Citrus Sinensis ID: 019077
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 346 | ||||||
| 225445039 | 346 | PREDICTED: nudix hydrolase 8-like [Vitis | 0.956 | 0.956 | 0.711 | 1e-136 | |
| 255546261 | 343 | mutt domain protein, putative [Ricinus c | 0.820 | 0.827 | 0.719 | 1e-122 | |
| 224122502 | 281 | predicted protein [Populus trichocarpa] | 0.794 | 0.978 | 0.740 | 1e-120 | |
| 297738728 | 221 | unnamed protein product [Vitis vinifera] | 0.627 | 0.981 | 0.815 | 1e-105 | |
| 255581321 | 368 | mutt domain protein, putative [Ricinus c | 0.736 | 0.692 | 0.621 | 1e-93 | |
| 356540550 | 363 | PREDICTED: nudix hydrolase 8-like [Glyci | 0.731 | 0.696 | 0.618 | 6e-92 | |
| 357476761 | 357 | Nudix hydrolase [Medicago truncatula] gi | 0.731 | 0.708 | 0.610 | 2e-90 | |
| 297794491 | 364 | predicted protein [Arabidopsis lyrata su | 0.893 | 0.848 | 0.556 | 3e-90 | |
| 21593371 | 371 | mutT domain protein-like [Arabidopsis th | 0.849 | 0.792 | 0.563 | 4e-90 | |
| 18422772 | 369 | nudix hydrolase 8 [Arabidopsis thaliana] | 0.849 | 0.796 | 0.563 | 5e-90 |
| >gi|225445039|ref|XP_002280214.1| PREDICTED: nudix hydrolase 8-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 492 bits (1266), Expect = e-136, Method: Compositional matrix adjust.
Identities = 237/333 (71%), Positives = 281/333 (84%), Gaps = 2/333 (0%)
Query: 14 SGFRCQNFAKEPTTSLPKTRPFPMPLKAFSSKGSSTS-TSAKLKSSLMPSLFGGGSVIKK 72
SG CQ+++++P S ++ F + F K S++ SS +PSL GG V+++
Sbjct: 11 SGLYCQSYSEKPRVSWRESCSFQGLSRGFWRKTLPLEVNSSEPNSSSIPSL-RGGYVLRR 69
Query: 73 KEINVLSPDITAPIFVPEFLDPFDDEYDGVIINPENLPSSANAFVSALRASLSNWKLKGK 132
K I VLSP I++P EFLD ++DEYDGV+INPENLPSSANAF SALRAS+SNW+LKGK
Sbjct: 70 KGIQVLSPHISSPSVPVEFLDAWEDEYDGVVINPENLPSSANAFASALRASMSNWELKGK 129
Query: 133 KGVWLKILSKQADLVPIAIQEGFSYHHAEPGYVMLTYWIPVEPCMLPGSPSHQIGVGGFV 192
+G+WLKIL +QADLVPIAIQEGF++HHAEPGYVMLTYW+P EPC+LP SPSHQIG+GGFV
Sbjct: 130 RGIWLKILLEQADLVPIAIQEGFNFHHAEPGYVMLTYWLPNEPCLLPASPSHQIGIGGFV 189
Query: 193 MNDKREVLVVKEKCPRSCSGMWKIPTGYINKSEDLFSGAVREVKEETGVDTIFLEMVAFR 252
MN KREVLVVKEKCP SCSG+WK+PTGYINKSE++FSGAVREVKEETG+DTIFLEMVAFR
Sbjct: 190 MNHKREVLVVKEKCPCSCSGVWKLPTGYINKSEEIFSGAVREVKEETGIDTIFLEMVAFR 249
Query: 253 HVHLVAFEKSDLLFVCMLKPLSFEITIYEKEIQAAKWMPLEEFVKQPFYLEDDMSRKVID 312
H HLVAFE+SDLLFVCMLKPL+FEIT+ EKEIQAAKWMPL+EFV QPFY ED MSRKVID
Sbjct: 250 HAHLVAFEQSDLLFVCMLKPLTFEITVDEKEIQAAKWMPLDEFVSQPFYKEDHMSRKVID 309
Query: 313 ICIKAYDDRFNGFIAHELASKLDGKLSCLYHND 345
ICI YD+R+NGFIAH++ SKLD KLS LY+N+
Sbjct: 310 ICISKYDNRYNGFIAHQMTSKLDRKLSYLYYNE 342
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255546261|ref|XP_002514190.1| mutt domain protein, putative [Ricinus communis] gi|223546646|gb|EEF48144.1| mutt domain protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224122502|ref|XP_002330497.1| predicted protein [Populus trichocarpa] gi|222872431|gb|EEF09562.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297738728|emb|CBI27973.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255581321|ref|XP_002531471.1| mutt domain protein, putative [Ricinus communis] gi|223528925|gb|EEF30921.1| mutt domain protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356540550|ref|XP_003538751.1| PREDICTED: nudix hydrolase 8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357476761|ref|XP_003608666.1| Nudix hydrolase [Medicago truncatula] gi|355509721|gb|AES90863.1| Nudix hydrolase [Medicago truncatula] gi|388508944|gb|AFK42538.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297794491|ref|XP_002865130.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297310965|gb|EFH41389.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|21593371|gb|AAM65320.1| mutT domain protein-like [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18422772|ref|NP_568680.1| nudix hydrolase 8 [Arabidopsis thaliana] gi|68565908|sp|Q8L7W2.2|NUDT8_ARATH RecName: Full=Nudix hydrolase 8; Short=AtNUDT8 gi|332008107|gb|AED95490.1| nudix hydrolase 8 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 346 | ||||||
| TAIR|locus:2171544 | 369 | NUDT8 "nudix hydrolase homolog | 0.815 | 0.764 | 0.544 | 5.5e-77 | |
| TAIR|locus:2168993 | 278 | NUDT2 "nudix hydrolase homolog | 0.673 | 0.838 | 0.459 | 1.2e-51 | |
| TAIR|locus:2058364 | 302 | NUDT5 "nudix hydrolase homolog | 0.693 | 0.794 | 0.395 | 3.4e-45 | |
| TAIR|locus:2058334 | 283 | NUDT6 "nudix hydrolase homolog | 0.710 | 0.869 | 0.420 | 3.9e-44 | |
| DICTYBASE|DDB_G0281219 | 376 | DDB_G0281219 "Nucleoside dipho | 0.760 | 0.699 | 0.356 | 2.1e-38 | |
| FB|FBgn0030668 | 330 | CG8128 [Drosophila melanogaste | 0.578 | 0.606 | 0.373 | 1.3e-31 | |
| UNIPROTKB|F1NLN3 | 297 | F1NLN3 "Uncharacterized protei | 0.656 | 0.764 | 0.330 | 3.9e-28 | |
| UNIPROTKB|P53370 | 316 | NUDT6 "Nucleoside diphosphate- | 0.708 | 0.775 | 0.310 | 2.2e-27 | |
| UNIPROTKB|F1RQN4 | 314 | NUDT6 "Uncharacterized protein | 0.708 | 0.780 | 0.313 | 2.2e-27 | |
| UNIPROTKB|E2RC30 | 316 | NUDT6 "Uncharacterized protein | 0.702 | 0.768 | 0.312 | 5.7e-27 |
| TAIR|locus:2171544 NUDT8 "nudix hydrolase homolog 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 775 (277.9 bits), Expect = 5.5e-77, P = 5.5e-77
Identities = 159/292 (54%), Positives = 202/292 (69%)
Query: 63 LFGGGSVI-------KKKEINVLSPDI-TAPIFVPEFLDPFDDEYDGVIINPENLPSSAN 114
++GGGS+ K +N+ S + ++ + LD +DDEY GVI++ LPS+
Sbjct: 59 VYGGGSIAATSDSGYKMNGVNLKSRTLMSSAVKERSLLDAYDDEYGGVIVDHGKLPSNPY 118
Query: 115 AFVSALRASLSNXXXXXXXXXXXXILSKQADLVPIAIQEGFSYHHAEPGYVMLTYWIPVE 174
AF S LRASLS+ + +Q++LVPIAI+EGF YHHAE GYVMLTYWIP E
Sbjct: 119 AFASMLRASLSDWRRKGKKGVWLKLPVEQSELVPIAIKEGFEYHHAEKGYVMLTYWIPEE 178
Query: 175 -PCMLPGSPSHQIGVGGFVMNDKREVLVVKEK-CPRSCSGMWKIPTGYINKSEDLFSGAV 232
P MLP + SHQ+GVGGFV+N +EVLVV+EK C S +G+WK+PTG+IN+SE++FSGAV
Sbjct: 179 EPSMLPANASHQVGVGGFVLNQHKEVLVVQEKYCAPSITGLWKLPTGFINESEEIFSGAV 238
Query: 233 REVKEETGVDTIFLEMVAFRHVHLVAFEKSDLLFVCMLKPLSFEITIYEKEIQAAKWMPL 292
REVKEETGVDT F E++AFRH H VAFEKSDL F+CML+PLS +I I EI+AAKWMPL
Sbjct: 239 REVKEETGVDTEFSEVIAFRHAHNVAFEKSDLFFICMLRPLSDKIIIDALEIKAAKWMPL 298
Query: 293 EEFVKQPFYLEDDMSRKVIDICIKAYDDRFNGFIAHELASKLDGKLSCLYHN 344
EFV+QP D M ++VI+IC R+ G H L S DGK S LY+N
Sbjct: 299 AEFVEQPMIRGDKMFKRVIEICEARLSHRYCGLSPHRLVSTFDGKPSSLYYN 350
|
|
| TAIR|locus:2168993 NUDT2 "nudix hydrolase homolog 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058364 NUDT5 "nudix hydrolase homolog 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058334 NUDT6 "nudix hydrolase homolog 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281219 DDB_G0281219 "Nucleoside diphosphate-linked moiety X motif 6" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030668 CG8128 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLN3 F1NLN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P53370 NUDT6 "Nucleoside diphosphate-linked moiety X motif 6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQN4 NUDT6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RC30 NUDT6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.145.139.1 | hypothetical protein (253 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 346 | |||
| cd04670 | 127 | cd04670, Nudix_Hydrolase_12, Members of the Nudix | 2e-62 | |
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 2e-21 | |
| cd02883 | 123 | cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup | 2e-17 | |
| cd04676 | 129 | cd04676, Nudix_Hydrolase_17, Members of the Nudix | 4e-12 | |
| cd04699 | 129 | cd04699, Nudix_Hydrolase_39, Members of the Nudix | 4e-10 | |
| cd04671 | 123 | cd04671, Nudix_Hydrolase_13, Members of the Nudix | 1e-09 | |
| COG1051 | 145 | COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl | 2e-08 | |
| cd04678 | 129 | cd04678, Nudix_Hydrolase_19, Members of the Nudix | 5e-08 | |
| cd04673 | 122 | cd04673, Nudix_Hydrolase_15, Members of the Nudix | 2e-07 | |
| cd03674 | 138 | cd03674, Nudix_Hydrolase_1, Members of the Nudix h | 2e-07 | |
| cd04680 | 120 | cd04680, Nudix_Hydrolase_21, Members of the Nudix | 3e-07 | |
| cd03428 | 130 | cd03428, Ap4A_hydrolase_human_like, Diadenosine te | 4e-07 | |
| cd04664 | 129 | cd04664, Nudix_Hydrolase_7, Members of the Nudix h | 6e-07 | |
| cd03425 | 124 | cd03425, MutT_pyrophosphohydrolase, The MutT pyrop | 1e-06 | |
| cd04677 | 132 | cd04677, Nudix_Hydrolase_18, Members of the Nudix | 2e-06 | |
| cd04700 | 142 | cd04700, DR1025_like, DR1025 from Deinococcus radi | 2e-06 | |
| cd04697 | 126 | cd04697, Nudix_Hydrolase_38, Members of the Nudix | 3e-06 | |
| cd04696 | 125 | cd04696, Nudix_Hydrolase_37, Members of the Nudix | 6e-06 | |
| cd04683 | 120 | cd04683, Nudix_Hydrolase_24, Members of the Nudix | 7e-06 | |
| cd03671 | 147 | cd03671, Ap4A_hydrolase_plant_like, Diadenosine te | 8e-06 | |
| cd03673 | 131 | cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate | 2e-05 | |
| cd03672 | 145 | cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), t | 2e-05 | |
| cd03675 | 134 | cd03675, Nudix_Hydrolase_2, Contains a crystal str | 3e-05 | |
| cd04681 | 130 | cd04681, Nudix_Hydrolase_22, Members of the Nudix | 3e-05 | |
| COG0494 | 161 | COG0494, MutT, NTP pyrophosphohydrolases including | 3e-05 | |
| cd04672 | 123 | cd04672, Nudix_Hydrolase_14, Members of the Nudix | 4e-05 | |
| cd04682 | 122 | cd04682, Nudix_Hydrolase_23, Members of the Nudix | 4e-05 | |
| PLN02791 | 770 | PLN02791, PLN02791, Nudix hydrolase homolog | 1e-04 | |
| cd03427 | 137 | cd03427, MTH1, MutT homolog-1 (MTH1) is a member o | 2e-04 | |
| cd04692 | 144 | cd04692, Nudix_Hydrolase_33, Members of the Nudix | 4e-04 | |
| cd04679 | 125 | cd04679, Nudix_Hydrolase_20, Members of the Nudix | 4e-04 | |
| cd04667 | 112 | cd04667, Nudix_Hydrolase_10, Members of the Nudix | 6e-04 | |
| cd04684 | 128 | cd04684, Nudix_Hydrolase_25, Contains a crystal st | 6e-04 | |
| cd04674 | 118 | cd04674, Nudix_Hydrolase_16, Members of the Nudix | 6e-04 | |
| cd03424 | 137 | cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase | 6e-04 | |
| cd04691 | 117 | cd04691, Nudix_Hydrolase_32, Members of the Nudix | 8e-04 | |
| cd03429 | 131 | cd03429, NADH_pyrophosphatase, NADH pyrophosphatas | 9e-04 | |
| PRK09438 | 148 | PRK09438, nudB, dihydroneopterin triphosphate pyro | 0.001 | |
| cd04511 | 130 | cd04511, Nudix_Hydrolase_4, Members of the Nudix h | 0.002 | |
| cd04693 | 127 | cd04693, Nudix_Hydrolase_34, Members of the Nudix | 0.002 | |
| PRK00714 | 156 | PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi | 0.003 | |
| PRK05379 | 340 | PRK05379, PRK05379, bifunctional nicotinamide mono | 0.004 |
| >gnl|CDD|240027 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
Score = 194 bits (495), Expect = 2e-62
Identities = 72/131 (54%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
Query: 184 HQIGVGGFVMNDKREVLVVKEKCPRSCSGMWKIPTGYINKSEDLFSGAVREVKEETGVDT 243
H +GVGG V+N+K EVLVV+E+ WK+P G ++ ED+F GAVREV EETG+DT
Sbjct: 1 HTVGVGGLVLNEKNEVLVVQER--NKTPNGWKLPGGLVDPGEDIFDGAVREVLEETGIDT 58
Query: 244 IFLEMVAFRHVHLVAFEKSDLLFVCMLKPLSFEITIYEKEIQAAKWMPLEEFVKQPFYLE 303
F+ +V FRH H AF KSDL F+C LKPLSF+I EI AAKWMPLEE++ QP E
Sbjct: 59 EFVSVVGFRHAHPGAFGKSDLYFICRLKPLSFDINFDTSEIAAAKWMPLEEYISQPITSE 118
Query: 304 DDMSRKVIDIC 314
++R ++DIC
Sbjct: 119 --VNRLILDIC 127
|
Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. Length = 127 |
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240054 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240028 cd04671, Nudix_Hydrolase_13, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240034 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239646 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240036 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240022 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239517 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >gnl|CDD|240033 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240055 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >gnl|CDD|240053 cd04697, Nudix_Hydrolase_38, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240052 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240039 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239644 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >gnl|CDD|239647 cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240037 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240029 cd04672, Nudix_Hydrolase_14, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240038 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|215425 PLN02791, PLN02791, Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240048 cd04692, Nudix_Hydrolase_33, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240035 cd04679, Nudix_Hydrolase_20, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240025 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240040 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|240031 cd04674, Nudix_Hydrolase_16, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|240047 cd04691, Nudix_Hydrolase_32, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239521 cd03429, NADH_pyrophosphatase, NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >gnl|CDD|236516 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239948 cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240049 cd04693, Nudix_Hydrolase_34, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235436 PRK05379, PRK05379, bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| KOG0648 | 295 | consensus Predicted NUDIX hydrolase FGF-2 and rela | 100.0 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.88 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 99.83 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.81 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.81 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.8 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.8 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.8 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.8 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.79 | |
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 99.79 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.79 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.79 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.79 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.79 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.79 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.79 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.78 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.78 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.78 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.78 | |
| PLN02325 | 144 | nudix hydrolase | 99.78 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.78 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.78 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.78 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.77 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.77 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.77 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.77 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.77 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.77 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.76 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.76 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.76 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.76 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.75 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.75 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.75 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.74 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.74 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.74 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.74 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.74 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.73 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.73 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.73 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.72 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.72 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.72 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.72 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.72 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.71 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.71 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.7 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.7 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.69 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.69 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.68 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.68 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.67 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 99.65 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.64 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.64 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.64 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.63 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.63 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.6 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.59 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.59 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.58 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 99.58 | |
| KOG3084 | 345 | consensus NADH pyrophosphatase I of the Nudix fami | 99.57 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 99.52 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.52 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.5 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.5 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.5 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.49 | |
| PLN02709 | 222 | nudix hydrolase | 99.48 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 99.41 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 99.41 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.4 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 99.27 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 99.26 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 99.19 | |
| KOG2839 | 145 | consensus Diadenosine and diphosphoinositol polyph | 99.15 | |
| KOG3069 | 246 | consensus Peroxisomal NUDIX hydrolase [Replication | 98.93 | |
| KOG3041 | 225 | consensus Nucleoside diphosphate-sugar hydrolase o | 98.93 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 98.9 | |
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 98.84 | |
| PLN02839 | 372 | nudix hydrolase | 98.69 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 98.37 | |
| KOG4195 | 275 | consensus Transient receptor potential-related cha | 97.78 | |
| KOG0142 | 225 | consensus Isopentenyl pyrophosphate:dimethylallyl | 97.67 | |
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 97.43 | |
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 97.37 | |
| KOG2937 | 348 | consensus Decapping enzyme complex, predicted pyro | 97.05 | |
| PRK13910 | 289 | DNA glycosylase MutY; Provisional | 95.44 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 94.92 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 94.91 | |
| KOG4313 | 306 | consensus Thiamine pyrophosphokinase [Nucleotide t | 94.44 | |
| COG1194 | 342 | MutY A/G-specific DNA glycosylase [DNA replication | 93.85 | |
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 93.47 | |
| KOG1689 | 221 | consensus mRNA cleavage factor I subunit [RNA proc | 90.18 | |
| TIGR01084 | 275 | mutY A/G-specific adenine glycosylase. This equiva | 85.1 | |
| KOG4548 | 263 | consensus Mitochondrial ribosomal protein L17 [Tra | 82.96 | |
| COG4111 | 322 | Uncharacterized conserved protein [General functio | 80.59 |
| >KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.3e-44 Score=332.30 Aligned_cols=265 Identities=45% Similarity=0.797 Sum_probs=250.7
Q ss_pred CCCCCCccccccCCccCCCCcEEeCCCCCCCChHHHHHHHHHHhHHhHhcCceeEEEEccccccCchHHHHhcccceecC
Q 019077 81 DITAPIFVPEFLDPFDDEYDGVIINPENLPSSANAFVSALRASLSNWKLKGKKGVWLKILSKQADLVPIAIQEGFSYHHA 160 (346)
Q Consensus 81 ~~~~~~~~~~~~~~~~d~~~g~~v~~~~~~~~~~~f~~~l~~sl~~w~~~~~r~vw~~l~~~~~~l~~~a~~~gf~~H~~ 160 (346)
...++++..+.+.+..|+|+||+++....+-|...|.+.|++|+.+|+.+|++++|++++...+++++.|++.||.+||+
T Consensus 11 ~~~~~~~~~~~l~~~~D~~ggv~v~~~~~~~d~~~f~~~l~~Sl~~W~~~Gr~~iwl~l~~~~~~lV~~a~~~gf~~hHa 90 (295)
T KOG0648|consen 11 RMDSMSVGSSLLAGLSDRYGGVVVDIVPEPMDEKLFIEELRASLQKWYLQGRKGIWLKLPEELARLVEEAAKYGFDYHHA 90 (295)
T ss_pred CCCccccchhhhcccccccCCEEeecccCCCCHHHHHHHHHHHHHHHHHccCcccceechHHHHhHHHHHHhcCcEEecc
Confidence 45567888899999999999999999766669999999999999999999999999999999999999999999999999
Q ss_pred CCceeEeeccccCCCCCCCCCCccceEEEEEEEeCCCeEEEEeec-CCCCCCCceeeeeEEecCCCCHHHHHHHHHHHHh
Q 019077 161 EPGYVMLTYWIPVEPCMLPGSPSHQIGVGGFVMNDKREVLVVKEK-CPRSCSGMWKIPTGYINKSEDLFSGAVREVKEET 239 (346)
Q Consensus 161 ~~~~~~l~~wl~~~~~~lp~~~~~~v~V~avVin~~~~VLLvrr~-~~~~~~g~W~lPGG~ve~GEs~~eAA~REv~EET 239 (346)
+..|+|++.|++..+.++|.++.|+++|+++|+|.+++||++++. +.....|.|++|+|.|++||++.++|+||++|||
T Consensus 91 e~~~~~l~~Wl~e~~~~lP~~Ash~vgvg~~V~n~~~eVlVv~e~d~~~~~~~~wK~ptG~v~~~e~i~~gavrEvkeet 170 (295)
T KOG0648|consen 91 ESLYVMLTSWLREAPSTLPANASHRVGVGAFVLNKKKEVLVVQEKDGAVKIRGGWKLPTGRVEEGEDIWHGAVREVKEET 170 (295)
T ss_pred cccceeeeeeeccccccCCCchhhheeeeeeEecCCceeEEEEecccceeecccccccceEecccccchhhhhhhhHHHh
Confidence 999999999999999999999999999999999988999999986 5666889999999999999999999999999999
Q ss_pred CCceeeeEEEEEEeeeccccc--eeEEEEEEEEecCCccccCCccccceEEEEchhhhhcCCCCCccHHHHHHHHHHHHH
Q 019077 240 GVDTIFLEMVAFRHVHLVAFE--KSDLLFVCMLKPLSFEITIYEKEIQAAKWMPLEEFVKQPFYLEDDMSRKVIDICIKA 317 (346)
Q Consensus 240 Gl~v~~~~ll~~~~~~~~~~~--~~~~~fv~~l~~~~~~i~~~~~Ei~~~~Wv~~eel~~l~~~~~~~~~~~ii~~~l~~ 317 (346)
|++.++.+++.+++.|...+. ++++||+|.+++.+.+++.+..|+..++||+++++..+|..+...+++.+...|+++
T Consensus 171 gid~ef~eVla~r~~H~~~~~~~ksd~f~~c~L~p~s~~i~~~~~ei~~~~Wmp~~e~v~qp~~~~~~m~~~~~~Ic~~~ 250 (295)
T KOG0648|consen 171 GIDTEFVEVLAFRRAHNATFGLIKSDMFFTCELRPRSLDITKCKREIEAAAWMPIEEYVSQPLVHPKGMFRLAAGICLNR 250 (295)
T ss_pred CcchhhhhHHHHHhhhcchhhcccccceeEEEeeccccccchhHHHHHHHhcccHHHhhcccccccchhhHHHhhhhHHH
Confidence 999999999999999988777 899999999999999999999999999999999999999988777899999999999
Q ss_pred hcCCCCCccccccccccccccccceecC
Q 019077 318 YDDRFNGFIAHELASKLDGKLSCLYHND 345 (346)
Q Consensus 318 ~~~~~~g~~~~~l~~~f~~~~~~~y~~~ 345 (346)
+...|.|+....++.++..+..++|+|+
T Consensus 251 ~~~~~~~~~~~~l~~~~~~k~~~ly~~~ 278 (295)
T KOG0648|consen 251 LEEFYLGLTAIVLTTTYTGKESYLYYNE 278 (295)
T ss_pred HhhhcCCccceeccccccCccccccccc
Confidence 9999999999999999999999999985
|
|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK13910 DNA glycosylase MutY; Provisional | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01084 mutY A/G-specific adenine glycosylase | Back alignment and domain information |
|---|
| >KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4111 Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 346 | ||||
| 3h95_A | 199 | Crystal Structure Of The Nudix Domain Of Nudt6 Leng | 6e-18 | ||
| 1vc8_A | 126 | Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydr | 5e-07 | ||
| 1vc9_A | 126 | Crystal Structure Of A T.thermophilus Hb8 Ap6a Hydr | 1e-06 | ||
| 3grn_A | 153 | Crystal Structure Of Mutt Protein From Methanosarci | 1e-04 | ||
| 3r03_A | 144 | The Crystal Structure Of Nudix Hydrolase From Rhodo | 8e-04 |
| >pdb|3H95|A Chain A, Crystal Structure Of The Nudix Domain Of Nudt6 Length = 199 | Back alignment and structure |
|
| >pdb|1VC8|A Chain A, Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydrolase Ndx1-Ap6a Complex Length = 126 | Back alignment and structure |
| >pdb|1VC9|A Chain A, Crystal Structure Of A T.thermophilus Hb8 Ap6a Hydrolase E50q Mutant- Mg2+-atp Complex Length = 126 | Back alignment and structure |
| >pdb|3GRN|A Chain A, Crystal Structure Of Mutt Protein From Methanosarcina Mazei Go1 Length = 153 | Back alignment and structure |
| >pdb|3R03|A Chain A, The Crystal Structure Of Nudix Hydrolase From Rhodospirillum Rubrum Length = 144 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 346 | |||
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 7e-52 | |
| 3fxt_A | 113 | Nucleoside diphosphate-linked moiety X motif 6; nu | 7e-31 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 3e-23 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 4e-23 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 1e-22 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 2e-22 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 1e-19 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 2e-17 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 6e-17 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 4e-16 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 8e-16 | |
| 1xsa_A | 153 | BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, | 9e-16 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 1e-15 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 1e-15 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 7e-15 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 8e-15 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 2e-14 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 2e-13 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 1e-12 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 1e-12 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 2e-12 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 6e-12 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 9e-12 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 1e-11 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 2e-11 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 2e-11 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 2e-11 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 6e-11 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 7e-11 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 9e-11 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 2e-10 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 2e-10 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 6e-10 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 2e-09 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 2e-09 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 7e-09 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 1e-08 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 2e-08 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 2e-08 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 3e-08 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 4e-08 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 8e-08 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 3e-07 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 4e-07 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 4e-07 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 1e-06 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 1e-06 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 2e-06 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 9e-06 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 1e-05 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 1e-05 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 2e-05 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 5e-05 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 9e-05 |
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
Score = 169 bits (430), Expect = 7e-52
Identities = 61/192 (31%), Positives = 92/192 (47%), Gaps = 15/192 (7%)
Query: 157 YHHAEPGYVMLTYWIPVEPCMLPGSPSHQIGVGGFVMNDK-REVLVVKEKCPRSCSGMWK 215
+HH G + T + S SHQ+GV G V ++ R++LVV+++ MWK
Sbjct: 4 HHHHSSGVDLGT------ENLYFQSMSHQVGVAGAVFDESTRKILVVQDR--NKLKNMWK 55
Query: 216 IPTGYINKSEDLFSGAVREVKEETGVDTIFLEMVAFRHVHLV--AFEKSDLLFVCMLKPL 273
P G ED+ AVREV EETG+ + F +++ R H AF KSD+ +C LKP
Sbjct: 56 FPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQQHTNPGAFGKSDMYIICRLKPY 115
Query: 274 SFEITIYEKEIQAAKWMPLEEFVKQPFYLEDDMSRKVIDICIKAYDDRFNG--FIAHELA 331
SF I ++E +WM L + K ++ +V + + Y + F+ EL
Sbjct: 116 SFTINFCQEECLRCEWMDLNDLAKTENTTP--ITSRVARLLLYGYREGFDKIDLTVEELP 173
Query: 332 SKLDGKLSCLYH 343
+ G LYH
Sbjct: 174 AVYTGLFYKLYH 185
|
| >3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189 | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206 | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187 | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273 | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Length = 300 | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Length = 226 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Length = 240 | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| 3fxt_A | 113 | Nucleoside diphosphate-linked moiety X motif 6; nu | 99.9 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.89 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.87 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.85 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.85 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.85 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.84 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.83 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.83 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.83 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.83 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.83 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.83 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.82 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.82 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.82 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 99.82 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.82 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.82 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.81 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.81 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.81 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.81 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.81 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.81 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.8 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.8 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.8 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.8 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.8 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.8 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.8 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.79 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.79 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.78 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.78 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.78 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.78 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.78 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.78 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.78 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.77 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.77 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.77 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.77 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.76 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.76 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.76 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.76 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.76 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.75 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.75 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.75 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.75 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.74 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.73 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.72 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.72 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.72 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.72 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.7 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.69 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.69 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.68 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.68 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.66 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.65 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.64 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 99.57 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 99.56 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.52 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 99.51 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 99.45 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 99.35 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 99.3 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.29 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 98.84 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 98.78 |
| >3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.90 E-value=1.6e-24 Score=176.01 Aligned_cols=92 Identities=29% Similarity=0.506 Sum_probs=82.3
Q ss_pred CCCccccccCCccCCCCcEEeCCCC----CCCChHHHHHHHHHHhHHhHhcCceeEEEEccccccCchHHHHhcccceec
Q 019077 84 APIFVPEFLDPFDDEYDGVIINPEN----LPSSANAFVSALRASLSNWKLKGKKGVWLKILSKQADLVPIAIQEGFSYHH 159 (346)
Q Consensus 84 ~~~~~~~~~~~~~d~~~g~~v~~~~----~~~~~~~f~~~l~~sl~~w~~~~~r~vw~~l~~~~~~l~~~a~~~gf~~H~ 159 (346)
+..++..+|+|+.|+||||+|+..+ .+.|+++|...|++||.+|+.+|+++||++||+.++++++.|+++||.|||
T Consensus 17 ~~~~~~~~l~g~~DrygGV~Vd~~~l~~~~~~d~~~F~~~L~~SL~~Wr~~gk~~IWlklpi~~s~lIp~a~~~GF~fHH 96 (113)
T 3fxt_A 17 NLYFQSMDLQGELDRFGGISVRLARLDALDRLDAAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHH 96 (113)
T ss_dssp ----CCCCCCCEECTTSCEEEEHHHHTTTSCBCHHHHHHHHHHHHHHHHHTTCCEEEEEEEGGGGGGHHHHHHTTCEEEE
T ss_pred ccccccccccCCccCcCCEEEeCCccCCcCcCCHHHHHHHHHHHHHHHHHcCCeeEEEEcCHHHhhhHHHHHHcCceeec
Confidence 4468899999999999999999754 346999999999999999999999999999999999999999999999999
Q ss_pred CCCceeEeeccccCCC
Q 019077 160 AEPGYVMLTYWIPVEP 175 (346)
Q Consensus 160 ~~~~~~~l~~wl~~~~ 175 (346)
|+++|+||++||++.+
T Consensus 97 Ae~dylmL~~WLpe~p 112 (113)
T 3fxt_A 97 AESDSSTLTLWLREGP 112 (113)
T ss_dssp EEBTEEEEEEECCC--
T ss_pred CCCCeEEEEEecCcCC
Confidence 9999999999999875
|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 346 | ||||
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 4e-19 | |
| d1vcda1 | 126 | d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t | 2e-17 | |
| d2b0va1 | 146 | d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N | 7e-16 | |
| d1irya_ | 156 | d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha | 1e-13 | |
| d2fvva1 | 135 | d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat | 1e-13 | |
| d2azwa1 | 147 | d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E | 3e-13 | |
| d2a6ta2 | 151 | d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c | 3e-13 | |
| d1ryaa_ | 160 | d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD | 5e-13 | |
| d1k2ea_ | 152 | d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa | 6e-13 | |
| d1vk6a2 | 131 | d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher | 4e-12 | |
| d1xsba_ | 153 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 8e-12 | |
| d2b06a1 | 155 | d.113.1.1 (A:1-155) Hypothetical protein SP1235 (s | 1e-10 | |
| d1puna_ | 129 | d.113.1.1 (A:) Nucleoside triphosphate pyrophospho | 2e-10 | |
| d1hzta_ | 153 | d.113.1.2 (A:) Isopentenyl diphosphate isomerase { | 7e-10 | |
| d2fkba1 | 161 | d.113.1.2 (A:8-168) Hypothetical protein YfcD {Esc | 4e-09 | |
| d1v8ya_ | 158 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus | 5e-09 | |
| d1jkna_ | 165 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 6e-09 | |
| d1nqza_ | 187 | d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinoco | 6e-09 | |
| d2fmla2 | 202 | d.113.1.6 (A:3-204) Hypothetical protein EF2700, N | 7e-09 | |
| d1ktga_ | 137 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 1e-08 | |
| d2o5fa1 | 162 | d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D | 1e-08 | |
| d2fb1a2 | 147 | d.113.1.6 (A:3-149) Hypothetical protein BT0354, N | 1e-06 | |
| d1u20a1 | 196 | d.113.1.1 (A:14-209) U8 snorna-binding protein x29 | 2e-06 | |
| d1q33a_ | 292 | d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr | 3e-06 | |
| d1vhza_ | 186 | d.113.1.1 (A:) ADP compounds hydrolase NudE {Esche | 4e-05 | |
| d1rrqa2 | 127 | d.113.1.3 (A:234-360) Adenine glycosylase MutY, C- | 2e-04 |
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: Hypothetical protein DR1025 species: Deinococcus radiodurans [TaxId: 1299]
Score = 81.0 bits (199), Expect = 4e-19
Identities = 28/136 (20%), Positives = 58/136 (42%), Gaps = 4/136 (2%)
Query: 182 PSHQIGVGGFVMNDKREVLVVKEKCP---RSCSGMWKIPTGYINKSEDLFSGAVREVKEE 238
P G ++N++ ++L+V+EK +G+W IP+G + E+ AVRE EE
Sbjct: 9 PVELRAAGVVLLNERGDILLVQEKGIPGHPEKAGLWHIPSGAVEDGENPQDAAVREACEE 68
Query: 239 TGVDTIFLEMVA-FRHVHLVAFEKSDLLFVCMLKPLSFEITIYEKEIQAAKWMPLEEFVK 297
TG+ ++ + + +++ +P + EI A ++ E+F +
Sbjct: 69 TGLRVRPVKFLGAYLGRFPDGVLILRHVWLAEPEPGQTLAPAFTDEIAEASFVSREDFAQ 128
Query: 298 QPFYLEDDMSRKVIDI 313
+ M + +
Sbjct: 129 LYAAGQIRMYQTKLFY 144
|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146 | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152 | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131 | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Length = 155 | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Length = 129 | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Length = 187 | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202 | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Length = 137 | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196 | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Length = 186 | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 127 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.88 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.87 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.85 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.85 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.84 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.83 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.82 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.82 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.81 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.8 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.79 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.79 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.78 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.78 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.78 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.78 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.77 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.76 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.76 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.76 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.74 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.74 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.72 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 99.72 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.7 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 99.6 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 99.48 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 99.46 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 99.39 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 99.26 |
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: NADH pyrophosphatase domain: NADH pyrophosphatase species: Escherichia coli [TaxId: 562]
Probab=99.88 E-value=7.2e-22 Score=163.72 Aligned_cols=127 Identities=19% Similarity=0.247 Sum_probs=99.3
Q ss_pred eEEEEEEEeCCCeEEEEeecCCCCCCCceeeeeEEecCCCCHHHHHHHHHHHHhCCceeeeEEEEEEeeeccccceeEEE
Q 019077 186 IGVGGFVMNDKREVLVVKEKCPRSCSGMWKIPTGYINKSEDLFSGAVREVKEETGVDTIFLEMVAFRHVHLVAFEKSDLL 265 (346)
Q Consensus 186 v~V~avVin~~~~VLLvrr~~~~~~~g~W~lPGG~ve~GEs~~eAA~REv~EETGl~v~~~~ll~~~~~~~~~~~~~~~~ 265 (346)
++|.++|.+ ++++||+++++. .+|.|.+|||++|+|||+++||+||++||||+++.....++...... .....++
T Consensus 4 paViv~i~~-~~~vLL~~~~~~--~~g~w~lpGG~ve~GEt~~~aa~REl~EEtG~~~~~~~~~~~~~~~~--~~~~~~~ 78 (131)
T d1vk6a2 4 PCIIVAIRR-DDSILLAQHTRH--RNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPF--PQSLMTA 78 (131)
T ss_dssp EEEEEEEEE-TTEEEEEEETTT--CSSCCBCEEEECCTTCCHHHHHHHHHHHHHCCEEEEEEEEEEEEEET--TEEEEEE
T ss_pred cEEEEEEEe-CCEEEEEEeccC--CCCCEecccCCCcCCCcHHHHHHHHHHHHhCCcccceeEEEEeccCc--CceEEEE
Confidence 566555554 579999998754 35899999999999999999999999999999998888777543332 2345566
Q ss_pred EEEEEecCCccccCCccccceEEEEchhhhhcCCCCCccHHHHHHHHHHHHHhcCC
Q 019077 266 FVCMLKPLSFEITIYEKEIQAAKWMPLEEFVKQPFYLEDDMSRKVIDICIKAYDDR 321 (346)
Q Consensus 266 fv~~l~~~~~~i~~~~~Ei~~~~Wv~~eel~~l~~~~~~~~~~~ii~~~l~~~~~~ 321 (346)
|++... .+++.+++.|+.+++|++++|++.++... .+.+.+|+.+++..+..
T Consensus 79 f~~~~~--~~~~~~~~~E~~~~~W~~~~el~~l~~~~--~i~r~li~~~l~~~r~~ 130 (131)
T d1vk6a2 79 FMAEYD--SGDIVIDPKELLEANWYRYDDLPLLPPPG--TVARRLIEDTVAMCRAE 130 (131)
T ss_dssp EEEEEE--ECCCCCCTTTEEEEEEEETTSCCSCCCTT--SHHHHHHHHHHHHHHHC
T ss_pred EEEEEc--CCcccCCCccEEEEEEEcHHHHhhCCCCh--HHHHHHHHHHHHHHHhc
Confidence 666653 45677788999999999999999887654 36788888888877654
|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|