Citrus Sinensis ID: 019058

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MELVSCPSYRCTISPKILTSQNGESKRSPFVFSSLRNTKKPSALSFSNVVTRDGYVGRGSSSSFSGSTVNNKIYQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLPSVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESIGGTVEKVQLNGNHITPCIQVIHANSIFWAMSFTICV
cccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEcccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccccccccccccccccccHHHHccccHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHHHHccccccccccHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHccccccccccEEEEEccccccccHHHHHccccccccccEEEEc
cccccccccccccccccccccccccccccEEccccccccccccccccccccccccEEEccccccccccccccccEEcccEEEEccccccccEEEEEEEcHHHHHHcHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccccEEEEcccHHHHHHHHHHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHHccccHHHHHHccHHHHHHHcHHHHHHHHHccccccccHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHccccccccEEEEEccccccccccccccEEcccccccEEEEc
melvscpsyrctispkiltsqngeskrspfvfsslrntkkpsalsfsnvvtrdgyvgrgssssfsgstvnnKIYQRLgscliipplngkkpRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVisvpynvtfdhanAANQVYERFNSCLDYVLstglpdanltpddlvnlpiysvghrpateavpyfeqlgplvnqmmpiveaspvysMARNASGDAWKLLLNTAEalipgsdmesLVSLNNFvdqlpsvfgqvtegisefkptpsenldcfkksynvqhTLLVKFSFDTIDQTDLLEETLKPrmesiggtvekvqlngnhitpcIQVIHANSIFWAMSFTICV
melvscpsyrctispkiltsqngeskRSPFVFsslrntkkpsalsfsnvvtrDGYVgrgssssfsgstvNNKIYQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLPSVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESIGGTVEKVQLNGNHITPCIQVIHANSIFWAMSFTICV
MELVSCPSYRCTISPKILTSQNGESKRSPFVFSSLRNTKKPSALSFSNVVTRDGYVgrgssssfsgsTVNNKIYQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLPSVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESIGGTVEKVQLNGNHITPCIQVIHANSIFWAMSFTICV
*********RCTI***********************************VVT**GY************TVNNKIYQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLPSVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESIGGTVEKVQLNGNHITPCIQVIHANSIFWAMSFTIC*
****S**SYRCT*************************************************************YQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLPSVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLK*************QLNGNHITPCIQVIHANSIFWAMSFTICV
MELVSCPSYRCTISPKILTSQNGESKRSPFVFSSLRNTKKPSALSFSNVVTRDGYVGR********STVNNKIYQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLPSVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESIGGTVEKVQLNGNHITPCIQVIHANSIFWAMSFTICV
*****CPSYRCTISPKIL**********************************DGYVGRGSSSSFSGSTVNNKIYQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLPSVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESIGGTVEKVQLNGNHITPCIQVIHANSIFWAMSFTICV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELVSCPSYRCTISPKILTSQNGESKRSPFVFSSLRNTKKPSALSFSNVVTRDGYVGRGSSSSFSGSTVNNKIYQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLPSVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESIGGTVEKVQLNGNHITPCIQVIHANSIFWAMSFTICV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
255550243410 conserved hypothetical protein [Ricinus 0.823 0.695 0.655 1e-117
359476299400 PREDICTED: uncharacterized protein LOC10 0.838 0.725 0.625 1e-110
359476297398 PREDICTED: uncharacterized protein LOC10 0.838 0.728 0.625 1e-110
224088635326 predicted protein [Populus trichocarpa] 0.731 0.776 0.687 1e-109
449447195418 PREDICTED: uncharacterized protein LOC10 0.800 0.662 0.630 1e-105
356563966409 PREDICTED: uncharacterized protein LOC10 0.786 0.665 0.615 1e-103
15229305373 uncharacterized protein [Arabidopsis tha 0.765 0.710 0.627 1e-101
297815454372 hypothetical protein ARALYDRAFT_484802 [ 0.763 0.709 0.630 1e-100
223945349414 unknown [Zea mays] 0.748 0.625 0.565 1e-89
326487442397 predicted protein [Hordeum vulgare subsp 0.760 0.662 0.541 1e-87
>gi|255550243|ref|XP_002516172.1| conserved hypothetical protein [Ricinus communis] gi|223544658|gb|EEF46174.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/319 (65%), Positives = 249/319 (78%), Gaps = 34/319 (10%)

Query: 45  SFSNVVTRDGYVGRGSSSSF-----SGSTVNNKIYQRLGSCLIIPPLNGKKPRAIIKFLG 99
           S S  +  +GY GR +++ F     S S  ++K Y ++ SC++IPP  GKKPRAIIKFLG
Sbjct: 48  SLSIRMVSNGYAGRDANNLFFTNSTSTSNYDSKKYSKIDSCVVIPPPKGKKPRAIIKFLG 107

Query: 100 GAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLDYVLSTGL 159
           GAFIGAVPEVTY YL ELLAKEG++V+ VPYNVTFDHA+AANQVYE+FN+CLD +L++GL
Sbjct: 108 GAFIGAVPEVTYGYLIELLAKEGYVVVLVPYNVTFDHAHAANQVYEKFNACLDLLLTSGL 167

Query: 160 PDANLTPDDLVNLPIYSVGH-----------------------------RPATEAVPYFE 190
           PDANLTP  LV LP++SVGH                             RPATEAVPYFE
Sbjct: 168 PDANLTPAQLVGLPVFSVGHSNGALLQVLTGSYFCDNIPKANAIISFNNRPATEAVPYFE 227

Query: 191 QLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLP 250
           QLGPL+NQMMPIVEASP+YS+AR+ASGDAWK+L++TA A+IP S+ E+L SL  FVDQLP
Sbjct: 228 QLGPLINQMMPIVEASPMYSIARSASGDAWKMLIDTAGAIIPDSEQEALTSLTRFVDQLP 287

Query: 251 SVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESI 310
           SV  QVTEG+SEFKP PSEN DC + SYNVQHTLLVKF+ DTID+TDLLEETL+PR+ESI
Sbjct: 288 SVMSQVTEGVSEFKPRPSENRDCCRNSYNVQHTLLVKFTSDTIDETDLLEETLQPRIESI 347

Query: 311 GGTVEKVQLNGNHITPCIQ 329
           GGT+EKVQL+GNHITPCIQ
Sbjct: 348 GGTIEKVQLSGNHITPCIQ 366

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359476299|ref|XP_002280415.2| PREDICTED: uncharacterized protein LOC100257842 isoform 1 [Vitis vinifera] gi|296081745|emb|CBI20750.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476297|ref|XP_003631813.1| PREDICTED: uncharacterized protein LOC100257842 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224088635|ref|XP_002308506.1| predicted protein [Populus trichocarpa] gi|222854482|gb|EEE92029.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449447195|ref|XP_004141354.1| PREDICTED: uncharacterized protein LOC101217829 [Cucumis sativus] gi|449522730|ref|XP_004168379.1| PREDICTED: uncharacterized protein LOC101229712 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356563966|ref|XP_003550228.1| PREDICTED: uncharacterized protein LOC100799131 [Glycine max] Back     alignment and taxonomy information
>gi|15229305|ref|NP_189940.1| uncharacterized protein [Arabidopsis thaliana] gi|7288032|emb|CAB81794.1| putative protein [Arabidopsis thaliana] gi|14532796|gb|AAK64179.1| unknown protein [Arabidopsis thaliana] gi|19310741|gb|AAL85101.1| unknown protein [Arabidopsis thaliana] gi|332644282|gb|AEE77803.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297815454|ref|XP_002875610.1| hypothetical protein ARALYDRAFT_484802 [Arabidopsis lyrata subsp. lyrata] gi|297321448|gb|EFH51869.1| hypothetical protein ARALYDRAFT_484802 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|223945349|gb|ACN26758.1| unknown [Zea mays] Back     alignment and taxonomy information
>gi|326487442|dbj|BAJ89705.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326526373|dbj|BAJ97203.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
TAIR|locus:2098199373 AT3G43540 "AT3G43540" [Arabido 0.514 0.477 0.642 1.6e-57
TAIR|locus:2160962431 AT5G47860 [Arabidopsis thalian 0.881 0.707 0.260 4.6e-17
TAIR|locus:2098199 AT3G43540 "AT3G43540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 567 (204.7 bits), Expect = 1.6e-57, Sum P(2) = 1.6e-57
 Identities = 117/182 (64%), Positives = 140/182 (76%)

Query:   148 NSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASP 207
             N  L  VL TG   A   P   VN  I S  ++ ATEAVPYFEQLGPL+ QM+P+VEASP
Sbjct:   152 NGALLQVL-TGSYFAEKIPK--VNA-IISFNNKSATEAVPYFEQLGPLIQQMLPMVEASP 207

Query:   208 VYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFVDQLPSVFGQVTEGISEFKPTP 267
             VY MARNASGD  KLLL+TA   I  +D E+L S    VDQLPSVFG+V +G+SEF+P+P
Sbjct:   208 VYEMARNASGDVLKLLLDTAGTTILNNDQEALKSFTKLVDQLPSVFGEVGQGVSEFRPSP 267

Query:   268 SENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESIGGTVEKVQLNGNHITPC 327
              EN +CFK SY+V HTLLV+F+ D ID+TDLLEETL+PR+ESIGGT+EKV+LNGNH+TPC
Sbjct:   268 LENRNCFKCSYSVPHTLLVQFNSDAIDETDLLEETLRPRIESIGGTLEKVRLNGNHLTPC 327

Query:   328 IQ 329
             IQ
Sbjct:   328 IQ 329
GO:0003674 "molecular_function" evidence=ND
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
TAIR|locus:2160962 AT5G47860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032312001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (356 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00026129001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (273 aa)
  ••    0.524
GSVIVG00038032001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (158 aa)
  ••    0.488
GSVIVG00028771001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (378 aa)
  ••    0.486
GSVIVG00026214001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (278 aa)
  ••    0.483
GSVIVG00028499001
RecName- Full=Photosystem II reaction center psb28 protein; (179 aa)
  ••    0.478
GSVIVG00026573001
SubName- Full=Chromosome chr12 scaffold_38, whole genome shotgun sequence; (245 aa)
  •     0.464
GSVIVG00001938001
SubName- Full=Chromosome chr5 scaffold_124, whole genome shotgun sequence; (229 aa)
  ••    0.459
GSVIVG00004124001
SubName- Full=Chromosome undetermined scaffold_608, whole genome shotgun sequence; (162 aa)
  •     0.455
PDS1
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (582 aa)
  ••    0.454
GSVIVG00038180001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (279 aa)
  ••    0.450

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
pfam07082250 pfam07082, DUF1350, Protein of unknown function (D 2e-29
>gnl|CDD|115718 pfam07082, DUF1350, Protein of unknown function (DUF1350) Back     alignment and domain information 
 Score =  113 bits (284), Expect = 2e-29
 Identities = 71/254 (27%), Positives = 111/254 (43%), Gaps = 53/254 (20%)

Query: 78  GSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHA 137
           G+ +++P     +P   I FLGGAF+   P++TY +L E L + G++VI+ P+  TFDH 
Sbjct: 7   GNWVLVPQ----RPLGWIHFLGGAFVATAPQLTYRWLLEHLGEAGYVVIATPFVNTFDHG 62

Query: 138 NAANQVYERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVN 197
             A  V  +F   L+ ++  G       P     LPIY +GH           +L  L+ 
Sbjct: 63  AIALSVLNKFEYALERLVHRG----GYPP---AYLPIYGLGHSMGC-------KLHLLIG 108

Query: 198 QMMPIVEASPVYSMARNASGDAWKLLLNTAEALIPGSDMESLVSLNNFV--DQLPSVFGQ 255
            +  +  A  +                              L++ NN+     +P +   
Sbjct: 109 SLYDVERAGNI------------------------------LMAFNNYPAKQAIPWMDNF 138

Query: 256 VTEGISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMESIGGTVE 315
            T    EF P+P+E     ++ Y V+  LL+KF  D IDQT  L   L+ +    G  V 
Sbjct: 139 GTALSVEFTPSPTETNHLIQERYPVRRNLLIKFQNDDIDQTARLRSILRAKF---GDMVT 195

Query: 316 KVQLNGNHITPCIQ 329
            ++L GNH+TP  Q
Sbjct: 196 ALKLPGNHLTPLGQ 209

This family consists of several hypothetical proteins from both cyanobacteria and plants. Members of this family are typically around 250 residues in length. The function of this family is unknown but the species distribution indicates that the family may be involved in photosynthesis. Length = 250

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 346
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 100.0
KOG1455313 consensus Lysophospholipase [Lipid transport and m 96.82
PLN02385349 hydrolase; alpha/beta fold family protein 96.18
PRK10566249 esterase; Provisional 95.86
PLN02298330 hydrolase, alpha/beta fold family protein 95.86
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 95.3
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 95.19
COG4757281 Predicted alpha/beta hydrolase [General function p 94.86
PLN02652395 hydrolase; alpha/beta fold family protein 94.45
PHA02857276 monoglyceride lipase; Provisional 93.87
PRK10162318 acetyl esterase; Provisional 93.63
PLN00021313 chlorophyllase 93.55
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 93.4
PRK05077414 frsA fermentation/respiration switch protein; Revi 92.29
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 92.19
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 91.7
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 91.58
PRK10749330 lysophospholipase L2; Provisional 91.23
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 90.36
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 90.03
PRK13604307 luxD acyl transferase; Provisional 88.72
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 88.0
COG2267298 PldB Lysophospholipase [Lipid metabolism] 87.82
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 86.26
PLN02965255 Probable pheophorbidase 85.68
PLN02211273 methyl indole-3-acetate methyltransferase 85.3
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 85.13
COG0657312 Aes Esterase/lipase [Lipid metabolism] 84.98
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 83.51
PRK10985324 putative hydrolase; Provisional 82.9
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 82.8
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 82.33
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 82.31
PRK10673255 acyl-CoA esterase; Provisional 81.15
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information 
Probab=100.00  E-value=2.4e-74  Score=541.17  Aligned_cols=212  Identities=41%  Similarity=0.716  Sum_probs=189.2

Q ss_pred             cceEeccEEEeCCCCCCCCcEEEEeeccccccccchhhHHHHHHHHHhCCcEEEEecCCCCCChHHHHHHHHHHHHHHHH
Q 019058           73 IYQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANAANQVYERFNSCLD  152 (346)
Q Consensus        73 ~w~r~~~~~vl~PP~~~~P~gVIhFiGGAfvGa~PqitYr~LLE~La~~Gy~ViAtPy~~tFDH~~iA~ev~~~F~~~~~  152 (346)
                      +|++++++||+.||   +|+|||||||||||||+||||||+|||+|+++||+||||||++||||+++|++++++|++|++
T Consensus         1 ~w~~i~~~wvl~P~---~P~gvihFiGGaf~ga~P~itYr~lLe~La~~Gy~ViAtPy~~tfDH~~~A~~~~~~f~~~~~   77 (250)
T PF07082_consen    1 DWQEISGSWVLIPP---RPKGVIHFIGGAFVGAAPQITYRYLLERLADRGYAVIATPYVVTFDHQAIAREVWERFERCLR   77 (250)
T ss_pred             CcccccCcEEEeCC---CCCEEEEEcCcceeccCcHHHHHHHHHHHHhCCcEEEEEecCCCCcHHHHHHHHHHHHHHHHH
Confidence            69999999999996   899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCCCCCCCCCCCCCCeeEecCCCCcCccchhhhhchhhhhcccccccchhHHhhhcccchhHHHHhhhhhccCC
Q 019058          153 YVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAWKLLLNTAEALIP  232 (346)
Q Consensus       153 ~L~~~g~~~~gl~~~~~~~lPv~gVGHS~a~~AvP~f~~LGckL~~L~p~~~asp~~~~~R~~~~~~~k~l~n~ag~l~~  232 (346)
                      .|.+++.    +   +.+++|+||||||           ||||||+|++     ..++..|             +||   
T Consensus        78 ~L~~~~~----~---~~~~lP~~~vGHS-----------lGcklhlLi~-----s~~~~~r-------------~gn---  118 (250)
T PF07082_consen   78 ALQKRGG----L---DPAYLPVYGVGHS-----------LGCKLHLLIG-----SLFDVER-------------AGN---  118 (250)
T ss_pred             HHHHhcC----C---CcccCCeeeeecc-----------cchHHHHHHh-----hhccCcc-------------cce---
Confidence            9998742    2   3567999999999           9999999984     2333334             233   


Q ss_pred             CCchHHHHHhHHHH--hhhhhhhhhccCC-cccccCChHHHHHHHHhccCccceeeEEecCCCCCCcHHHHHHhchhccc
Q 019058          233 GSDMESLVSLNNFV--DQLPSVFGQVTEG-ISEFKPTPSENLDCFKKSYNVQHTLLVKFSFDTIDQTDLLEETLKPRMES  309 (346)
Q Consensus       233 ~~~~~i~~sf~nfv--dqLp~~~~~va~G-~~EF~PsPeET~~LI~~sY~v~rnLLIkF~dD~IDqT~~L~~~L~~r~~s  309 (346)
                           +++||||+-  +.||. +.+++.. ++||+|||+||+++|+++|.++|||||||+||+||||+.|+++|++|.  
T Consensus       119 -----iliSFNN~~a~~aIP~-~~~l~~~l~~EF~PsP~ET~~li~~~Y~~~rnLLIkF~~D~iDqt~~L~~~L~~r~--  190 (250)
T PF07082_consen  119 -----ILISFNNFPADEAIPL-LEQLAPALRLEFTPSPEETRRLIRESYQVRRNLLIKFNDDDIDQTDELEQILQQRF--  190 (250)
T ss_pred             -----EEEecCChHHHhhCch-HhhhccccccCccCCHHHHHHHHHHhcCCccceEEEecCCCccchHHHHHHHhhhc--
Confidence                 789999954  37775 5555543 789999999999999999999999999999999999999999999994  


Q ss_pred             cCCceeEEeecCCCcccCcccccchh
Q 019058          310 IGGTVEKVQLNGNHITPCIQVIHANS  335 (346)
Q Consensus       310 ~~~~v~~~~LpGnHLTPl~qd~~~~~  335 (346)
                       ++++++++|||||||||+||++|+.
T Consensus       191 -~~~~~~~~L~G~HLTPl~q~~~~~~  215 (250)
T PF07082_consen  191 -PDMVSIQTLPGNHLTPLGQDLKWQV  215 (250)
T ss_pred             -cccceEEeCCCCCCCcCcCCcCCcc
Confidence             4679999999999999999999997

Members of this family are typically around 250 residues in length. The function of this family is unknown but the species distribution indicates that the family may be involved in photosynthesis.
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 53.3 bits (127), Expect = 6e-08
 Identities = 56/316 (17%), Positives = 107/316 (33%), Gaps = 67/316 (21%)

Query: 7   PSYRCTISPKILTSQNGESKRSPFVFSSLRNTKKPSALSFSNVVTRDGYVGRGSSSSFSG 66
           P    T +P+ L S   ES R     ++  N K  +    + ++           SS + 
Sbjct: 319 PREVLTTNPRRL-SIIAESIRDGL--ATWDNWKHVNCDKLTTII----------ESSLNV 365

Query: 67  --STVNNKIYQRLGSCLIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYL--KELLAKEG 122
                  K++ RL    + PP +   P  ++  +    I +   V  + L    L+ K+ 
Sbjct: 366 LEPAEYRKMFDRLS---VFPP-SAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQP 421

Query: 123 F-LVISVPYNVTFDHANAANQVYERFNSCLD-YVLSTGLPDANLTPDDLVNLPIYS-VGH 179
               IS+  ++  +        Y    S +D Y +       +L P  L     YS +GH
Sbjct: 422 KESTISI-PSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQY-FYSHIGH 479

Query: 180 --RPA--TEAVPYFEQLGPLVNQMMPIVEASPVYSMARNASGDAW---KLLLNTAEALIP 232
             +     E +  F  +   ++                      +   K+  ++      
Sbjct: 480 HLKNIEHPERMTLFRMV--FLD--------------------FRFLEQKIRHDSTAWNAS 517

Query: 233 GSDMESLVSLNNF----VDQLPSVFGQVTEGISEFKPTPSENLDCFKKSYNVQHTLLVKF 288
           GS + +L  L  +     D  P  + ++   I +F P   ENL         ++T L++ 
Sbjct: 518 GSILNTLQQLKFYKPYICDNDP-KYERLVNAILDFLPKIEENL------ICSKYTDLLRI 570

Query: 289 SFDTIDQTDLLEETLK 304
           +    +   + EE  K
Sbjct: 571 ALMA-EDEAIFEEAHK 585
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 96.8
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 96.56
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 96.14
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 95.91
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 95.82
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 95.65
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 95.63
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 95.63
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 95.56
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 95.47
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 95.45
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 95.36
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 95.35
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 95.31
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 95.25
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 95.16
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 94.94
3bjr_A283 Putative carboxylesterase; structural genomics, jo 94.8
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 94.79
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 94.76
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 94.76
3h04_A275 Uncharacterized protein; protein with unknown func 94.76
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 94.66
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 94.64
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 94.64
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 94.55
3ain_A323 303AA long hypothetical esterase; carboxylesterase 94.42
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 94.33
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 94.21
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 94.21
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 94.17
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 94.06
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 93.93
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 93.85
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 93.82
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 93.75
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 93.72
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 93.67
1vkh_A273 Putative serine hydrolase; structural genomics, jo 93.59
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 93.51
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 93.5
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 93.47
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 93.32
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 93.29
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 93.27
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 93.24
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 92.92
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 92.9
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 92.84
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 92.64
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 92.48
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 92.46
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 92.35
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 92.16
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 92.1
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 92.01
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 91.5
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 91.46
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 91.37
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 91.34
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 91.12
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 90.86
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 90.8
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 90.71
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 90.65
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 90.59
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 90.51
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 90.48
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 90.33
3llc_A270 Putative hydrolase; structural genomics, joint cen 90.2
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 89.87
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 89.69
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 89.64
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 89.61
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 89.53
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 89.42
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 89.39
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 89.31
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 89.08
3nuz_A398 Putative acetyl xylan esterase; structural genomic 88.79
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 88.71
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 88.69
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 88.56
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 88.36
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 87.94
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 87.82
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 87.42
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 86.85
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 86.71
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 86.61
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 85.74
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 85.7
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 85.43
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 84.71
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 84.56
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 84.3
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 84.22
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 84.1
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 84.08
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 83.99
3d59_A383 Platelet-activating factor acetylhydrolase; secret 83.81
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 83.66
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 83.62
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 83.57
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 83.27
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 83.22
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 82.78
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 82.77
1r3d_A264 Conserved hypothetical protein VC1974; structural 82.32
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 81.72
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 81.57
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 81.33
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 81.24
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 80.14
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 80.14
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
Probab=96.80  E-value=0.018  Score=47.96  Aligned_cols=95  Identities=18%  Similarity=0.237  Sum_probs=61.2

Q ss_pred             EEeCCCCCCCCcEEEEeeccccccccchhhHHHHHHHHHhCCcEEEEecCCC------CCChHHHH----------HHHH
Q 019058           81 LIIPPLNGKKPRAIIKFLGGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNV------TFDHANAA----------NQVY  144 (346)
Q Consensus        81 ~vl~PP~~~~P~gVIhFiGGAfvGa~PqitYr~LLE~La~~Gy~ViAtPy~~------tFDH~~iA----------~ev~  144 (346)
                      ++..|++...|+.+|=|+-| +.|..  -.|+.+.+.|+++||.|++.=|.-      .++...-.          .+..
T Consensus        21 ~~~~p~~~~~~~p~vv~~HG-~~g~~--~~~~~~~~~l~~~G~~v~~~d~~g~g~~~~~~~~~~~~~~~~~~~~~~~~~~   97 (241)
T 3f67_A           21 YHARPKNADGPLPIVIVVQE-IFGVH--EHIRDLCRRLAQEGYLAIAPELYFRQGDPNEYHDIPTLFKELVSKVPDAQVL   97 (241)
T ss_dssp             EEEEETTCCSCEEEEEEECC-TTCSC--HHHHHHHHHHHHTTCEEEEECTTTTTCCGGGCCSHHHHHHHTGGGSCHHHHH
T ss_pred             EEecCCCCCCCCCEEEEEcC-cCccC--HHHHHHHHHHHHCCcEEEEecccccCCCCCchhhHHHHHHHhhhcCCchhhH
Confidence            44444444467788888888 33443  368999999999999999987632      11111111          2345


Q ss_pred             HHHHHHHHHHHhcCCCCCCCCCCCCCCCCeeEecCCCCcCccchhhhhchhhhhc
Q 019058          145 ERFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHRPATEAVPYFEQLGPLVNQM  199 (346)
Q Consensus       145 ~~F~~~~~~L~~~g~~~~gl~~~~~~~lPv~gVGHS~a~~AvP~f~~LGckL~~L  199 (346)
                      +....+++.|.+.+          ...-+++.+|||           +|..+...
T Consensus        98 ~d~~~~~~~l~~~~----------~d~~~i~l~G~S-----------~Gg~~a~~  131 (241)
T 3f67_A           98 ADLDHVASWAARHG----------GDAHRLLITGFC-----------WGGRITWL  131 (241)
T ss_dssp             HHHHHHHHHHHTTT----------EEEEEEEEEEET-----------HHHHHHHH
T ss_pred             HHHHHHHHHHHhcc----------CCCCeEEEEEEc-----------ccHHHHHH
Confidence            55667777776542          123478999999           98877653
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 97.03
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 96.7
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 96.37
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 95.81
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 95.59
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 95.58
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 94.58
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 94.51
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 94.21
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 94.16
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 93.96
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 93.5
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 92.15
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 91.04
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 90.88
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 90.79
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 90.75
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 89.82
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 89.74
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 89.5
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 89.04
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 89.0
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 88.88
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 88.07
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 87.78
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 86.03
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 85.47
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 84.79
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 84.73
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 84.47
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 84.34
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 83.0
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 81.66
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 81.61
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 80.09
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acylamino-acid-releasing enzyme, C-terminal donain
domain: Acylamino-acid-releasing enzyme, C-terminal donain
species: Aeropyrum pernix [TaxId: 56636]

Probab=97.03  E-value=0.0023  Score=54.01  Aligned_cols=91  Identities=18%  Similarity=0.328  Sum_probs=56.1

Q ss_pred             EeccEEEeCCCCCCCCcEEEEee-ccccccccchhhHHHHHHHHHhCCcEEEEecCCCCCChHHH---H------HHHHH
Q 019058           76 RLGSCLIIPPLNGKKPRAIIKFL-GGAFIGAVPEVTYSYLKELLAKEGFLVISVPYNVTFDHANA---A------NQVYE  145 (346)
Q Consensus        76 r~~~~~vl~PP~~~~P~gVIhFi-GGAfvGa~PqitYr~LLE~La~~Gy~ViAtPy~~tFDH~~i---A------~ev~~  145 (346)
                      ++. .|++.|++..+|.-||=|+ ||.+.....  .|..+.+.|+++||+|++.=|...-.+..-   +      ....+
T Consensus        24 ~i~-~~l~~p~~~~~~~Pviv~~HGG~~~~~~~--~~~~~~~~la~~G~~v~~~d~r~~~~~g~~~~~~~~~~~~~~~~~  100 (260)
T d2hu7a2          24 RVP-TYVLESGRAPTPGPTVVLVHGGPFAEDSD--SWDTFAASLAAAGFHVVMPNYRGSTGYGEEWRLKIIGDPCGGELE  100 (260)
T ss_dssp             EEE-EEEEEETTSCSSEEEEEEECSSSSCCCCS--SCCHHHHHHHHHTCEEEEECCTTCSSSCHHHHHTTTTCTTTHHHH
T ss_pred             EEE-EEEEeCCCCCCCceEEEEECCCCccCCCc--cccHHHHHHHhhccccccceeeeccccccccccccccccchhhhh
Confidence            455 4555566666676566666 766644444  456788899999999999877643221111   0      12244


Q ss_pred             HHHHHHHHHHhcCCCCCCCCCCCCCCCCeeEecCC
Q 019058          146 RFNSCLDYVLSTGLPDANLTPDDLVNLPIYSVGHR  180 (346)
Q Consensus       146 ~F~~~~~~L~~~g~~~~gl~~~~~~~lPv~gVGHS  180 (346)
                      .+..+.+.|.+.+-           .-.++.+|||
T Consensus       101 D~~~~~~~l~~~~~-----------~~~~~i~g~s  124 (260)
T d2hu7a2         101 DVSAAARWARESGL-----------ASELYIMGYS  124 (260)
T ss_dssp             HHHHHHHHHHHTTC-----------EEEEEEEEET
T ss_pred             hhcccccccccccc-----------cceeeccccc
Confidence            55667777776421           2366888999
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure