRSIEHV TGDNDCP  +V I DCGEIPEG D+G
Sbjct: 121 FITTTRTSHLDGKHVVFGKVVKGMGVVRSIEHVTTGDNDCPTVNVLIADCGEIPEGVDNG 180

Query: 181 ISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALR 240
           +SNFF DGD+YPDWPADLD+ PN+LSWW NAVDS+K FGNEH+KKQDYKMALRKYRKALR
Sbjct: 181 VSNFFKDGDTYPDWPADLDENPNDLSWWTNAVDSVKAFGNEHFKKQDYKMALRKYRKALR 240

Query: 241 YLDICWEKEGIDEGKSSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKA 300
           YLDICWEKEGIDE KSS LRKTKS IFTNSSACKLKLGDLKGALLDT+FAMRD ++NVKA
Sbjct: 241 YLDICWEKEGIDEEKSSCLRKTKSLIFTNSSACKLKLGDLKGALLDTDFAMRDEENNVKA 300

Query: 301 LFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKKVS 346
           L+RQGQAYMALND+DAA ESF+KAL+LEPNDGGIK+ELA AKKK++
Sbjct: 301 LYRQGQAYMALNDIDAAAESFKKALELEPNDGGIKRELAAAKKKIA 346




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255561673|ref|XP_002521846.1| peptidyl-prolyl cis-trans isomerase d, ppid, putative [Ricinus communis] gi|223538884|gb|EEF40482.1| peptidyl-prolyl cis-trans isomerase d, ppid, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356521481|ref|XP_003529384.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like [Glycine max] Back     alignment and taxonomy information
>gi|224103535|ref|XP_002313093.1| predicted protein [Populus trichocarpa] gi|222849501|gb|EEE87048.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449438434|ref|XP_004136993.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363807868|ref|NP_001241932.1| uncharacterized protein LOC100804110 [Glycine max] gi|255644776|gb|ACU22890.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224123292|ref|XP_002330280.1| predicted protein [Populus trichocarpa] gi|222871315|gb|EEF08446.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|355329950|dbj|BAL14274.1| cyclophilin 40 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|449517543|ref|XP_004165805.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase CYP40-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224081585|ref|XP_002306460.1| predicted protein [Populus trichocarpa] gi|222855909|gb|EEE93456.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
TAIR|locus:2044596361 SQN "SQUINT" [Arabidopsis thal 0.997 0.958 0.751 1.1e-142
ZFIN|ZDB-GENE-040625-34371 ppid "peptidylprolyl isomerase 0.979 0.916 0.453 1e-77
RGD|1303174370 Ppid "peptidylprolyl isomerase 0.976 0.916 0.461 1.5e-76
UNIPROTKB|F1RTY6370 PPID "Uncharacterized protein" 0.979 0.918 0.457 1.9e-76
MGI|MGI:1914988370 Ppid "peptidylprolyl isomerase 0.976 0.916 0.459 3.9e-76
UNIPROTKB|P26882370 PPID "Peptidyl-prolyl cis-tran 0.979 0.918 0.446 6.3e-76
UNIPROTKB|Q08752370 PPID "Peptidyl-prolyl cis-tran 0.979 0.918 0.452 4.5e-75
UNIPROTKB|E2QTC7372 PPID "Uncharacterized protein" 0.974 0.908 0.449 2.8e-73
UNIPROTKB|G4MYB7376 MGG_08104 "Peptidyl-prolyl cis 0.976 0.901 0.463 3.6e-73
DICTYBASE|DDB_G0283663354 ppiD "peptidylprolyl isomerase 0.942 0.923 0.466 4.1e-72
TAIR|locus:2044596 SQN "SQUINT" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1395 (496.1 bits), Expect = 1.1e-142, P = 1.1e-142
 Identities = 260/346 (75%), Positives = 285/346 (82%)

Query:     1 MARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVR 60
             M R +CF+DISIG ELEGRI++E+Y+DV+PKTAENFR LCTGEKG+GPNTGVPLHYKG R
Sbjct:     1 MGRSKCFMDISIGGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNR 60

Query:    61 FHRVIKGFMIQXXXXXXXXXXXXESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQF 120
             FHRVIKGFMIQ            ESIYGLKF+DENFELKHERKGMLSMAN+GPNTNGSQF
Sbjct:    61 FHRVIKGFMIQGGDISANDGTGGESIYGLKFDDENFELKHERKGMLSMANSGPNTNGSQF 120

Query:   121 FITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDG 180
             FITTTRTSHLDGKHVVFGRV KGMGVVRSIEHV   +  CP  DV I DCGEIPEGADDG
Sbjct:   121 FITTTRTSHLDGKHVVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEIPEGADDG 180

Query:   181 ISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALR 240
             I +FF DGD YPDWP DL+++P ELSWWM  VD +K  GNEH+KKQDYKMALRKYRKALR
Sbjct:   181 ICDFFKDGDVYPDWPIDLNESPAELSWWMETVDFVKAHGNEHFKKQDYKMALRKYRKALR 240

Query:   241 YLDICWEKEGIDEGKSSSLRKTKSQIFTNSSACXXXXXXXXXXXXXTEFAMRDGDDNVKA 300
             YLDICWEKEGIDE  S++LRKTKSQIFTNS+AC             TEFAMRD D+NVKA
Sbjct:   241 YLDICWEKEGIDEETSTALRKTKSQIFTNSAACKLKFGDAKGALLDTEFAMRDEDNNVKA 300

Query:   301 LFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKKVS 346
             LFRQGQAYMALN+VDAA ES EKAL+ EPND GIKKE A   KK++
Sbjct:   301 LFRQGQAYMALNNVDAAAESLEKALQFEPNDAGIKKEYAAVMKKIA 346




GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0006457 "protein folding" evidence=IEA
GO:0010050 "vegetative phase change" evidence=IMP
GO:0010582 "floral meristem determinacy" evidence=IGI
GO:0005829 "cytosol" evidence=IDA
ZFIN|ZDB-GENE-040625-34 ppid "peptidylprolyl isomerase D" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1303174 Ppid "peptidylprolyl isomerase D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTY6 PPID "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1914988 Ppid "peptidylprolyl isomerase D (cyclophilin D)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P26882 PPID "Peptidyl-prolyl cis-trans isomerase D" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q08752 PPID "Peptidyl-prolyl cis-trans isomerase D" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTC7 PPID "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G4MYB7 MGG_08104 "Peptidyl-prolyl cis-trans isomerase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283663 ppiD "peptidylprolyl isomerase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C566CYP40_ARATH5, ., 2, ., 1, ., 80.81500.99710.9584yesno
Q6BXZ7PPID_DEBHA5, ., 2, ., 1, ., 80.45650.97400.9135yesno
Q75A33PPID_ASHGO5, ., 2, ., 1, ., 80.42450.96820.9105yesno
Q6CBP4PPID_YARLI5, ., 2, ., 1, ., 80.44750.99420.9400yesno
Q4HXF6PPID_GIBZE5, ., 2, ., 1, ., 80.49270.96540.9005yesno
Q4WIF3PPID_ASPFU5, ., 2, ., 1, ., 80.47790.96820.8912yesno
P26882PPID_BOVIN5, ., 2, ., 1, ., 80.48830.98270.9216yesno
P53691PPID_YEAST5, ., 2, ., 1, ., 80.44160.98550.9218yesno
Q9CR16PPID_MOUSE5, ., 2, ., 1, ., 80.49700.97690.9162yesno
Q6FNU6PPID_CANGA5, ., 2, ., 1, ., 80.43380.95380.8921yesno
Q2U0E0PPID_ASPOR5, ., 2, ., 1, ., 80.45890.97690.9137yesno
Q6CL78PPID_KLULA5, ., 2, ., 1, ., 80.43580.97980.9139yesno
Q11004PPID_SCHPO5, ., 2, ., 1, ., 80.42280.93370.9101yesno
Q6DGG0PPID_RAT5, ., 2, ., 1, ., 80.50.97690.9162yesno
Q5B4E7PPID_EMENI5, ., 2, ., 1, ., 80.48870.97400.9086yesno
P0CP80PPID_CRYNJ5, ., 2, ., 1, ., 80.42270.98270.9093yesno
P0C1I1PPID_RHIO95, ., 2, ., 1, ., 80.51140.95380.9093N/Ano
Q08752PPID_HUMAN5, ., 2, ., 1, ., 80.49120.98270.9216yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.983
4th Layer5.2.1.80.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00036534001
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (361 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 2e-99
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 1e-81
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 4e-71
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 4e-64
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 3e-59
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 4e-57
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 3e-56
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 3e-52
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 3e-49
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 4e-48
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 8e-38
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 1e-35
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 6e-28
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 8e-22
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 1e-14
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 2e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 8e-13
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 2e-10
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 7e-08
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 1e-07
smart0002834 smart00028, TPR, Tetratricopeptide repeats 2e-07
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-07
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 2e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-06
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-06
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-05
pfam1342844 pfam13428, TPR_14, Tetratricopeptide repeat 8e-05
pfam1317433 pfam13174, TPR_6, Tetratricopeptide repeat 1e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-04
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.001
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.002
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.002
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.004
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.004
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
 Score =  290 bits (744), Expect = 2e-99
 Identities = 111/168 (66%), Positives = 130/168 (77%), Gaps = 4/168 (2%)

Query: 4   PRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHR 63
           P+ F DI+IG E  GRI++E++ DV+PKTAENFRALCTGEKG G   G P  YKG  FHR
Sbjct: 1   PKVFFDITIGGEPAGRIVMELFADVVPKTAENFRALCTGEKGKG---GKPFGYKGSTFHR 57

Query: 64  VIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFIT 123
           VI  FMIQGGD + G+GTGG+SIYG KF DENF+LKH   G+LSMANAGPNTNGSQFFIT
Sbjct: 58  VIPDFMIQGGDFTRGNGTGGKSIYGEKFPDENFKLKHTGPGLLSMANAGPNTNGSQFFIT 117

Query: 124 TTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCG 171
           T +T  LDGKHVVFG+V++GM VV+ IE+V +G N  P   V I DCG
Sbjct: 118 TVKTPWLDGKHVVFGKVVEGMDVVKKIENVGSG-NGKPKKKVVIADCG 164


This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. These enzymes have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. As cyclophilins, Human hCyP-A, human cyclophilin-B (hCyP-19), S. cerevisiae Cpr1 and C. elegans Cyp-3, are inhibited by the immunosuppressive drug cyclopsporin A (CsA). CsA binds to the PPIase active site. Cyp-3. S. cerevisiae Cpr1 interacts with the Rpd3 - Sin3 complex and in addition is a component of the Set3 complex. S. cerevisiae Cpr1 has also been shown to have a role in Zpr1p nuclear transport. Human cyclophilin H associates with the [U4/U6.U5] tri-snRNP particles of the splicesome. Length = 164

>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222121 pfam13428, TPR_14, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|221956 pfam13174, TPR_6, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 347
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
PTZ00221249 cyclophilin; Provisional 100.0
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PTZ00060183 cyclophilin; Provisional 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
KOG0883518 consensus Cyclophilin type, U box-containing pepti 100.0
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
KOG0885439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
KOG0553 304 consensus TPR repeat-containing protein [General f 99.87
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.86
KOG4234271 consensus TPR repeat-containing protein [General f 99.78
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.74
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.68
PRK15359144 type III secretion system chaperone protein SscB; 99.65
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.64
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.64
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.6
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.54
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.53
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.52
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.49
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.45
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.44
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.44
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.41
PRK10370198 formate-dependent nitrite reductase complex subuni 99.41
PRK11189 296 lipoprotein NlpI; Provisional 99.41
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 99.38
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.38
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.36
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.33
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.3
PRK15359144 type III secretion system chaperone protein SscB; 99.25
KOG1126638 consensus DNA-binding cell division cycle control 99.25
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.23
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.23
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.22
KOG1155 559 consensus Anaphase-promoting complex (APC), Cdc23 99.22
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.21
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.2
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.2
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.19
PRK15331165 chaperone protein SicA; Provisional 99.19
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.19
PRK12370 553 invasion protein regulator; Provisional 99.18
PRK10370198 formate-dependent nitrite reductase complex subuni 99.17
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.17
PRK12370553 invasion protein regulator; Provisional 99.17
KOG1126638 consensus DNA-binding cell division cycle control 99.16
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.16
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.16
KOG1125579 consensus TPR repeat-containing protein [General f 99.14
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.13
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.13
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 99.11
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.11
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.1
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.1
PRK11189 296 lipoprotein NlpI; Provisional 99.08
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.07
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.06
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.06
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.05
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.04
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.04
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.02
PRK10803263 tol-pal system protein YbgF; Provisional 99.01
PF1337173 TPR_9: Tetratricopeptide repeat 99.01
KOG4555175 consensus TPR repeat-containing protein [Function 99.01
PLN02789 320 farnesyltranstransferase 99.0
KOG2003 840 consensus TPR repeat-containing protein [General f 98.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.97
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.92
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.91
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.9
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.9
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.9
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.9
PF13512142 TPR_18: Tetratricopeptide repeat 98.9
KOG2076 895 consensus RNA polymerase III transcription factor 98.89
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.88
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.88
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.87
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.86
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.85
PRK11788389 tetratricopeptide repeat protein; Provisional 98.84
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.84
PLN02789 320 farnesyltranstransferase 98.83
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.79
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.78
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.78
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.78
KOG0553 304 consensus TPR repeat-containing protein [General f 98.78
KOG1129478 consensus TPR repeat-containing protein [General f 98.77
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.75
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.75
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.75
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.75
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.73
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.71
PF12688120 TPR_5: Tetratrico peptide repeat 98.71
KOG1310 758 consensus WD40 repeat protein [General function pr 98.69
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.68
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.68
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.68
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.67
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.67
PRK14574 822 hmsH outer membrane protein; Provisional 98.67
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.66
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.65
PF1337173 TPR_9: Tetratricopeptide repeat 98.65
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.64
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.62
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.61
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.6
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.59
KOG1125 579 consensus TPR repeat-containing protein [General f 98.55
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.55
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.53
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.53
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.49
PRK14574 822 hmsH outer membrane protein; Provisional 98.48
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.47
KOG2076 895 consensus RNA polymerase III transcription factor 98.47
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.4
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.37
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.37
PRK11906458 transcriptional regulator; Provisional 98.36
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.35
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 98.35
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.33
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.33
PF12688120 TPR_5: Tetratrico peptide repeat 98.32
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.32
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.28
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.27
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.26
PRK11906458 transcriptional regulator; Provisional 98.25
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.25
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.22
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.21
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.21
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.19
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.19
PF1342844 TPR_14: Tetratricopeptide repeat 98.19
COG4700251 Uncharacterized protein conserved in bacteria cont 98.19
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.18
PF1343134 TPR_17: Tetratricopeptide repeat 98.18
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.17
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.16
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.16
KOG1129 478 consensus TPR repeat-containing protein [General f 98.15
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.14
PRK10803263 tol-pal system protein YbgF; Provisional 98.13
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.12
PF1342844 TPR_14: Tetratricopeptide repeat 98.12
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 98.12
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.11
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.1
PRK15331165 chaperone protein SicA; Provisional 98.09
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.06
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.05
KOG2003 840 consensus TPR repeat-containing protein [General f 98.04
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.03
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.03
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.03
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.02
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.02
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.0
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 98.0
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.99
KOG4555175 consensus TPR repeat-containing protein [Function 97.98
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 97.98
PF13512142 TPR_18: Tetratricopeptide repeat 97.96
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.96
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.94
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.92
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 97.87
PRK10941269 hypothetical protein; Provisional 97.86
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.84
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.82
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.81
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.8
KOG4234271 consensus TPR repeat-containing protein [General f 97.78
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.77
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.76
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.75
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.71
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.7
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 97.62
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.61
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.55
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.54
KOG4814 872 consensus Uncharacterized conserved protein [Funct 97.53
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.5
PF1343134 TPR_17: Tetratricopeptide repeat 97.5
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.49
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.48
KOG3364149 consensus Membrane protein involved in organellar 97.45
KOG1586288 consensus Protein required for fusion of vesicles 97.41
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.4
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.37
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.37
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.34
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.3
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.3
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.26
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.25
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.24
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.23
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.21
KOG2471 696 consensus TPR repeat-containing protein [General f 97.19
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.18
COG4105 254 ComL DNA uptake lipoprotein [General function pred 97.18
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.15
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.13
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.12
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.11
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.1
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.08
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.07
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.03
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.96
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.95
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.95
PF06552 186 TOM20_plant: Plant specific mitochondrial import r 96.93
COG2912269 Uncharacterized conserved protein [Function unknow 96.91
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.9
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.9
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.83
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.79
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.75
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.75
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.74
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.73
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.66
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.64
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.55
COG4700251 Uncharacterized protein conserved in bacteria cont 96.54
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.54
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.53
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.5
KOG2471 696 consensus TPR repeat-containing protein [General f 96.4
PRK04841 903 transcriptional regulator MalT; Provisional 96.35
KOG1586288 consensus Protein required for fusion of vesicles 96.31
PRK04841 903 transcriptional regulator MalT; Provisional 96.27
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.24
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 96.23
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.21
KOG1585 308 consensus Protein required for fusion of vesicles 96.14
PRK00969508 hypothetical protein; Provisional 96.11
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.08
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.08
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 96.06
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.06
PLN03077 857 Protein ECB2; Provisional 95.99
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.97
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.95
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.91
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 95.84
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.77
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.71
PLN03218 1060 maturation of RBCL 1; Provisional 95.66
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 95.62
PLN03218 1060 maturation of RBCL 1; Provisional 95.61
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.59
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.58
COG4976 287 Predicted methyltransferase (contains TPR repeat) 95.55
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.53
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.51
COG3629280 DnrI DNA-binding transcriptional activator of the 95.49
PRK00969508 hypothetical protein; Provisional 95.48
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.46
PRK10941269 hypothetical protein; Provisional 95.44
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 95.39
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.26
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.25
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 95.23
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.13
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.08
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.01
PLN03077 857 Protein ECB2; Provisional 94.99
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.82
COG3947361 Response regulator containing CheY-like receiver a 94.77
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.7
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.59
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 94.47
KOG1585 308 consensus Protein required for fusion of vesicles 94.21
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.1
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 94.08
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 94.04
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.02
KOG2300 629 consensus Uncharacterized conserved protein [Funct 94.0
COG5191 435 Uncharacterized conserved protein, contains HAT (H 93.97
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.96
KOG3364149 consensus Membrane protein involved in organellar 93.83
PHA02537230 M terminase endonuclease subunit; Provisional 93.78
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.66
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 93.54
COG3898 531 Uncharacterized membrane-bound protein [Function u 93.52
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 93.48
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 93.23
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 93.18
KOG4814 872 consensus Uncharacterized conserved protein [Funct 93.04
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 93.02
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 92.88
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 92.81
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 92.72
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.67
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.54
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.17
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 92.07
KOG4507 886 consensus Uncharacterized conserved protein, conta 92.05
COG2976207 Uncharacterized protein conserved in bacteria [Fun 91.95
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 91.82
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 91.79
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.78
KOG2422 665 consensus Uncharacterized conserved protein [Funct 91.66
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 91.26
KOG1550 552 consensus Extracellular protein SEL-1 and related 90.76
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 90.7
PF13281374 DUF4071: Domain of unknown function (DUF4071) 90.66
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 90.58
KOG1310 758 consensus WD40 repeat protein [General function pr 90.55
COG3898 531 Uncharacterized membrane-bound protein [Function u 90.52
PF0421269 MIT: MIT (microtubule interacting and transport) d 90.21
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.02
KOG1550 552 consensus Extracellular protein SEL-1 and related 89.94
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 89.81
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 89.68
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.65
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 89.52
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 89.29
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 89.27
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.25
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 89.22
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 88.89
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 88.85
COG2912269 Uncharacterized conserved protein [Function unknow 88.16
COG4455 273 ImpE Protein of avirulence locus involved in tempe 88.07
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 88.06
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 87.82
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 87.07
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 87.06
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 87.0
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 86.98
KOG2581 493 consensus 26S proteasome regulatory complex, subun 86.65
KOG2047 835 consensus mRNA splicing factor [RNA processing and 86.64
cd0267979 MIT_spastin MIT: domain contained within Microtubu 86.51
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 86.39
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 86.31
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 86.26
KOG2300 629 consensus Uncharacterized conserved protein [Funct 86.25
COG3118304 Thioredoxin domain-containing protein [Posttransla 86.19
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 85.92
KOG2047 835 consensus mRNA splicing factor [RNA processing and 85.68
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 85.61
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 85.43
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 85.35
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.03
smart0074577 MIT Microtubule Interacting and Trafficking molecu 84.96
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 84.43
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 84.34
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 84.3
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 83.92
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.84
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 83.48
KOG1839 1236 consensus Uncharacterized protein CLU1/cluA/TIF31 83.41
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 83.24
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 83.08
cd0265675 MIT MIT: domain contained within Microtubule Inter 82.97
KOG1839 1236 consensus Uncharacterized protein CLU1/cluA/TIF31 82.92
KOG0529 421 consensus Protein geranylgeranyltransferase type I 82.69
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 82.56
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 82.46
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 82.1
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 80.86
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 80.14
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 80.07
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=2.3e-83  Score=559.42  Aligned_cols=343  Identities=55%  Similarity=0.835  Sum_probs=316.4

Q ss_pred             CCeEEEEEEECCeeeeeEEEEEcCCCCCcchHhHHhhhccCCCCCCCCCCcccccCCeeEEEecCceEEeccCCCCCCCC
Q 019054            3 RPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDGTG   82 (347)
Q Consensus         3 ~~~v~~~~~~~~~~~G~i~i~L~~~~~P~~~~nf~~l~~~~~~~~~~~~~~~~y~g~~~~rv~~~~~iq~G~~~~~~~~~   82 (347)
                      ||+|||||+|+|.+.||||||||.|+||+||+||+.||+|.++.+..+|++|+|+|+.|||||++|||||||++.++|+|
T Consensus         8 ~pr~ffDISI~ge~~GRIvfeLf~dv~PKTaENFraLCtGE~G~~~~~gk~L~YKG~~FHRViK~FMiQgGDfs~gnGtG   87 (372)
T KOG0546|consen    8 NPRVFFDISIGGEPAGRIVFELFNDVVPKTAENFRALCTGEKGGGLTTGKPLHYKGSRFHRVIKNFMIQGGDFSEGNGTG   87 (372)
T ss_pred             CceEEEEEEeCCcccceEEEEeecccCchhHHHHHHHhccccCCCCCCCCeeeecCchhheeeecceeeccccccCCCCC
Confidence            89999999999999999999999999999999999999999997778999999999999999999999999999999999


Q ss_pred             CCcccCCCCCCCccccCCCCccEEEeeeCCCCCCCceEEEecCCCCCCCCCCceeeEEEeChHHHHHHhcccCCCCCccc
Q 019054           83 GESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPI  162 (347)
Q Consensus        83 ~~~~~~~~~~~e~~~~~~~~~g~~~~~~~~~~~~~sqF~i~~~~~~~l~~~~~vfG~v~~g~~vl~~I~~~~~~~~~~P~  162 (347)
                      |.||||.+|+||||.++|+++++|||||.||||||||||||+.++|||||+|+|||+|+.|++||+.|+++.++....|.
T Consensus        88 GeSIYG~~FdDEnF~lKHdrpflLSMAN~GpNTNgSQFFITT~p~PHLdGkHVVFGqVI~G~~VVr~IEn~~~d~~skP~  167 (372)
T KOG0546|consen   88 GESIYGEKFDDENFELKHDRPFLLSMANRGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGKEVVREIENLETDEESKPL  167 (372)
T ss_pred             cccccccccccccceeccCcchhhhhhcCCCCCCCcceEEeCCCCCCcCCceeEEeeEeechhHHHHHhccccccCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999988999


Q ss_pred             cceEeccceecCCC----CCCCCCCcCCCCCCCCCCCCCCCCC-cchhHHHHhhHHHHHHcCccccchhhHHHHHHHHHH
Q 019054          163 ADVTITDCGEIPEG----ADDGISNFFNDGDSYPDWPADLDQT-PNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRK  237 (347)
Q Consensus       163 ~~v~I~~~g~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~a~~~~~~g~~~~~~g~y~~A~~~y~~  237 (347)
                      .+|+|.+||++...    ..+.....++.++.++++|.++..+ ..+..+.++.+...++.|+..|++++|..|...|.+
T Consensus       168 ~dV~I~dCGel~~~~~~~~~~~a~~~~~sgd~~~d~p~~~~~~~~~~~~~~~~~~~~~k~~~~~~~kk~~~~~a~~k~~k  247 (372)
T KOG0546|consen  168 ADVVISDCGELVKKSKVKEDAGASEPDETGDSYEDYPKDDRSWDDKDFDKALEREEKKKNIGNKEFKKQRYREALAKYRK  247 (372)
T ss_pred             cceEecccccccccccccccccCCCCCCCCCcccccccccccccccccchhhhhhhhhhccchhhhhhccHhHHHHHHHH
Confidence            99999999999877    5677777899999999999776553 456667788889999999999999999999999999


Q ss_pred             HHHHhhhccccCCCChhh--hhhHHhhHHHHHHHHHHHHHHcCChHHHHHHHHHHhhcCCCChhHHHHHHHHHHhcCCHH
Q 019054          238 ALRYLDICWEKEGIDEGK--SSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVD  315 (347)
Q Consensus       238 al~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~nla~~~~~l~~~~~A~~~~~~al~~~p~~~~a~~~~g~~~~~~~~~~  315 (347)
                      ++++..+ .+........  ..........++.|++.|-++++.+..|+..+..+++.+++..+++|++++++..+.+++
T Consensus       248 ~~r~~~~-~s~~~~~e~~~~~~~~~~~r~~~~~n~~~~~lk~~~~~~a~~~~~~~~~~~~s~tka~~Rr~~~~~~~~~~~  326 (372)
T KOG0546|consen  248 ALRYLSE-QSRDREKEQENRIPPLRELRFSIRRNLAAVGLKVKGRGGARFRTNEALRDERSKTKAHYRRGQAYKLLKNYD  326 (372)
T ss_pred             Hhhhhcc-cccccccccccccccccccccccccchHHhcccccCCCcceeccccccccChhhCcHHHHHHhHHHhhhchh
Confidence            9999886 3322222221  244666777889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhCCCCHHHHHHHHHHHHHhc
Q 019054          316 AAVESFEKALKLEPNDGGIKKELAVAKKKVS  346 (347)
Q Consensus       316 ~A~~~~~~al~l~P~~~~~~~~l~~~~~~~~  346 (347)
                      +|+++++.+....|++.++...+..+++.++
T Consensus       327 ~a~~~~~~a~~~~p~d~~i~~~~~~~~~~~~  357 (372)
T KOG0546|consen  327 EALEDLKKAKQKAPNDKAIEEELENVRQKKK  357 (372)
T ss_pred             hhHHHHHHhhccCcchHHHHHHHHHhhhHHH
Confidence            9999999999999999999999988877653



>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 3e-80
1dyw_A173 Biochemical And Structural Characterization Of A Di 2e-51
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 3e-50
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 3e-50
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 1e-49
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 7e-48
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 2e-46
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 1e-44
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 1e-44
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 9e-44
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 2e-43
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 2e-43
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 3e-43
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 4e-43
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 6e-43
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 7e-43
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 8e-43
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 8e-43
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 9e-43
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 1e-42
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 1e-42
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 1e-42
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 1e-42
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 1e-42
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 2e-42
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 2e-42
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 2e-42
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 4e-42
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 4e-42
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 4e-42
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 4e-42
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 4e-42
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 4e-42
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 7e-42
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 8e-42
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 1e-41
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 1e-41
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 2e-41
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 2e-41
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 1e-40
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 2e-40
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 2e-40
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 3e-40
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 6e-40
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 1e-39
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 1e-39
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 1e-38
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 2e-38
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 9e-37
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 2e-36
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 2e-36
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 3e-36
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 4e-35
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 2e-32
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 8e-28
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 8e-28
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 9e-28
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 1e-25
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 1e-25
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 3e-24
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 2e-23
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 8e-22
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 7e-21
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 9e-21
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 6e-20
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 2e-16
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 4e-15
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 8e-11
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 6e-09
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 6e-09
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 3e-08
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 3e-07
2if4_A338 Crystal Structure Of A Multi-Domain Immunophilin Fr 6e-07
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 9e-07
2ose_A234 Crystal Structure Of The Mimivirus Cyclophilin Leng 9e-07
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 2e-06
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 2e-06
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 2e-06
3rkv_A162 C-Terminal Domain Of Protein C56c10.10, A Putative 2e-06
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 3e-06
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 4e-06
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 4e-06
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 2e-05
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 5e-05
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 8e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-04
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure

Iteration: 1

Score = 295 bits (754), Expect = 3e-80, Method: Compositional matrix adjust. Identities = 154/344 (44%), Positives = 207/344 (60%), Gaps = 3/344 (0%) Query: 2 ARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRF 61 + PR F D+ IG E GRI++E++ D++PKTAENFRALCTGEKGIGP TG PLH+KG F Sbjct: 14 SNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPF 73 Query: 62 HRVIKGFMIQXXXXXXXXXXXXESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFF 121 HR+IK FMIQ ESIYG KFEDENF KH+++G+LSMANAG NTNGSQFF Sbjct: 74 HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFF 133 Query: 122 ITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDGI 181 ITT T HLDGKHVVFG+VIKGMGV + +E+V + P I +CGE+ EG D GI Sbjct: 134 ITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV-KGEKPAKLCVIAECGELKEGDDWGI 192 Query: 182 SNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRY 241 GDS+PD+P D D ++ + + +K GN +K Q+++MA++KY K LRY Sbjct: 193 FPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRY 252 Query: 242 LDICWEKEGIDEGKSSSLRKTKSQIFTNSSACXXXXXXXXXXXXXTEFAMRDGDDNVKAL 301 ++ + ++ + L+ N AC A+ N KAL Sbjct: 253 VE--GSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKAL 310 Query: 302 FRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKKV 345 +R+ Q + L + D A+ +KA ++ P D I+ EL K+K+ Sbjct: 311 YRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKI 354
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2OSE|A Chain A, Crystal Structure Of The Mimivirus Cyclophilin Length = 234 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 0.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 1e-124
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 1e-124
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 1e-123
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-117
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 1e-117
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-116
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-114
1z81_A229 Cyclophilin; structural genomics, structural genom 1e-112
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 1e-112
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 1e-110
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 1e-109
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-108
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 1e-108
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 1e-108
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 1e-108
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 1e-107
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 1e-107
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 1e-104
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-91
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 6e-80
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 4e-78
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 2e-76
2b71_A196 Cyclophilin-like protein; structural genomics, str 3e-75
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 2e-71
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 2e-71
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 8e-70
2hq6_A185 Serologically defined colon cancer antigen 10; pro 1e-67
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 5e-67
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 8e-66
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 1e-58
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-46
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 3e-46
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-45
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 4e-45
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 5e-45
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 5e-44
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-43
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-35
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 1e-33
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-28
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-27
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-25
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-24
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-24
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-24
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 8e-24
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-22
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-19
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 2e-19
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-17
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-13
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-13
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-11
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-04
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 3e-17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-17
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-14
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-13
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-11
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-06
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-17
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-14
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-13
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-08
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-13
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 2e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-08
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 2e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 9e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-12
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-07
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-06
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 4e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-11
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 9e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-06
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 9e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 6e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-09
3u4t_A 272 TPR repeat-containing protein; structural genomics 7e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-07
3u4t_A 272 TPR repeat-containing protein; structural genomics 1e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 6e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-06
2kat_A115 Uncharacterized protein; NESG, structure, structur 6e-09
2kat_A115 Uncharacterized protein; NESG, structure, structur 9e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 9e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-08
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-06
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-06
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-06
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 7e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-05
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-05
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-06
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 6e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 5e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 7e-06
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 2e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-06
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 8e-06
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 2e-04
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 4e-04
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 5e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 9e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-05
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 8e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-05
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 8e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-04
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 4e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 9e-04
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
 Score =  542 bits (1398), Expect = 0.0
 Identities = 168/345 (48%), Positives = 225/345 (65%), Gaps = 3/345 (0%)

Query: 1   MARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVR 60
            + PR F D+ IG E  GRI++E++ D++PKTAENFRALCTGEKGIGP TG PLH+KG  
Sbjct: 13  PSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCP 72

Query: 61  FHRVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQF 120
           FHR+IK FMIQGGD S  +GTGGESIYG KFEDENF  KH+++G+LSMANAG NTNGSQF
Sbjct: 73  FHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQF 132

Query: 121 FITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEIPEGADDG 180
           FITT  T HLDGKHVVFG+VIKGMGV + +E+V     + P     I +CGE+ EG D G
Sbjct: 133 FITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV-KGEKPAKLCVIAECGELKEGDDWG 191

Query: 181 ISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALR 240
           I      GDS+PD+P D D    ++   +   + +K  GN  +K Q+++MA++KY K LR
Sbjct: 192 IFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLR 251

Query: 241 YLDICWEKEGIDEGKSSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKA 300
           Y++    +   ++   + L+        N  ACKLK+ D +GA+     A+     N KA
Sbjct: 252 YVE--GSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKA 309

Query: 301 LFRQGQAYMALNDVDAAVESFEKALKLEPNDGGIKKELAVAKKKV 345
           L+R+ Q +  L + D A+   +KA ++ P D  I+ EL   K+K+
Sbjct: 310 LYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKI 354


>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.87
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.85
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.83
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.79
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.78
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.75
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.72
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.72
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.72
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.71
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.71
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.71
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.7
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.7
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.68
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.65
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.65
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.65
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.64
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.63
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.62
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.62
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.61
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.61
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.61
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.59
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.59
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.59
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.58
3k9i_A117 BH0479 protein; putative protein binding protein, 99.58
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.57
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 99.56
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.55
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.55
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.54
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.53
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.51
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.5
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.5
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.5
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.48
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.46
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.45
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.44
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.43
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.42
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.42
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.41
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.41
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.4
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.38
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.38
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.38
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 99.38
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.37
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.37
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.36
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.36
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.36
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.36
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.36
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.36
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.35
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.35
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.34
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.34
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.34
3u4t_A272 TPR repeat-containing protein; structural genomics 99.33
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.33
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.32
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.32
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.32
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.32
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.32
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.32
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.31
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.31
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.31
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.31
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.3
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.3
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.3
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.3
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.29
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.28
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.28
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.28
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.28
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.27
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.27
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.26
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.26
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.26
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.25
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.24
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.23
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.22
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.21
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.21
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.21
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.2
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.2
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.2
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.19
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.17
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.17
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.16
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.15
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.15
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.15
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.14
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.14
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.13
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 99.13
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.12
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.11
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.1
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.1
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.09
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.09
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.08
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.08
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.07
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 99.07
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 99.07
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.06
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.06
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.05
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 99.04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.03
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.02
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.01
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.01
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.0
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.0
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.99
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.99
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.99
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.99
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.99
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.99
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.97
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.97
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.96
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.96
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.95
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.95
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.95
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.94
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.93
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.92
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.92
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.91
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.91
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.91
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.91
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.91
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.91
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.9
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.88
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.88
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.88
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.88
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.87
3k9i_A117 BH0479 protein; putative protein binding protein, 98.87
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.86
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.85
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 98.85
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.84
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.79
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.78
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.77
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.74
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.73
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.72
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.71
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.71
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.69
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.65
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.64
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.62
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.62
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.52
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.49
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.48
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.42
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.41
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.4
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.36
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.35
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.33
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.24
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.23
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.21
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.19
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.18
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.16
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.08
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.02
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.02
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.98
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.97
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.93
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.92
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.87
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.82
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.6
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.59
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.43
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 97.36
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.35
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.23
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.2
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.9
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.73
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.69
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.48
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 95.98
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 95.84
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 95.03
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 94.77
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 94.66
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.37
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 94.07
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 93.7
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.23
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 92.59
3kop_A188 Uncharacterized protein; protein with A cyclophili 92.46
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 91.81
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.7
3mv2_A325 Coatomer subunit alpha; vesicular membrane coat CO 90.43
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 90.38
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 90.27
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 90.24
3mkr_B320 Coatomer subunit alpha; tetratricopeptide repeats 90.09
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 89.61
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 88.8
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.45
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 86.88
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 86.3
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 86.24
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 85.84
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 84.23
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 84.11
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 83.73
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 82.24
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 81.59
2dl1_A116 Spartin; SPG20, MIT, structural genomics, NPPSFA, 81.04
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 80.9
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
Probab=100.00  E-value=4.4e-73  Score=529.96  Aligned_cols=341  Identities=49%  Similarity=0.824  Sum_probs=314.4

Q ss_pred             CCeEEEEEEECCeeeeeEEEEEcCCCCCcchHhHHhhhccCCCCCCCCCCcccccCCeeEEEecCceEEeccCCCCCCCC
Q 019054            3 RPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDGTG   82 (347)
Q Consensus         3 ~~~v~~~~~~~~~~~G~i~i~L~~~~~P~~~~nf~~l~~~~~~~~~~~~~~~~y~g~~~~rv~~~~~iq~G~~~~~~~~~   82 (347)
                      ||+|||||+|+|++.|+|+||||++.||+||+||++||++.++.+...|+++||+||.||||||||||||||++.++|+|
T Consensus        15 ~~~v~~~~~~~~~~~G~i~~~l~~~~~P~t~~nf~~l~~~~~~~~~~~g~~~~y~~~~fhrv~~~f~~q~Gd~~~~~g~g   94 (370)
T 1ihg_A           15 NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTG   94 (370)
T ss_dssp             SCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHCTTCBCTTTSSBSCCTTCBEEEEETTTEEEECCTTTSSSSC
T ss_pred             CCeEEEEEEECCEecccEEEEEcCCCCchHHHHHHHHcCCCcCcCccCCCcceeCCcEeEEEECCcEEECCCCCCCCCCC
Confidence            89999999999999999999999999999999999999998877666688889999999999999999999999889999


Q ss_pred             CCcccCCCCCCCccccCCCCccEEEeeeCCCCCCCceEEEecCCCCCCCCCCceeeEEEeChHHHHHHhcccCCCCCccc
Q 019054           83 GESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPI  162 (347)
Q Consensus        83 ~~~~~~~~~~~e~~~~~~~~~g~~~~~~~~~~~~~sqF~i~~~~~~~l~~~~~vfG~v~~g~~vl~~I~~~~~~~~~~P~  162 (347)
                      ++|+||.+|+||++.++|+++|+|||+|.||||+|||||||+.+.|+||++|+|||+|++|++++++|+.++++. ++|.
T Consensus        95 ~~~~~~~~~~~e~~~~~~~~~g~l~ma~~~~~~~~sqffi~~~~~~~ld~~~~vfG~v~~g~~v~~~i~~~~~~~-~~P~  173 (370)
T 1ihg_A           95 GESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKG-EKPA  173 (370)
T ss_dssp             CCBTTBSCBCCCCCCBCCCSTTEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTSCEET-TEES
T ss_pred             CCCCCCCCcCCCcCCcCCCCCeEEEEeeCCCCCCCceEEEeCCCCcccCCCceEEEEEecCHHHHHHHHcCCCCC-Cccc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999998877 8999


Q ss_pred             cceEeccceecCCCCCCCCCCcCCCCCCCCCCCCCCCCCcchhHHHHhhHHHHHHcCccccchhhHHHHHHHHHHHHHHh
Q 019054          163 ADVTITDCGEIPEGADDGISNFFNDGDSYPDWPADLDQTPNELSWWMNAVDSIKVFGNEHYKKQDYKMALRKYRKALRYL  242 (347)
Q Consensus       163 ~~v~I~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~~~g~y~~A~~~y~~al~~~  242 (347)
                      .+|.|.+|+++....++.+...+..++.+++++.++.....+.+...+.+..++.+|+.+++.|+|++|+..|++|+++.
T Consensus       174 ~~v~I~~~g~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~~~g~~~~Ai~~y~kAl~~~  253 (370)
T 1ihg_A          174 KLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYTKVLRYV  253 (370)
T ss_dssp             SCEEEEEEEEECTTCCCCCSCCSSSCCCSCSSGGGSSSCTTCHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHH
T ss_pred             eeEEEEEEEEeccCccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHh
Confidence            99999999999887777776666788999999999876666788888899999999999999999999999999999976


Q ss_pred             hhccccCCCChhhhhhHHhhHHHHHHHHHHHHHHcCChHHHHHHHHHHhhcCCCChhHHHHHHHHHHhcCCHHHHHHHHH
Q 019054          243 DICWEKEGIDEGKSSSLRKTKSQIFTNSSACKLKLGDLKGALLDTEFAMRDGDDNVKALFRQGQAYMALNDVDAAVESFE  322 (347)
Q Consensus       243 ~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~~~~l~~~~~A~~~~~~al~~~p~~~~a~~~~g~~~~~~~~~~~A~~~~~  322 (347)
                      +...  .....+......+....+|.|+|.||+++++|++|+.+|++|++++|+++++++++|.+|..+|++++|+.+|+
T Consensus       254 ~~~~--~~~~~~~~~~~~~~~~~~~~nla~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~~~eA~~~l~  331 (370)
T 1ihg_A          254 EGSR--AAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALADLK  331 (370)
T ss_dssp             HHHH--HHSCHHHHGGGHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             hcCc--cccChHHHHHHHHHHHHHHHHHHHHHHhccCHHHHHHHHHHHHHhCchhHHHHHHHHHHHHHccCHHHHHHHHH
Confidence            5432  11223334457888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhCCCCHHHHHHHHHHHHHhc
Q 019054          323 KALKLEPNDGGIKKELAVAKKKVS  346 (347)
Q Consensus       323 ~al~l~P~~~~~~~~l~~~~~~~~  346 (347)
                      +|++++|++..++..+..+...++
T Consensus       332 ~Al~l~P~~~~~~~~l~~~~~~~~  355 (370)
T 1ihg_A          332 KAQEIAPEDKAIQAELLKVKQKIK  355 (370)
T ss_dssp             HHHHHCTTCHHHHHHHHHHHHHHH
T ss_pred             HHHHhCCCCHHHHHHHHHHHHHHH
Confidence            999999999999999998877653



>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2dl1_A Spartin; SPG20, MIT, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 347
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 3e-62
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 2e-61
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 2e-58
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 8e-56
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6e-55
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 2e-50
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 3e-50
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 2e-49
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 2e-49
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 4e-49
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 2e-48
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 7e-47
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 8e-47
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 6e-43
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 2e-42
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 5e-39
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 1e-36
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 9e-31
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 1e-30
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 3e-30
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 5e-26
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 7e-26
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 3e-24
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-16
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-16
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-15
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-12
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-10
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-10
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-09
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 7e-08
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-07
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 7e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 7e-04
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-07
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-05
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-04
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 2e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-05
d1hz4a_ 366 a.118.8.2 (A:) Transcription factor MalT domain II 8e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-05
d1xnfa_ 259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.004
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-04
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-04
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Nematode (Brugia malayi) [TaxId: 6279]
 Score =  194 bits (494), Expect = 3e-62
 Identities = 101/171 (59%), Positives = 124/171 (72%)

Query: 3   RPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFH 62
           R R FLD++I   L GRI++E+YND+ P+T  NF  LCTG  G G  +G PLHYKG  FH
Sbjct: 3   RRRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFH 62

Query: 63  RVIKGFMIQGGDISAGDGTGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFI 122
           RVIK FMIQGGD + GDGTGGESIYG  F+DE F +KH+   ++SMAN GPNTNGSQFFI
Sbjct: 63  RVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFI 122

Query: 123 TTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDCPIADVTITDCGEI 173
           TTT   HL+  HVVFG+V+ G  VV  IE++ T   + P+ADV I +CGE+
Sbjct: 123 TTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL 173


>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.9
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.87
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.86
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.86
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.82
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.76
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.67
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.64
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.59
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.55
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.55
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.5
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.49
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.49
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.48
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.48
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.45
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.39
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.34
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.34
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.3
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.29
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 99.26
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.25
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.24
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.09
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.04
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.02
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.97
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.95
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.95
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 98.91
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.84
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.8
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.75
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.65
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.54
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.53
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.52
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.48
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.39
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.36
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.32
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.32
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.11
d2onda1 308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.09
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.9
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.78
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.71
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.56
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 90.01
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 89.48
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 88.59
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 87.01
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 84.28
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 80.23
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Caenorhabditis elegans, isoform 3 [TaxId: 6239]
Probab=100.00  E-value=4.9e-48  Score=318.86  Aligned_cols=171  Identities=61%  Similarity=1.102  Sum_probs=160.9

Q ss_pred             CCCCeEEEEEEECCeeeeeEEEEEcCCCCCcchHhHHhhhccCCCCCCCCCCcccccCCeeEEEecCceEEeccCCCCCC
Q 019054            1 MARPRCFLDISIGVELEGRIIVEIYNDVIPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIKGFMIQGGDISAGDG   80 (347)
Q Consensus         1 ~~~~~v~~~~~~~~~~~G~i~i~L~~~~~P~~~~nf~~l~~~~~~~~~~~~~~~~y~g~~~~rv~~~~~iq~G~~~~~~~   80 (347)
                      |+||+|||||+|+++++|+|+||||.+.||+||+||++||++...... .++..||+||.||||+|+++||+|++..+++
T Consensus         1 ~~~~~v~~Di~i~~~~~G~i~ieL~~~~aP~tv~nF~~L~~~~~~~~~-~~k~~~y~~~~f~rv~~~~~i~~G~~~~~~~   79 (172)
T d2igva1           1 MSRSKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGK-SGKPLHFKGSKFHRIIPNFMIQGGDFTRGNG   79 (172)
T ss_dssp             CCCCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTTTCBCT-TSSBSCCTTCBCCEEETTTEEEECCTTTSSS
T ss_pred             CCCCEEEEEEEECCEeccEEEEEEcCCCCcHHHHHHHHHHhccccccc-cCcccccCCcceeEEEecceEEcCCccCCCC
Confidence            899999999999999999999999999999999999999998765432 4677799999999999999999999998899


Q ss_pred             CCCCcccCCCCCCCccccCCCCccEEEeeeCCCCCCCceEEEecCCCCCCCCCCceeeEEEeChHHHHHHhcccCCCCCc
Q 019054           81 TGGESIYGLKFEDENFELKHERKGMLSMANAGPNTNGSQFFITTTRTSHLDGKHVVFGRVIKGMGVVRSIEHVMTGDNDC  160 (347)
Q Consensus        81 ~~~~~~~~~~~~~e~~~~~~~~~g~~~~~~~~~~~~~sqF~i~~~~~~~l~~~~~vfG~v~~g~~vl~~I~~~~~~~~~~  160 (347)
                      +++.++++..+++|+....|+.+|+|+|++.+|++++|||||++++.|+||++|+|||+|++||++|++|+.+++. +++
T Consensus        80 ~~~~~~~~~~~~~e~~~~~~~~~G~lsma~~~~~~~~sqFfIt~~~~~~ld~~~~vFG~Vv~Gmdvl~~I~~~~~~-~g~  158 (172)
T d2igva1          80 TGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ-SGK  158 (172)
T ss_dssp             SCCCBTTBSCBCCCCCCSCCCSTTEEEECCSSTTCBSSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTTCCT-TSC
T ss_pred             CCCcccCCCccCccccccccCCCcEEEEeecCCCCcCceeEeeecCCcccCCceeEEEEEeccHHHHHHHHcCCCC-CCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999988765 489


Q ss_pred             cccceEeccceec
Q 019054          161 PIADVTITDCGEI  173 (347)
Q Consensus       161 P~~~v~I~~~g~~  173 (347)
                      |..+|.|.+||++
T Consensus       159 P~~~i~I~~cG~l  171 (172)
T d2igva1         159 PVKDCMIADCGQL  171 (172)
T ss_dssp             CSSCEEEEEEEEE
T ss_pred             CCCCeEEEecccc
Confidence            9999999999987



>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure