Citrus Sinensis ID: 019100


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
METNSSGGGSSSGSLGSSSTMILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRMLGFAPIKEMLHADICVSLGTDGAPSNNRMSIGPFYF
ccccccccccccccccccccEEEEccEEEEEcccccEEEcEEEEEEccEEEEEccccHHHHHHcccccEEEEccccEEEccccccccccHHHHccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccEEcccccccHHHHHHHHHHHccEEEEEccEEEcccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHccccccHHHHHHHcccccccEEEEEEEcccHHHHHHHHHccccEEEcccccccccccccHHHHHHccccEEEcccccccccccccccccc
cccccccccccccccccccEEEEEcEEEEEccccccEEcccEEEEEccEEEEEcccccHHHHccHHccEEEEccccEEEcccHcHHHHHHHHHHHcHHccHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHccccEHHccHHccHHHHHHHHHHcccEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccHHHHHHHcccccccEEEEEEEEccHHHHHHHHHcccEEEEcccccccEcccccHHHHHHcccEEEEEcccccccccccEEEEcc
metnssgggsssgslgssstmILHNAVIVTMDkesrvfrnggvfVVQDRIKAIGQSADILQQFSQMADQIIDLQsqillpgfvnthvHTSQQLAKGIADDVDLMTWLhdriwpyesnmteedSYISTLLCGIELIHSGVTcfaeaggqHVSEMAKAVELLGLRACLVQstmdcgeglpaswavrttDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHvaeipyenqvvmdtrkvdhgtvTFLDKIEFLQNNLLSAHTVWVNHTEIgllsragvkvshcpasamrmlGFAPIKEMLHADICVslgtdgapsnnrmsigpfyf
metnssgggsssgslgssstMILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHvaeipyenqvvMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRMLGFAPIKEMLHADICVSLgtdgapsnnrmsigpfyf
METNssgggsssgslgsssTMILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRMLGFAPIKEMLHADICVSLGTDGAPSNNRMSIGPFYF
********************MILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRMLGFAPIKEMLHADICVSLGT****************
********************MILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRMLGFAPIKEMLHADICVSLGTDGAPSNNRMSIGPFYF
*****************SSTMILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRMLGFAPIKEMLHADICVSLGTDGAPSNNRMSIGPFYF
*****************SSTMILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRMLGFAPIKEMLHADICVSLGTDGAPSNNRMSIGPFYF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METNSSGGGSSSGSLGSSSTMILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRMLGFAPIKEMLHADICVSLGTDGAPSNNRMSIGPFYF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query346 2.2.26 [Sep-21-2011]
A5UMN6 435 5-methylthioadenosine/S-a yes no 0.884 0.703 0.387 2e-57
Q466Q9 432 5-methylthioadenosine/S-a yes no 0.881 0.706 0.354 7e-48
Q8PUQ3 432 5-methylthioadenosine/S-a yes no 0.881 0.706 0.350 8e-48
Q8TRA4 432 5-methylthioadenosine/S-a yes no 0.875 0.701 0.339 6e-46
A5D1G6 433 5-methylthioadenosine/S-a yes no 0.887 0.709 0.334 4e-45
Q0AYV2 431 5-methylthioadenosine/S-a yes no 0.881 0.707 0.346 6e-45
O27549 427 5-methylthioadenosine/S-a yes no 0.832 0.674 0.356 4e-42
C6A048 424 5-methylthioadenosine/S-a yes no 0.817 0.667 0.32 8e-41
Q2NHL6 425 5-methylthioadenosine/S-a yes no 0.881 0.717 0.314 8e-41
B5YLB7 439 5-methylthioadenosine/S-a yes no 0.904 0.712 0.307 3e-40
>sp|A5UMN6|MTAD_METS3 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=mtaD PE=3 SV=1 Back     alignment and function desciption
 Score =  223 bits (567), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 127/328 (38%), Positives = 195/328 (59%), Gaps = 22/328 (6%)

Query: 17  SSSTMILHNAVIVT-MD-KESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQ 74
           + +T+++ +A+I+  +D KE +    G + +  D+I  IG   D         D++ID +
Sbjct: 2   TDNTILIKDALILNPLDFKEIK----GSLLIKNDKIAEIGTDID-----ESNVDKVIDAK 52

Query: 75  SQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIEL 134
            +ILLPGFVNTH H S  L +G+ADD+ L +WL+D IWP E+N+T E  YI  LL  IEL
Sbjct: 53  GKILLPGFVNTHTHLSMTLFRGLADDLSLDSWLNDNIWPMEANLTSEYCYIGALLGAIEL 112

Query: 135 IHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQK 194
           I SG T F++    ++ ++AKAVE  G+RA L    +D G+           +  I+   
Sbjct: 113 IKSGTTTFSDM-YFYMEDVAKAVEESGIRAVLSYGMIDFGDD-------EKREHEIKENI 164

Query: 195 ELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVM 254
            L+ K +  ADGRI+++FG      A+  LL + R +A E+ TGIH+HV+E   E    +
Sbjct: 165 ALFEKCNGMADGRIKVFFGPHSPYTASKDLLEDVRWLANEYNTGIHIHVSETQKEINDSL 224

Query: 255 DTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRML-GF 313
           +    D     +LD I FL  ++++AH+VW++H EI ++ R  VK+SH P S M++  G 
Sbjct: 225 EAH--DLRPFEYLDSIGFLGPDVVAAHSVWLSHNEIEIIKRNNVKISHNPCSNMKLASGI 282

Query: 314 APIKEMLHADICVSLGTDGAPSNNRMSI 341
           API++++  DICV +GTDGA SNN + +
Sbjct: 283 APIQDLITNDICVGIGTDGASSNNNLDL 310




Catalyzes the deamination of 5-methylthioadenosine and S-adenosyl-L-homocysteine into 5-methylthioinosine and S-inosyl-L-homocysteine, respectively. Is also able to deaminate adenosine.
Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) (taxid: 420247)
EC: 3EC: .EC: 5EC: .EC: 4EC: .EC: 3EC: 1
>sp|Q466Q9|MTAD_METBF 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=mtaD PE=3 SV=1 Back     alignment and function description
>sp|Q8PUQ3|MTAD_METMA 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=mtaD PE=3 SV=2 Back     alignment and function description
>sp|Q8TRA4|MTAD_METAC 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=mtaD PE=3 SV=2 Back     alignment and function description
>sp|A5D1G6|MTAD_PELTS 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mtaD PE=3 SV=1 Back     alignment and function description
>sp|Q0AYV2|MTAD_SYNWW 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Syntrophomonas wolfei subsp. wolfei (strain Goettingen) GN=mtaD PE=3 SV=1 Back     alignment and function description
>sp|O27549|MTAD_METTH 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=mtaD PE=3 SV=1 Back     alignment and function description
>sp|C6A048|MTAD_THESM 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=mtaD PE=3 SV=1 Back     alignment and function description
>sp|Q2NHL6|MTAD_METST 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Methanosphaera stadtmanae (strain DSM 3091) GN=mtaD PE=3 SV=1 Back     alignment and function description
>sp|B5YLB7|MTAD_THEYD 5-methylthioadenosine/S-adenosylhomocysteine deaminase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mtaD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
255547626 471 Atrazine chlorohydrolase, putative [Rici 0.939 0.690 0.833 1e-162
225425192 469 PREDICTED: 5-methylthioadenosine/S-adeno 0.939 0.692 0.821 1e-159
147857762 470 hypothetical protein VITISV_008190 [Viti 0.939 0.691 0.821 1e-159
449468824 484 PREDICTED: 5-methylthioadenosine/S-adeno 0.936 0.669 0.817 1e-157
296088709 493 unnamed protein product [Vitis vinifera] 0.939 0.659 0.765 1e-155
357152672 468 PREDICTED: 5-methylthioadenosine/S-adeno 0.939 0.694 0.739 1e-145
226502244 468 LOC100283572 [Zea mays] gi|195635661|gb| 0.921 0.681 0.743 1e-142
115488528 471 Os12g0468600 [Oryza sativa Japonica Grou 0.921 0.677 0.734 1e-141
168021897 561 predicted protein [Physcomitrella patens 0.916 0.565 0.685 1e-129
302824689 473 hypothetical protein SELMODRAFT_431949 [ 0.924 0.676 0.640 1e-126
>gi|255547626|ref|XP_002514870.1| Atrazine chlorohydrolase, putative [Ricinus communis] gi|223545921|gb|EEF47424.1| Atrazine chlorohydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  575 bits (1483), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 294/325 (90%)

Query: 17  SSSTMILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQ 76
           SS  +ILHNA IVTMD ESRVFRNGGVF+ QD+IKAIGQS+DIL ++S +AD II+L  Q
Sbjct: 7   SSVLIILHNAAIVTMDAESRVFRNGGVFIEQDKIKAIGQSSDILGEYSTIADHIINLHGQ 66

Query: 77  ILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIH 136
            LLPGFVNTHVHTSQQL +GIADDVDLMTWLH RIWPYESNMTE DSYISTLLCGIELIH
Sbjct: 67  FLLPGFVNTHVHTSQQLGRGIADDVDLMTWLHRRIWPYESNMTELDSYISTLLCGIELIH 126

Query: 137 SGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKEL 196
           SGVTCFAEAGGQHVS MAKA E LGLRACL QS MD GEGLP SWA RTTDDCIQSQKEL
Sbjct: 127 SGVTCFAEAGGQHVSGMAKAAEELGLRACLTQSVMDSGEGLPPSWASRTTDDCIQSQKEL 186

Query: 197 YAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDT 256
           Y K+H+ A+GRIR+WFGIRQIMN+TDRLLLETRD+ARE  TGIHMHV+EI YENQVVMDT
Sbjct: 187 YEKYHNTAEGRIRVWFGIRQIMNSTDRLLLETRDIARELNTGIHMHVSEIAYENQVVMDT 246

Query: 257 RKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRMLGFAPI 316
           RKV+HGTVTFLDKI+FLQ NLL+AHTVWVN+ EIGLLSRAGVKVSHCPASAMRMLGFAPI
Sbjct: 247 RKVEHGTVTFLDKIDFLQKNLLAAHTVWVNNAEIGLLSRAGVKVSHCPASAMRMLGFAPI 306

Query: 317 KEMLHADICVSLGTDGAPSNNRMSI 341
           KEML + ICVS+GTDGAPSNNRMS+
Sbjct: 307 KEMLDSSICVSVGTDGAPSNNRMSM 331




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225425192|ref|XP_002265828.1| PREDICTED: 5-methylthioadenosine/S-adenosylhomocysteine deaminase [Vitis vinifera] Back     alignment and taxonomy information
>gi|147857762|emb|CAN80808.1| hypothetical protein VITISV_008190 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449468824|ref|XP_004152121.1| PREDICTED: 5-methylthioadenosine/S-adenosylhomocysteine deaminase-like [Cucumis sativus] gi|449484683|ref|XP_004156951.1| PREDICTED: 5-methylthioadenosine/S-adenosylhomocysteine deaminase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296088709|emb|CBI38159.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357152672|ref|XP_003576198.1| PREDICTED: 5-methylthioadenosine/S-adenosylhomocysteine deaminase-like isoform 1 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|226502244|ref|NP_001149944.1| LOC100283572 [Zea mays] gi|195635661|gb|ACG37299.1| amidohydrolase family protein [Zea mays] Back     alignment and taxonomy information
>gi|115488528|ref|NP_001066751.1| Os12g0468600 [Oryza sativa Japonica Group] gi|77555621|gb|ABA98417.1| Amidohydrolase family protein, expressed [Oryza sativa Japonica Group] gi|108862664|gb|ABG22018.1| Amidohydrolase family protein, expressed [Oryza sativa Japonica Group] gi|113649258|dbj|BAF29770.1| Os12g0468600 [Oryza sativa Japonica Group] gi|215686380|dbj|BAG87641.1| unnamed protein product [Oryza sativa Japonica Group] gi|215713483|dbj|BAG94620.1| unnamed protein product [Oryza sativa Japonica Group] gi|222617055|gb|EEE53187.1| hypothetical protein OsJ_36050 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|168021897|ref|XP_001763477.1| predicted protein [Physcomitrella patens subsp. patens] gi|162685270|gb|EDQ71666.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|302824689|ref|XP_002993985.1| hypothetical protein SELMODRAFT_431949 [Selaginella moellendorffii] gi|300138147|gb|EFJ04925.1| hypothetical protein SELMODRAFT_431949 [Selaginella moellendorffii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
ASPGD|ASPL0000035211 464 AN3194 [Emericella nidulans (t 0.901 0.672 0.325 2.7e-45
TIGR_CMR|CHY_0698 444 CHY_0698 "amidohydrolase famil 0.893 0.695 0.321 6.6e-42
POMBASE|SPAC1F8.04c 463 SPAC1F8.04c "hydrolase (predic 0.913 0.682 0.290 4.9e-37
UNIPROTKB|Q48FM5 443 PSPPH_3669 "Hydrolase, Atz/Trz 0.884 0.690 0.307 9.5e-34
UNIPROTKB|Q81S14 435 mtaD "5-methylthioadenosine/S- 0.872 0.694 0.300 4.7e-32
TIGR_CMR|BA_1865 435 BA_1865 "chlorohydrolase famil 0.872 0.694 0.300 4.7e-32
TIGR_CMR|CHY_1438 433 CHY_1438 "amidohydrolase famil 0.872 0.697 0.302 4.2e-31
TIGR_CMR|CBU_0521 484 CBU_0521 "chlorohydrolase fami 0.849 0.607 0.270 3.5e-29
DICTYBASE|DDB_G0285467 482 DDB_G0285467 "putative amidohy 0.786 0.564 0.287 7.5e-29
TIGR_CMR|SPO_2957 444 SPO_2957 "hydroxydechloroatraz 0.884 0.689 0.246 5.8e-18
ASPGD|ASPL0000035211 AN3194 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
 Score = 476 (172.6 bits), Expect = 2.7e-45, P = 2.7e-45
 Identities = 107/329 (32%), Positives = 181/329 (55%)

Query:    21 MILHNAVIVTMDKESRVFRNGGVFVVQ--DRIKAIGQSADILQQFSQMADQIIDLQSQIL 78
             M+  +A I+T+D   R+  +G ++V +  +RI ++G++A +L Q+    ++  DL  +I+
Sbjct:     1 MLFTHATILTLDSTRRIITDGAIYVPRGSNRISSLGKTAALLAQYPD--EEKYDLTGRIV 58

Query:    79 LPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSG 138
             +PG V+TH+HT+Q L +G ADD++L++WL +RIW  + N T++D Y +  L   E++ SG
Sbjct:    59 IPGLVSTHMHTAQTLLRGTADDLELVSWLCERIWVLQGNFTKDDGYAAARLSIAEMLKSG 118

Query:   139 VTCFAEA--GGQHVSE-MAKAVELLGLRACLVQSTMDCGE-GLPASWA-----VRTTDDC 189
              TCF E+    ++  E + +AV   G+R CL +  MD G      +WA     +   +  
Sbjct:   119 TTCFLESMFADRYGFEGLCQAVAESGIRGCLGKIVMDKGTYAADDAWAMHPGLIEDRETS 178

Query:   190 IQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYE 249
             +    +++ K +  AD RIR+WFG R     +D L  E   ++RE    I MH AE+  +
Sbjct:   179 LLGTVKMWEKWNGKADDRIRVWFGARTPGGVSDELYREMTAISREKNIPITMHCAEVKAD 238

Query:   250 NQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMR 309
                      V H  +T+   +  L  + +  H V ++  +I LLS +G  V+HCP S  +
Sbjct:   239 RAFF---GSVGHTPMTYCSSVGLLSPSTVLVHMVHLDDRDISLLSESGTHVAHCPTSNAK 295

Query:   310 ML-GFAPIKEMLHADICVSLGTDGAPSNN 337
             +  G   + ++  A + + LGTDGAP NN
Sbjct:   296 LASGTCRVPDLQTAGVNIGLGTDGAPCNN 324




GO:0008150 "biological_process" evidence=ND
GO:0016810 "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005829 "cytosol" evidence=IEA
TIGR_CMR|CHY_0698 CHY_0698 "amidohydrolase family protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
POMBASE|SPAC1F8.04c SPAC1F8.04c "hydrolase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q48FM5 PSPPH_3669 "Hydrolase, Atz/Trz family" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q81S14 mtaD "5-methylthioadenosine/S-adenosylhomocysteine deaminase" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1865 BA_1865 "chlorohydrolase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1438 CHY_1438 "amidohydrolase family protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0521 CBU_0521 "chlorohydrolase family protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285467 DDB_G0285467 "putative amidohydrolase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2957 SPO_2957 "hydroxydechloroatrazine ethylaminohydrolase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.40.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00006976001
SubName- Full=Chromosome chr1 scaffold_180, whole genome shotgun sequence; (469 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00016416001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (376 aa)
      0.886
GSVIVG00015916001
RecName- Full=Adenosylhomocysteinase; EC=3.3.1.1; (444 aa)
       0.685
GSVIVG00031656001
RecName- Full=Adenosylhomocysteinase; EC=3.3.1.1; (445 aa)
       0.676
GSVIVG00002096001
SubName- Full=Chromosome chr19 scaffold_126, whole genome shotgun sequence; (387 aa)
       0.571
GSVIVG00034771001
RecName- Full=6,7-dimethyl-8-ribityllumazine synthase; EC=2.5.1.9; (185 aa)
      0.571
GSVIVG00019784001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (925 aa)
      0.555
GSVIVG00021876001
SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (190 aa)
     0.550
GSVIVG00029446001
SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (190 aa)
       0.531
GSVIVG00021387001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (227 aa)
       0.524
GSVIVG00035063001
SubName- Full=Chromosome chr1 scaffold_75, whole genome shotgun sequence; (127 aa)
      0.509

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
cd01298411 cd01298, ATZ_TRZ_like, TRZ/ATZ family contains enz 1e-106
PRK07228 445 PRK07228, PRK07228, N-ethylammeline chlorohydrolas 9e-78
PRK06038 430 PRK06038, PRK06038, N-ethylammeline chlorohydrolas 1e-67
COG0402 421 COG0402, SsnA, Cytosine deaminase and related meta 1e-57
PRK08393 424 PRK08393, PRK08393, N-ethylammeline chlorohydrolas 7e-54
PRK06380 418 PRK06380, PRK06380, metal-dependent hydrolase; Pro 4e-53
PRK09045 443 PRK09045, PRK09045, N-ethylammeline chlorohydrolas 6e-51
PRK08203 451 PRK08203, PRK08203, hydroxydechloroatrazine ethyla 3e-45
PRK06687 419 PRK06687, PRK06687, chlorohydrolase; Validated 9e-38
PRK15493 435 PRK15493, PRK15493, 5-methylthioadenosine/S-adenos 1e-37
PRK07203 442 PRK07203, PRK07203, putative chlorohydrolase/amino 3e-37
TIGR03314 441 TIGR03314, Se_ssnA, putative selenium metabolism p 6e-33
PRK12393 457 PRK12393, PRK12393, amidohydrolase; Provisional 6e-28
cd01303429 cd01303, GDEase, Guanine deaminase (GDEase) 1e-20
PRK08204 449 PRK08204, PRK08204, hypothetical protein; Provisio 1e-19
TIGR02967401 TIGR02967, guan_deamin, guanine deaminase 4e-18
PRK06151 488 PRK06151, PRK06151, N-ethylammeline chlorohydrolas 5e-13
cd01292275 cd01292, metallo-dependent_hydrolases, Superfamily 2e-11
PRK09228433 PRK09228, PRK09228, guanine deaminase; Provisional 8e-11
cd01312381 cd01312, Met_dep_hydrolase_D, Metallo-dependent hy 6e-10
COG1574 535 COG1574, COG1574, Predicted metal-dependent hydrol 4e-09
PRK09356406 PRK09356, PRK09356, imidazolonepropionase; Validat 4e-08
cd01313418 cd01313, Met_dep_hydrolase_E, Metallo-dependent hy 7e-07
pfam1359466 pfam13594, Amidohydro_5, Amidohydrolase 2e-06
cd00854374 cd00854, NagA, N-acetylglucosamine-6-phosphate dea 2e-06
PRK08418408 PRK08418, PRK08418, chlorohydrolase; Provisional 5e-06
cd01300 479 cd01300, YtcJ_like, YtcJ_like metal dependent amid 1e-05
PRK08418408 PRK08418, PRK08418, chlorohydrolase; Provisional 4e-05
pfam13147304 pfam13147, Amidohydro_4, Amidohydrolase 4e-05
COG0044 430 COG0044, PyrC, Dihydroorotase and related cyclic a 5e-05
pfam01979307 pfam01979, Amidohydro_1, Amidohydrolase family 8e-05
COG1820380 COG1820, NagA, N-acetylglucosamine-6-phosphate dea 1e-04
cd01305263 cd01305, archeal_chlorohydrolases, Predicted chlor 2e-04
PRK09357 423 PRK09357, pyrC, dihydroorotase; Validated 2e-04
PRK09236 444 PRK09236, PRK09236, dihydroorotase; Reviewed 5e-04
PRK13404 477 PRK13404, PRK13404, dihydropyrimidinase; Provision 5e-04
COG1228406 COG1228, HutI, Imidazolonepropionase and related a 6e-04
PRK14085382 PRK14085, PRK14085, imidazolonepropionase; Provisi 6e-04
PRK15446383 PRK15446, PRK15446, phosphonate metabolism protein 9e-04
PRK10657388 PRK10657, PRK10657, isoaspartyl dipeptidase; Provi 0.001
cd01296371 cd01296, Imidazolone-5PH, Imidazolonepropionase/im 0.001
PRK05985391 PRK05985, PRK05985, cytosine deaminase; Provisiona 0.001
TIGR03178 443 TIGR03178, allantoinase, allantoinase 0.002
cd01315 447 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and A 0.004
cd01314 447 cd01314, D-HYD, D-hydantoinases (D-HYD) also calle 0.004
>gnl|CDD|238623 cd01298, ATZ_TRZ_like, TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
 Score =  315 bits (810), Expect = e-106
 Identities = 123/322 (38%), Positives = 181/322 (56%), Gaps = 16/322 (4%)

Query: 21  MILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLP 80
           +++ N  IVT D   RV  +G V V   RI A+G +       +  AD++ID + ++++P
Sbjct: 1   ILIRNGTIVTTD-PRRVLEDGDVLVEDGRIVAVGPAL---PLPAYPADEVIDAKGKVVMP 56

Query: 81  GFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVT 140
           G VNTH H +  L +G+ADD+ LM WL D IWP E  +TEED Y+  LL   E+I SG T
Sbjct: 57  GLVNTHTHLAMTLLRGLADDLPLMEWLKDLIWPLERLLTEEDVYLGALLALAEMIRSGTT 116

Query: 141 CFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKH 200
            FA+    +   +A+A E LG+RA L +  MD G        V  T++ +   + L  + 
Sbjct: 117 TFADMYFFYPDAVAEAAEELGIRAVLGRGIMDLGTE-----DVEETEEALAEAERLIREW 171

Query: 201 HHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDTRKVD 260
           H AADGRIR+          +D LL E  ++ARE+   +H+H+AE   E    ++     
Sbjct: 172 HGAADGRIRVALAPHAPYTCSDELLREVAELAREYGVPLHIHLAETEDE----VEESLEK 227

Query: 261 HG--TVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRM-LGFAPIK 317
           +G   V +L+++  L  +++ AH VW+   EI LL+  G  V+H PAS M++  G AP+ 
Sbjct: 228 YGKRPVEYLEELGLLGPDVVLAHCVWLTDEEIELLAETGTGVAHNPASNMKLASGIAPVP 287

Query: 318 EMLHADICVSLGTDGAPSNNRM 339
           EML A + V LGTDGA SNN +
Sbjct: 288 EMLEAGVNVGLGTDGAASNNNL 309


Atrazine, a chlorinated herbizide, can be catabolized by a variety of different bacteria. The first three steps of the atrazine dehalogenation pathway are catalyzed by atrazine chlorohydrolase (AtzA), hydroxyatrazine ethylaminohydrolase (AtzB), and N-isopropylammelide N-isopropylaminohydrolase (AtzC). All three enzymes belong to the superfamily of metal dependent hydrolases. AtzA and AtzB, beside other related enzymes are represented in this CD. Length = 411

>gnl|CDD|180895 PRK07228, PRK07228, N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|180363 PRK06038, PRK06038, N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|223479 COG0402, SsnA, Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|181411 PRK08393, PRK08393, N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|180548 PRK06380, PRK06380, metal-dependent hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|236366 PRK09045, PRK09045, N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|236184 PRK08203, PRK08203, hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>gnl|CDD|180657 PRK06687, PRK06687, chlorohydrolase; Validated Back     alignment and domain information
>gnl|CDD|185390 PRK15493, PRK15493, 5-methylthioadenosine/S-adenosylhomocysteine deaminase; Provisional Back     alignment and domain information
>gnl|CDD|235963 PRK07203, PRK07203, putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>gnl|CDD|132357 TIGR03314, Se_ssnA, putative selenium metabolism protein SsnA Back     alignment and domain information
>gnl|CDD|237088 PRK12393, PRK12393, amidohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|238628 cd01303, GDEase, Guanine deaminase (GDEase) Back     alignment and domain information
>gnl|CDD|181288 PRK08204, PRK08204, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132012 TIGR02967, guan_deamin, guanine deaminase Back     alignment and domain information
>gnl|CDD|180428 PRK06151, PRK06151, N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|238617 cd01292, metallo-dependent_hydrolases, Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>gnl|CDD|236419 PRK09228, PRK09228, guanine deaminase; Provisional Back     alignment and domain information
>gnl|CDD|238637 cd01312, Met_dep_hydrolase_D, Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>gnl|CDD|224490 COG1574, COG1574, Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|236478 PRK09356, PRK09356, imidazolonepropionase; Validated Back     alignment and domain information
>gnl|CDD|238638 cd01313, Met_dep_hydrolase_E, Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>gnl|CDD|222250 pfam13594, Amidohydro_5, Amidohydrolase Back     alignment and domain information
>gnl|CDD|238434 cd00854, NagA, N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>gnl|CDD|181419 PRK08418, PRK08418, chlorohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|238625 cd01300, YtcJ_like, YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>gnl|CDD|181419 PRK08418, PRK08418, chlorohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|221936 pfam13147, Amidohydro_4, Amidohydrolase Back     alignment and domain information
>gnl|CDD|223122 COG0044, PyrC, Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|216825 pfam01979, Amidohydro_1, Amidohydrolase family Back     alignment and domain information
>gnl|CDD|224733 COG1820, NagA, N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|238630 cd01305, archeal_chlorohydrolases, Predicted chlorohydrolases Back     alignment and domain information
>gnl|CDD|236479 PRK09357, pyrC, dihydroorotase; Validated Back     alignment and domain information
>gnl|CDD|181716 PRK09236, PRK09236, dihydroorotase; Reviewed Back     alignment and domain information
>gnl|CDD|184033 PRK13404, PRK13404, dihydropyrimidinase; Provisional Back     alignment and domain information
>gnl|CDD|224149 COG1228, HutI, Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|237604 PRK14085, PRK14085, imidazolonepropionase; Provisional Back     alignment and domain information
>gnl|CDD|237967 PRK15446, PRK15446, phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>gnl|CDD|182623 PRK10657, PRK10657, isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>gnl|CDD|238621 cd01296, Imidazolone-5PH, Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>gnl|CDD|180337 PRK05985, PRK05985, cytosine deaminase; Provisional Back     alignment and domain information
>gnl|CDD|163175 TIGR03178, allantoinase, allantoinase Back     alignment and domain information
>gnl|CDD|238640 cd01315, L-HYD_ALN, L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>gnl|CDD|238639 cd01314, D-HYD, D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 346
PRK15493 435 5-methylthioadenosine/S-adenosylhomocysteine deami 100.0
PRK06687 419 chlorohydrolase; Validated 100.0
TIGR03314 441 Se_ssnA putative selenium metabolism protein SsnA. 100.0
PRK07203 442 putative chlorohydrolase/aminohydrolase; Validated 100.0
PRK12393 457 amidohydrolase; Provisional 100.0
PRK07228 445 N-ethylammeline chlorohydrolase; Provisional 100.0
PRK09045 443 N-ethylammeline chlorohydrolase; Provisional 100.0
PRK08203 451 hydroxydechloroatrazine ethylaminohydrolase; Revie 100.0
PRK06038 430 N-ethylammeline chlorohydrolase; Provisional 100.0
cd01303429 GDEase Guanine deaminase (GDEase). Guanine deamina 100.0
PRK06380 418 metal-dependent hydrolase; Provisional 100.0
PRK08418408 chlorohydrolase; Provisional 100.0
PRK08393 424 N-ethylammeline chlorohydrolase; Provisional 100.0
PRK09228433 guanine deaminase; Provisional 100.0
COG0402 421 SsnA Cytosine deaminase and related metal-dependen 100.0
TIGR02967401 guan_deamin guanine deaminase. This model describe 100.0
cd01312381 Met_dep_hydrolase_D Metallo-dependent hydrolases, 100.0
cd01298411 ATZ_TRZ_like TRZ/ATZ family contains enzymes from 100.0
PRK08204 449 hypothetical protein; Provisional 100.0
PRK06151 488 N-ethylammeline chlorohydrolase; Provisional 100.0
cd01313418 Met_dep_hydrolase_E Metallo-dependent hydrolases, 100.0
TIGR02022 455 hutF formiminoglutamate deiminase. In some species 100.0
PRK09229 456 N-formimino-L-glutamate deiminase; Validated 100.0
PRK07213375 chlorohydrolase; Provisional 100.0
KOG3968439 consensus Atrazine chlorohydrolase/guanine deamina 100.0
PRK09230426 cytosine deaminase; Provisional 100.0
cd01293398 Bact_CD Bacterial cytosine deaminase and related m 100.0
PRK09356406 imidazolonepropionase; Validated 100.0
PRK14085382 imidazolonepropionase; Provisional 100.0
PRK07572426 cytosine deaminase; Validated 99.98
TIGR01224377 hutI imidazolonepropionase. This enzyme catalyzes 99.97
cd01305263 archeal_chlorohydrolases Predicted chlorohydrolase 99.97
PRK05985391 cytosine deaminase; Provisional 99.96
cd01296371 Imidazolone-5PH Imidazolonepropionase/imidazolone- 99.96
COG1574535 Predicted metal-dependent hydrolase with the TIM-b 99.95
PRK06846410 putative deaminase; Validated 99.95
cd01314 447 D-HYD D-hydantoinases (D-HYD) also called dihydrop 99.95
PLN02942 486 dihydropyrimidinase 99.94
PRK07583438 cytosine deaminase-like protein; Validated 99.94
TIGR02033 454 D-hydantoinase D-hydantoinase. This model represen 99.93
PRK12394379 putative metallo-dependent hydrolase; Provisional 99.93
PRK08323 459 phenylhydantoinase; Validated 99.92
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 99.92
cd01300479 YtcJ_like YtcJ_like metal dependent amidohydrolase 99.91
COG1228406 HutI Imidazolonepropionase and related amidohydrol 99.89
PRK10657388 isoaspartyl dipeptidase; Provisional 99.89
PRK09357 423 pyrC dihydroorotase; Validated 99.88
cd01297415 D-aminoacylase D-aminoacylases (N-acyl-D-Amino aci 99.88
TIGR01975389 isoAsp_dipep isoaspartyl dipeptidase IadA. The L-i 99.87
PRK06886329 hypothetical protein; Validated 99.86
PRK09358340 adenosine deaminase; Provisional 99.86
PRK15446383 phosphonate metabolism protein PhnM; Provisional 99.85
PLN02795 505 allantoinase 99.85
PRK09237380 dihydroorotase; Provisional 99.84
TIGR03178 443 allantoinase allantoinase. This enzyme carries out 99.83
cd01320325 ADA Adenosine deaminase (ADA) is a monomeric zinc 99.83
TIGR01792 567 urease_alph urease, alpha subunit. This model desc 99.82
PRK13404 477 dihydropyrimidinase; Provisional 99.82
COG3964386 Predicted amidohydrolase [General function predict 99.82
PRK06189 451 allantoinase; Provisional 99.81
PRK07627 425 dihydroorotase; Provisional 99.81
cd01315 447 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinas 99.81
KOG2584 522 consensus Dihydroorotase and related enzymes [Nucl 99.81
TIGR01430324 aden_deam adenosine deaminase. This family include 99.81
PRK07575 438 dihydroorotase; Provisional 99.81
PRK09236 444 dihydroorotase; Reviewed 99.8
TIGR02318376 phosphono_phnM phosphonate metabolism protein PhnM 99.8
cd01292275 metallo-dependent_hydrolases Superfamily of metall 99.8
PRK07369418 dihydroorotase; Provisional 99.78
PRK13309 572 ureC urease subunit alpha; Reviewed 99.78
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hy 99.78
PRK02382 443 dihydroorotase; Provisional 99.77
cd01307338 Met_dep_hydrolase_B Metallo-dependent hydrolases, 99.76
PRK13207 568 ureC urease subunit alpha; Reviewed 99.75
cd01309359 Met_dep_hydrolase_C Metallo-dependent hydrolases, 99.75
PRK09059 429 dihydroorotase; Validated 99.73
PRK09061 509 D-glutamate deacylase; Validated 99.73
COG0044 430 PyrC Dihydroorotase and related cyclic amidohydrol 99.73
PRK13206 573 ureC urease subunit alpha; Reviewed 99.73
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, 99.72
PLN02303 837 urease 99.72
TIGR01178 552 ade adenine deaminase. The family described by thi 99.71
PRK13308 569 ureC urease subunit alpha; Reviewed 99.71
PRK09060 444 dihydroorotase; Validated 99.69
PRK08044 449 allantoinase; Provisional 99.69
cd00375 567 Urease_alpha Urease alpha-subunit; Urease is a nic 99.68
TIGR00857 411 pyrC_multi dihydroorotase, multifunctional complex 99.67
PRK08417386 dihydroorotase; Provisional 99.66
PF01979333 Amidohydro_1: Amidohydrolase family; InterPro: IPR 99.66
PRK13985 568 ureB urease subunit beta; Provisional 99.65
TIGR00221380 nagA N-acetylglucosamine-6-phosphate deacetylase. 99.64
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. 99.58
PRK11170382 nagA N-acetylglucosamine-6-phosphate deacetylase; 99.56
PF1359468 Amidohydro_5: Amidohydrolase; PDB: 4F0R_A 4F0S_A 1 99.56
cd01317374 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; 99.56
COG1820380 NagA N-acetylglucosamine-6-phosphate deacetylase [ 99.54
PRK10027 588 cryptic adenine deaminase; Provisional 99.54
cd00443305 ADA_AMPD Adenosine/AMP deaminase. Adenosine deamin 99.51
COG1001 584 AdeC Adenine deaminase [Nucleotide transport and m 99.5
TIGR03121 556 one_C_dehyd_A formylmethanofuran dehydrogenase sub 99.43
PRK01211 409 dihydroorotase; Provisional 99.43
PRK04250 398 dihydroorotase; Provisional 99.4
PTZ00124362 adenosine deaminase; Provisional 99.34
PRK00369 392 pyrC dihydroorotase; Provisional 99.34
cd01304 541 FMDH_A Formylmethanofuran dehydrogenase (FMDH) sub 99.33
COG3454377 Metal-dependent hydrolase involved in phosphonate 99.31
cd01321345 ADGF Adenosine deaminase-related growth factors (A 99.3
cd01295 422 AdeC Adenine deaminase (AdeC) directly deaminates 99.28
PF07969404 Amidohydro_3: Amidohydrolase family; InterPro: IPR 99.27
COG1816345 Add Adenosine deaminase [Nucleotide transport and 99.19
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, inc 99.17
COG3653 579 N-acyl-D-aspartate/D-glutamate deacylase [Secondar 99.15
PF00962331 A_deaminase: Adenosine/AMP deaminase immunodeficie 99.14
COG0804 568 UreC Urea amidohydrolase (urease) alpha subunit [A 99.13
COG1229 575 FwdA Formylmethanofuran dehydrogenase subunit A [E 99.07
cd01306325 PhnM PhnM is believed to be a subunit of the membr 99.06
cd01318361 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; 99.05
cd00530293 PTE Phosphotriesterase (PTE) catalyzes the hydroly 99.03
KOG3892407 consensus N-acetyl-glucosamine-6-phosphate deacety 98.97
TIGR01431479 adm_rel adenosine deaminase-related growth factor. 98.86
KOG1097399 consensus Adenine deaminase/adenosine deaminase [N 98.72
PRK09875292 putative hydrolase; Provisional 98.72
PF13147304 Amidohydro_4: Amidohydrolase; PDB: 3SFW_B 2FTW_A 2 98.66
cd01294335 DHOase Dihydroorotase (DHOase) catalyzes the rever 98.57
TIGR00010252 hydrolase, TatD family. Several genomes have multi 98.56
cd01310251 TatD_DNAse TatD like proteins; E.coli TatD is a cy 98.53
PRK11449258 putative deoxyribonuclease YjjV; Provisional 98.48
PF02126308 PTE: Phosphotriesterase family; InterPro: IPR00155 98.38
cd01316344 CAD_DHOase The eukaryotic CAD protein is a trifunc 98.34
PRK10812265 putative DNAse; Provisional 98.33
COG0084256 TatD Mg-dependent DNase [DNA replication, recombin 98.19
PRK10425258 DNase TatD; Provisional 98.15
COG1735316 Php Predicted metal-dependent hydrolase with the T 98.04
cd01319496 AMPD AMP deaminase (AMPD) catalyzes the hydrolytic 97.92
PF01026255 TatD_DNase: TatD related DNase The Pfam entry find 97.89
TIGR01429611 AMP_deaminase AMP deaminase. This model describes 97.86
PLN03055602 AMP deaminase; Provisional 97.8
COG1099254 Predicted metal-dependent hydrolases with the TIM- 97.68
PLN02768835 AMP deaminase 97.62
PTZ00310 1453 AMP deaminase; Provisional 97.46
PLN02599364 dihydroorotase 97.35
PRK05451345 dihydroorotase; Provisional 97.31
cd01311263 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) 97.16
TIGR00856341 pyrC_dimer dihydroorotase, homodimeric type. This 97.08
PTZ00310 1453 AMP deaminase; Provisional 96.87
PF00449121 Urease_alpha: Urease alpha-subunit, N-terminal dom 96.22
PF12890142 DHOase: Dihydro-orotase-like; InterPro: IPR024403 93.41
COG1387237 HIS2 Histidinol phosphatase and related hydrolases 92.36
PRK08609570 hypothetical protein; Provisional 89.78
KOG3020296 consensus TatD-related DNase [Replication, recombi 87.74
COG0418344 PyrC Dihydroorotase [Nucleotide transport and meta 86.98
PF04909273 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 86.06
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 84.24
PRK07945335 hypothetical protein; Provisional 83.13
cd01301309 rDP_like renal dipeptidase (rDP), best studied in 82.85
COG2159293 Predicted metal-dependent hydrolase of the TIM-bar 82.44
PRK07328269 histidinol-phosphatase; Provisional 82.43
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 80.42
>PRK15493 5-methylthioadenosine/S-adenosylhomocysteine deaminase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-48  Score=363.90  Aligned_cols=312  Identities=29%  Similarity=0.428  Sum_probs=271.7

Q ss_pred             eEEEEcCEEEecCCCCceeeeeeEEEeCCEEEEeccChhhhhhhcCCCCeEEecCCCEEeecccccccCCcccccccccC
Q 019100           20 TMILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIAD   99 (346)
Q Consensus        20 ~~li~n~~i~~~d~~~~~~~~~~v~V~~g~I~~v~~~~~~~~~~~~~~~~viD~~g~~v~PGfID~H~H~~~~~~~g~~~   99 (346)
                      +++|+|+.|++++++.+++++++|+|+||+|++|++.....   ..+++++||++|++|+|||||+|+|+.++.+||...
T Consensus         2 ~~li~~~~v~t~~~~~~~~~~g~V~i~~g~I~~vg~~~~~~---~~~~~~viD~~g~~i~PGlVn~H~H~~~~~~rg~~~   78 (435)
T PRK15493          2 KTTYVNATIVTMNEQNEVIENGYIIVENDQIIDVNSGEFAS---DFEVDEVIDMKGKWVLPGLVNTHTHVVMSLLRGIGD   78 (435)
T ss_pred             eEEEEccEEEEeCCCCcEecCcEEEEECCEEEEEcCccccc---cCCCCeEEeCCCCEEccceeecccCccchhhhccCC
Confidence            47999999999887778889999999999999999853221   123468999999999999999999999999999988


Q ss_pred             CCChhHhhhhhccccccCCCchHHHHHHHHHHHHHHhcCceEeeecCc---CCHHHHHHHHHHhCCeEEEecccccCCCC
Q 019100          100 DVDLMTWLHDRIWPYESNMTEEDSYISTLLCGIELIHSGVTCFAEAGG---QHVSEMAKAVELLGLRACLVQSTMDCGEG  176 (346)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~GvTt~~d~~~---~~~~~~~~~~~~~g~~~~~~~~~~~~g~~  176 (346)
                      +.++.+|+...+|+....+++++.+...+.++.+++++|+||+.|+..   ...+...+.+.+.|+|.++++..++.+. 
T Consensus        79 ~~~l~~wl~~~~~~~~~~~~~e~~~~~a~~~~~e~l~~G~Ttv~d~~~~~~~~~~~~~~a~~~~GiR~~~~~~~~~~~~-  157 (435)
T PRK15493         79 DMLLQPWLETRIWPLESQFTPELAVASTELGLLEMVKSGTTSFSDMFNPIGVDQDAIMETVSRSGMRAAVSRTLFSFGT-  157 (435)
T ss_pred             CCCHHHHHHhchhhchhcCCHHHHHHHHHHHHHHHHhCCccEEEccccccccCHHHHHHHHHHcCCcEEEeeeecCCCC-
Confidence            888899998888998888899999999999999999999999999752   2345667888899999999877765431 


Q ss_pred             CCcccccCChHHHHHHHHHHHHHHcCCCCCCeEEEEeecccccCCHHHHHHHHHHHHHcCCeEEEEecCChhhHHHHHHh
Q 019100          177 LPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMDT  256 (346)
Q Consensus       177 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~a~~~g~~v~~H~~~~~~~~~~~~~~  256 (346)
                       +.     ...+.+++..++++++... .+++++.++|+.+++++++.+++++++|+++|+++++|+.|+..+.+.+.+.
T Consensus       158 -~~-----~~~~~~~~~~~~~~~~~~~-~~~i~~~~~~~~~~t~s~e~l~~~~~~A~~~g~~v~~H~~e~~~e~~~~~~~  230 (435)
T PRK15493        158 -KE-----DEKKAIEEAEKYVKRYYNE-SGMLTTMVAPHSPYTCSTELLEECARIAVENQTMVHIHLSETEREVRDIEAQ  230 (435)
T ss_pred             -Cc-----cHHHHHHHHHHHHHHhcCC-CCCeEEEEeCCCCCcCCHHHHHHHHHHHHHcCCcEEEEeCCCHHHHHHHHHH
Confidence             11     2345566677777776542 4789999999999999999999999999999999999999999888888888


Q ss_pred             cCCCCCHHHHHHHcCCCCCCeeEEEeccCChhhHHHHHhcCCeEEEChhhhccc-cccccHHHHHHcCCcEEEcCCCCCC
Q 019100          257 RKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRM-LGFAPIKEMLHADICVSLGTDGAPS  335 (346)
Q Consensus       257 ~g~~~~~~~~l~~~g~l~~~~~~~H~~~~~~~~i~~l~~~g~~v~~~p~~~~~l-~~~~~~~~~~~~Gv~v~~GTD~~~~  335 (346)
                      +|..  +++++++.|+++++++++||++++++|++++++.|+.+++||.+|.++ .+.+|+++++++|+++++|||+.++
T Consensus       231 ~g~~--~~~~l~~~Gll~~~~~~~H~~~l~~~d~~~la~~g~~v~~~P~sn~~l~~g~~p~~~~~~~Gv~v~lGtD~~~~  308 (435)
T PRK15493        231 YGKR--PVEYAASCGLFKRPTVIAHGVVLNDNERAFLAEHDVRVAHNPNSNLKLGSGIANVKAMLEAGIKVGIATDSVAS  308 (435)
T ss_pred             hCCC--HHHHHHHcCCCCCCcEEEEeecCCHHHHHHHHHcCCeEEEChHHHHHHhcCcccHHHHHHCCCeEEEccCcccc
Confidence            8865  899999999999999999999999999999999999999999999888 8899999999999999999999888


Q ss_pred             CCCCCCCCC
Q 019100          336 NNRMSIGPF  344 (346)
Q Consensus       336 ~~~~~~~~~  344 (346)
                      +++.||+++
T Consensus       309 ~~~~d~~~~  317 (435)
T PRK15493        309 NNNLDMFEE  317 (435)
T ss_pred             CCCcCHHHH
Confidence            888999875



>PRK06687 chlorohydrolase; Validated Back     alignment and domain information
>TIGR03314 Se_ssnA putative selenium metabolism protein SsnA Back     alignment and domain information
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>PRK12393 amidohydrolase; Provisional Back     alignment and domain information
>PRK07228 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK09045 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>PRK06038 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd01303 GDEase Guanine deaminase (GDEase) Back     alignment and domain information
>PRK06380 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK08418 chlorohydrolase; Provisional Back     alignment and domain information
>PRK08393 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK09228 guanine deaminase; Provisional Back     alignment and domain information
>COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02967 guan_deamin guanine deaminase Back     alignment and domain information
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>PRK08204 hypothetical protein; Provisional Back     alignment and domain information
>PRK06151 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>TIGR02022 hutF formiminoglutamate deiminase Back     alignment and domain information
>PRK09229 N-formimino-L-glutamate deiminase; Validated Back     alignment and domain information
>PRK07213 chlorohydrolase; Provisional Back     alignment and domain information
>KOG3968 consensus Atrazine chlorohydrolase/guanine deaminase [Nucleotide transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09230 cytosine deaminase; Provisional Back     alignment and domain information
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases Back     alignment and domain information
>PRK09356 imidazolonepropionase; Validated Back     alignment and domain information
>PRK14085 imidazolonepropionase; Provisional Back     alignment and domain information
>PRK07572 cytosine deaminase; Validated Back     alignment and domain information
>TIGR01224 hutI imidazolonepropionase Back     alignment and domain information
>cd01305 archeal_chlorohydrolases Predicted chlorohydrolases Back     alignment and domain information
>PRK05985 cytosine deaminase; Provisional Back     alignment and domain information
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK06846 putative deaminase; Validated Back     alignment and domain information
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>PLN02942 dihydropyrimidinase Back     alignment and domain information
>PRK07583 cytosine deaminase-like protein; Validated Back     alignment and domain information
>TIGR02033 D-hydantoinase D-hydantoinase Back     alignment and domain information
>PRK12394 putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>PRK08323 phenylhydantoinase; Validated Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10657 isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>PRK09357 pyrC dihydroorotase; Validated Back     alignment and domain information
>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics Back     alignment and domain information
>TIGR01975 isoAsp_dipep isoaspartyl dipeptidase IadA Back     alignment and domain information
>PRK06886 hypothetical protein; Validated Back     alignment and domain information
>PRK09358 adenosine deaminase; Provisional Back     alignment and domain information
>PRK15446 phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>PLN02795 allantoinase Back     alignment and domain information
>PRK09237 dihydroorotase; Provisional Back     alignment and domain information
>TIGR03178 allantoinase allantoinase Back     alignment and domain information
>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively Back     alignment and domain information
>TIGR01792 urease_alph urease, alpha subunit Back     alignment and domain information
>PRK13404 dihydropyrimidinase; Provisional Back     alignment and domain information
>COG3964 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>PRK06189 allantoinase; Provisional Back     alignment and domain information
>PRK07627 dihydroorotase; Provisional Back     alignment and domain information
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>KOG2584 consensus Dihydroorotase and related enzymes [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01430 aden_deam adenosine deaminase Back     alignment and domain information
>PRK07575 dihydroorotase; Provisional Back     alignment and domain information
>PRK09236 dihydroorotase; Reviewed Back     alignment and domain information
>TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM Back     alignment and domain information
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK07369 dihydroorotase; Provisional Back     alignment and domain information
>PRK13309 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>PRK02382 dihydroorotase; Provisional Back     alignment and domain information
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK13207 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK09059 dihydroorotase; Validated Back     alignment and domain information
>PRK09061 D-glutamate deacylase; Validated Back     alignment and domain information
>COG0044 PyrC Dihydroorotase and related cyclic amidohydrolases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13206 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>PLN02303 urease Back     alignment and domain information
>TIGR01178 ade adenine deaminase Back     alignment and domain information
>PRK13308 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PRK09060 dihydroorotase; Validated Back     alignment and domain information
>PRK08044 allantoinase; Provisional Back     alignment and domain information
>cd00375 Urease_alpha Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide Back     alignment and domain information
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type Back     alignment and domain information
>PRK08417 dihydroorotase; Provisional Back     alignment and domain information
>PF01979 Amidohydro_1: Amidohydrolase family; InterPro: IPR006680 This group of enzymes represents a large metal dependent hydrolase superfamily [] Back     alignment and domain information
>PRK13985 ureB urease subunit beta; Provisional Back     alignment and domain information
>TIGR00221 nagA N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional Back     alignment and domain information
>PF13594 Amidohydro_5: Amidohydrolase; PDB: 4F0R_A 4F0S_A 1NFG_C 2FVM_A 2FVK_A 2FTY_D 1YBQ_B 1POJ_B 1ONW_A 2AQO_B Back     alignment and domain information
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>COG1820 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10027 cryptic adenine deaminase; Provisional Back     alignment and domain information
>cd00443 ADA_AMPD Adenosine/AMP deaminase Back     alignment and domain information
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03121 one_C_dehyd_A formylmethanofuran dehydrogenase subunit A Back     alignment and domain information
>PRK01211 dihydroorotase; Provisional Back     alignment and domain information
>PRK04250 dihydroorotase; Provisional Back     alignment and domain information
>PTZ00124 adenosine deaminase; Provisional Back     alignment and domain information
>PRK00369 pyrC dihydroorotase; Provisional Back     alignment and domain information
>cd01304 FMDH_A Formylmethanofuran dehydrogenase (FMDH) subunit A; Methanogenic bacteria and archea derive the energy for autotrophic growth from methanogenesis, the reduction of CO2 with molecular hydrogen as the electron donor Back     alignment and domain information
>COG3454 Metal-dependent hydrolase involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01321 ADGF Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>PF07969 Amidohydro_3: Amidohydrolase family; InterPro: IPR013108 Amidohydrolases are a diverse superfamily of enzymes which catalyse the hydrolysis of amide or amine bonds in a large number of different substrates including urea, cytosine, AMP, formylmethanofuran, etc [, ] Back     alignment and domain information
>COG1816 Add Adenosine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>COG3653 N-acyl-D-aspartate/D-glutamate deacylase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00962 A_deaminase: Adenosine/AMP deaminase immunodeficiency disease (SCID); InterPro: IPR001365 Adenosine deaminase (3 Back     alignment and domain information
>COG0804 UreC Urea amidohydrolase (urease) alpha subunit [Amino acid transport and metabolism] Back     alignment and domain information
>COG1229 FwdA Formylmethanofuran dehydrogenase subunit A [Energy production and conversion] Back     alignment and domain information
>cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex Back     alignment and domain information
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon Back     alignment and domain information
>KOG3892 consensus N-acetyl-glucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01431 adm_rel adenosine deaminase-related growth factor Back     alignment and domain information
>KOG1097 consensus Adenine deaminase/adenosine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>PF13147 Amidohydro_4: Amidohydrolase; PDB: 3SFW_B 2FTW_A 2PUZ_B 2GOK_B 3HM7_E 3D6N_A 1XRT_A 1XRF_A 1YNY_B 1K1D_F Back     alignment and domain information
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>TIGR00010 hydrolase, TatD family Back     alignment and domain information
>cd01310 TatD_DNAse TatD like proteins; E Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>PF02126 PTE: Phosphotriesterase family; InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3 Back     alignment and domain information
>cd01316 CAD_DHOase The eukaryotic CAD protein is a trifunctional enzyme of carbamoylphosphate synthetase-aspartate transcarbamoylase-dihydroorotase, which catalyzes the first three steps of de novo pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK10812 putative DNAse; Provisional Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd01319 AMPD AMP deaminase (AMPD) catalyzes the hydrolytic deamination of adensosine monophosphate (AMP) at position 6 of the adenine nucleotide ring Back     alignment and domain information
>PF01026 TatD_DNase: TatD related DNase The Pfam entry finds members not in the Prosite definition Back     alignment and domain information
>TIGR01429 AMP_deaminase AMP deaminase Back     alignment and domain information
>PLN03055 AMP deaminase; Provisional Back     alignment and domain information
>COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PLN02768 AMP deaminase Back     alignment and domain information
>PTZ00310 AMP deaminase; Provisional Back     alignment and domain information
>PLN02599 dihydroorotase Back     alignment and domain information
>PRK05451 dihydroorotase; Provisional Back     alignment and domain information
>cd01311 PDC_hydrolase 2-pyrone-4,6-dicarboxylic acid (PDC) hydrolase hydrolyzes PDC to yield 4-oxalomesaconic acid (OMA) or its tautomer, 4-carboxy-2-hydroxymuconic acid (CHM) Back     alignment and domain information
>TIGR00856 pyrC_dimer dihydroorotase, homodimeric type Back     alignment and domain information
>PTZ00310 AMP deaminase; Provisional Back     alignment and domain information
>PF00449 Urease_alpha: Urease alpha-subunit, N-terminal domain; InterPro: IPR011612 Urease (urea amidohydrolase, 3 Back     alignment and domain information
>PF12890 DHOase: Dihydro-orotase-like; InterPro: IPR024403 This entry represents a small family of dihydro-orotase-like proteins from bacteria Back     alignment and domain information
>COG1387 HIS2 Histidinol phosphatase and related hydrolases of the PHP family [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>KOG3020 consensus TatD-related DNase [Replication, recombination and repair] Back     alignment and domain information
>COG0418 PyrC Dihydroorotase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF04909 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 These proteins are related to the metal-dependent hydrolase superfamily [] Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>PRK07945 hypothetical protein; Provisional Back     alignment and domain information
>cd01301 rDP_like renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipeptidase, is a membrane-bound glycoprotein hydrolyzing dipeptides and is involved in hydrolytic metabolism of penem and carbapenem beta-lactam antibiotics Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK07328 histidinol-phosphatase; Provisional Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
3hpa_A 479 Crystal Structure Of An Amidohydrolase Gi:44264246 7e-37
4dyk_A 451 Crystal Structure Of An Adenosine Deaminase From Ps 2e-29
3lnp_A 468 Crystal Structure Of Amidohydrolase Family Protein 3e-29
4dzh_A 472 Crystal Structure Of An Adenosine Deaminase From Xa 4e-25
1p1m_A 406 Structure Of Thermotoga Maritima Amidohydrolase Tm0 7e-25
1j6p_A 418 Crystal Structure Of Metal-Dependent Hydrolase Of C 5e-23
2paj_A 492 Crystal Structure Of An Amidohydrolase From An Envi 1e-22
4f0r_A 447 Crystal Structure Of An Adenosine Deaminase Homolog 9e-22
2uz9_A 476 Human Guanine Deaminase (Guad) In Complex With Zinc 1e-15
2i9u_A 439 Crystal Structure Of Guanine Deaminase From C. Acet 1e-15
3ls9_A 456 Crystal Structure Of Atrazine Chlorohydrolase Trzn 1e-14
3lsb_A 456 Crystal Structure Of The Mutant E241q Of Atrazine C 3e-14
3e0l_A 455 Computationally Designed Ammelide Deaminase Length 1e-13
2ood_A 475 Crystal Structure Of Guanine Deaminase From Bradyrh 1e-08
3v7p_A 427 Crystal Structure Of Amidohydrolase Nis_0429 (Targe 1e-06
>pdb|3HPA|A Chain A, Crystal Structure Of An Amidohydrolase Gi:44264246 From An Evironmental Sample Of Sargasso Sea Length = 479 Back     alignment and structure

Iteration: 1

Score = 150 bits (380), Expect = 7e-37, Method: Compositional matrix adjust. Identities = 98/333 (29%), Positives = 171/333 (51%), Gaps = 27/333 (8%) Query: 21 MILHNAVIVTMDKESRVFRNGGVFVVQDRIKAIGQSADILQQFSQMADQIIDLQSQILLP 80 ++ H V+VTMD R R+ G+++ +RI A+G SA++ + AD+++DL+ +++P Sbjct: 32 LVKHADVLVTMDDTRRELRDAGLYIEDNRIVAVGPSAEL----PETADEVLDLRGHLVIP 87 Query: 81 GFVNTHVHTSQQLAKGI--ADDVDLMTWLHD--RIWPYESNMTEEDSYISTLLCGIELIH 136 G VNTH H Q L + + A + +L WL + +IW +++T E +STL EL+ Sbjct: 88 GLVNTHHHMYQSLTRAVPAAQNAELFGWLTNLYKIW---AHLTPEMIEVSTLTAMAELLQ 144 Query: 137 SGVTCFAE-----AGGQHVSEMAKAVELLGLRACLVQSTMDCGE---GLPASWAVRTTDD 188 SG T ++ G + + A + +G+R + M G+ GLP V D Sbjct: 145 SGCTTSSDHLYIYPNGSRLDDSIGAAQRIGMRFHASRGAMSVGQRDGGLPPDSVVEREPD 204 Query: 189 CIQSQKELYAKHHHAADGR---IRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAE 245 ++ + L +H +GR +R+ + + L+ + +ARE+ +H H+AE Sbjct: 205 ILRDTQRLIETYHD--EGRYAMLRVVVAPCSPFSVSRDLMRDAAVLAREYGVSLHTHLAE 262 Query: 246 IPYENQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPA 305 N + K + + + ++ +++ AH V ++ IGL +R G V+HCP Sbjct: 263 --NVNDIAYSREKFGMTPAEYAEDLGWVGHDVWHAHCVQLDDAGIGLFARTGTGVAHCPC 320 Query: 306 SAMRML-GFAPIKEMLHADICVSLGTDGAPSNN 337 S MR+ G AP+K+M A + V LG DG+ SN+ Sbjct: 321 SNMRLASGIAPVKKMRLAGVPVGLGVDGSASND 353
>pdb|4DYK|A Chain A, Crystal Structure Of An Adenosine Deaminase From Pseudomonas Aeruginosa Pao1 (Target Nysgrc-200449) With Bound Zn Length = 451 Back     alignment and structure
>pdb|3LNP|A Chain A, Crystal Structure Of Amidohydrolase Family Protein Olei01672_1_465 From Oleispira Antarctica Length = 468 Back     alignment and structure
>pdb|4DZH|A Chain A, Crystal Structure Of An Adenosine Deaminase From Xanthomonas Campestris (Target Nysgrc-200456) With Bound Zn Length = 472 Back     alignment and structure
>pdb|1P1M|A Chain A, Structure Of Thermotoga Maritima Amidohydrolase Tm0936 Bound To Ni And Methionine Length = 406 Back     alignment and structure
>pdb|1J6P|A Chain A, Crystal Structure Of Metal-Dependent Hydrolase Of CytosinedemaniaseCHLOROHYDROLASE FAMILY (TM0936) FROM THERMOTOGA Maritima At 1.9 A Resolution Length = 418 Back     alignment and structure
>pdb|2PAJ|A Chain A, Crystal Structure Of An Amidohydrolase From An Environmental Sample Of Sargasso Sea Length = 492 Back     alignment and structure
>pdb|4F0R|A Chain A, Crystal Structure Of An Adenosine Deaminase Homolog From Chromobacterium Violaceum (Target Nysgrc-019589) Bound Zn And 5'- Methylthioadenosine (Unproductive Complex) Length = 447 Back     alignment and structure
>pdb|2UZ9|A Chain A, Human Guanine Deaminase (Guad) In Complex With Zinc And Its Product Xanthine. Length = 476 Back     alignment and structure
>pdb|2I9U|A Chain A, Crystal Structure Of Guanine Deaminase From C. Acetobutylicum With Bound Guanine In The Active Site Length = 439 Back     alignment and structure
>pdb|3LS9|A Chain A, Crystal Structure Of Atrazine Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1 Complexed With Zinc Length = 456 Back     alignment and structure
>pdb|3LSB|A Chain A, Crystal Structure Of The Mutant E241q Of Atrazine Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1 Complexed With Zinc And Ametrin Length = 456 Back     alignment and structure
>pdb|3E0L|A Chain A, Computationally Designed Ammelide Deaminase Length = 455 Back     alignment and structure
>pdb|2OOD|A Chain A, Crystal Structure Of Guanine Deaminase From Bradyrhizobium Japonicum Length = 475 Back     alignment and structure
>pdb|3V7P|A Chain A, Crystal Structure Of Amidohydrolase Nis_0429 (Target Efi-500396) From Nitratiruptor Sp. Sb155-2 Length = 427 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
3lnp_A 468 Amidohydrolase family protein OLEI01672_1_465; TIM 1e-116
3h4u_A 479 Amidohydrolase; signature of Zn ligands, structura 1e-114
4dzh_A 472 Amidohydrolase; adenosine deaminase, nysgrc, struc 1e-113
4dyk_A 451 Amidohydrolase; adenosine deaminase, nysgrc, struc 1e-112
4f0r_A 447 5-methylthioadenosine/S-adenosylhomocysteine DEAM; 1e-111
1p1m_A 406 Hypothetical protein TM0936; putative metal depend 1e-111
3ls9_A 456 Triazine hydrolase; atrazine chlorohydrolase TRZN; 1e-109
2paj_A 492 Putative cytosine/guanine deaminase; NYSGXRC, PSI- 1e-106
3v7p_A 427 Amidohydrolase family protein; iron binding site, 2e-96
2imr_A420 Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, 9e-84
2i9u_A 439 Cytosine/guanine deaminase related protein; protei 2e-72
2ood_A 475 BLR3880 protein; PSI-II, PSI-2, guanine deaminase, 2e-71
4aql_A 476 Guanine deaminase; hydrolase, purine metabolism; H 2e-69
3mdu_A 453 N-formimino-L-glutamate iminohydrolase; amonohydra 3e-68
4f0l_A 458 Amidohydrolase; ssgcid, structural genomics, seatt 1e-65
2bb0_A421 Imidazolonepropionase; TIM barrel, hydrolase; 2.00 1e-50
2puz_A419 Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino 2e-43
1ra0_A430 Cytosine deaminase; alpha-beta barrel, hexamer, co 8e-28
2q09_A416 Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio 4e-27
2qt3_A403 N-isopropylammelide isopropyl amidohydrolase; N-is 2e-25
2ogj_A 417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 1e-15
2vun_A386 Enamidase; nicotinate degradation, binuclear metal 3e-13
3icj_A 534 Uncharacterized metal-dependent hydrolase; structu 5e-11
2vhl_A396 N-acetylglucosamine-6-phosphate deacetylase; N- ac 1e-09
2p9b_A 458 Possible prolidase; protein structure initiative I 5e-09
3ooq_A396 Amidohydrolase; structural genomics, protein struc 6e-09
3ggm_A81 Uncharacterized protein BT9727_2919; bacillus cere 6e-09
3be7_A408 Zn-dependent arginine carboxypeptidase; unknown so 7e-09
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 2e-08
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 5e-08
2qs8_A418 XAA-Pro dipeptidase; amidohydrolase, TIM barrel, p 9e-08
3feq_A423 Putative amidohydrolase; unknown source, sargasso 2e-07
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 2e-07
2gwn_A 452 Dihydroorotase; zinc-binding prote structural geno 2e-07
3nqb_A 608 Adenine deaminase 2; PSI-II, structural genomics, 2e-07
2r8c_A 426 Putative amidohydrolase; unknown source, sargasso 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
3hm7_A 448 Allantoinase; metallo-dependent hydrolase, protein 9e-07
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 1e-06
1xrt_A 467 Dihydroorotase, dhoase; amidohydrolase, metalloenz 1e-06
3mpg_A 428 Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus 7e-06
1gkr_A 458 Hydantoinase, non-ATP dependent L-selective hydant 8e-06
3e74_A 473 Allantoinase; (beta/alpha)8-barrel domain, small b 9e-06
3gri_A 424 Dihydroorotase, dhoase; hydrolase, IDP00795, metal 1e-05
1gkp_A 458 Hydantoinase; hydrolase, dihydropyrimidinase, cycl 1e-05
3dc8_A 490 Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K 1e-05
2fty_A 559 Dihydropyrimidinase; alpha/beta barrel, beta-sandw 2e-05
1onw_A390 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 2e-05
2ftw_A 521 Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba 2e-05
3sfw_A 461 Dihydropyrimidinase; hydrolase, zinc binding; HET: 3e-05
1rk6_A 496 D-aminoacylase; TIM barrel, beta barrel, insertion 5e-05
1nfg_A 457 D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2 5e-05
2z00_A 426 Dihydroorotase; zinc binding protein, hydrolase, m 6e-05
2vr2_A 541 Dihydropyrimidinase; hydantoinase, metal-binding, 6e-05
2vm8_A 501 Dihydropyrimidinase-related protein 2; neurogenesi 2e-04
>3lnp_A Amidohydrolase family protein OLEI01672_1_465; TIM barrel, beta-fold, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Oleispira antarctica} Length = 468 Back     alignment and structure
 Score =  344 bits (885), Expect = e-116
 Identities = 89/351 (25%), Positives = 158/351 (45%), Gaps = 27/351 (7%)

Query: 4   NSSGGGSSSGSLGSSSTMILHNAVIVTMD------KESRVFRNGGVFVVQDRIKAIGQSA 57
           + S          + + + +++  I+ ++        S +  +  + +    I AI   +
Sbjct: 8   SESNLAQRQSQPKAHADLRINSHWIIPIENTTDHNLVSNILIDHCLLIKDGIILAIEPQS 67

Query: 58  DILQQFSQMADQIIDLQSQILLPGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESN 117
                    A + +DL  Q+L+PG+VN H H +  L +G+ADD+ LMTWL + +WP E+ 
Sbjct: 68  SCQIP----ATETLDLGQQVLMPGWVNAHGHAAMSLFRGLADDLPLMTWLQEHVWPAEAQ 123

Query: 118 MT-EEDSYISTLLCGIELIHSGVTCFAEAGGQHVSEMAKAVELLGLRACLVQSTMDCGEG 176
              E      T L   E+I SG T FA+    +  +  +A    G+RA      +D    
Sbjct: 124 HVDEHFVKQGTELAIAEMIQSGTTTFADMYF-YPQQSGEAALAAGIRAVCFAPVLD---- 178

Query: 177 LPASWAVRTTDDCIQSQKEL---YAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAR 233
            P ++A +  D+ I+   E    +  H     G ++I FG       +D  L E   ++ 
Sbjct: 179 FPTNYA-QNADEYIRKAIECNDRFNNHPMNEQGLVQIGFGPHAPYTVSDEPLKEITMLSD 237

Query: 234 EFKTGIHMHVAEIPYENQVVMDTRKVDHG--TVTFLDKIEFLQNNLLSAHTVWVNHTEIG 291
           +    + +H+ E  +E    ++T            L  I FL   +   H   V+  +I 
Sbjct: 238 QLDMPVQIHLHETDFEVSESLET----FNKRPTQRLADIGFLNERVSCVHMTQVDDGDIK 293

Query: 292 LLSRAGVKVSHCPASAMRML-GFAPIKEMLHADICVSLGTDGAPSNNRMSI 341
           +L + G  + HCP S +++  GF PI ++  A+I +++GTDGA SNN + +
Sbjct: 294 ILQKTGASIIHCPESNLKLASGFCPIAKLSAANIPLAIGTDGAASNNDLDM 344


>4dzh_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO YORK structural genomics research consortium; 1.55A {Xanthomonas campestris PV} Length = 472 Back     alignment and structure
>4dyk_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO PSI-biology, NEW YORK structural genomics research consorti hydrolase; 2.00A {Pseudomonas aeruginosa} Length = 451 Back     alignment and structure
>4f0r_A 5-methylthioadenosine/S-adenosylhomocysteine DEAM; structural genomics, PSI-biology; HET: MSE MTA; 1.80A {Chromobacterium violaceum} PDB: 4f0s_A* Length = 447 Back     alignment and structure
>1p1m_A Hypothetical protein TM0936; putative metal dependent hydrolase, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: b.92.1.4 c.1.9.9 PDB: 2plm_A* 1j6p_A Length = 406 Back     alignment and structure
>3ls9_A Triazine hydrolase; atrazine chlorohydrolase TRZN; 1.40A {Arthrobacter aurescens} PDB: 3lsc_A* 3lsb_A* Length = 456 Back     alignment and structure
>2paj_A Putative cytosine/guanine deaminase; NYSGXRC, PSI-II, amidohydrolase, sargasso SEA, enviro sample, structural genomics; 2.70A {Unidentified} SCOP: b.92.1.4 c.1.9.9 Length = 492 Back     alignment and structure
>3v7p_A Amidohydrolase family protein; iron binding site, enzyme functio initiative, EFI; HET: TLA; 1.35A {Nitratiruptor SP} Length = 427 Back     alignment and structure
>2imr_A Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, structural genomics, protein structure initiative; 1.78A {Deinococcus radiodurans} SCOP: b.92.1.11 c.1.9.16 Length = 420 Back     alignment and structure
>2i9u_A Cytosine/guanine deaminase related protein; protein structure initiative II (PSI-II), amidohydrol guanine deaminase; HET: GUN; 2.05A {Clostridium acetobutylicum} SCOP: b.92.1.4 c.1.9.9 Length = 439 Back     alignment and structure
>2ood_A BLR3880 protein; PSI-II, PSI-2, guanine deaminase, guanine, structural genomics, protein structure initiative; HET: GUN; 2.62A {Bradyrhizobium japonicum} SCOP: b.92.1.4 c.1.9.9 Length = 475 Back     alignment and structure
>4aql_A Guanine deaminase; hydrolase, purine metabolism; HET: TXC; 1.99A {Homo sapiens} PDB: 2uz9_A* 3e0l_A Length = 476 Back     alignment and structure
>3mdu_A N-formimino-L-glutamate iminohydrolase; amonohydralase family, N-formimino-L-glutamate iminohydrolas guanidino-L-glutamate; HET: NGQ; 1.40A {Pseudomonas aeruginosa} PDB: 3mdw_A* Length = 453 Back     alignment and structure
>4f0l_A Amidohydrolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Brucella melitensis biovar abortus} Length = 458 Back     alignment and structure
>2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A Length = 421 Back     alignment and structure
>2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A Length = 419 Back     alignment and structure
>1ra0_A Cytosine deaminase; alpha-beta barrel, hexamer, conformation change, D314G mutant, hydrolase; 1.12A {Escherichia coli} SCOP: b.92.1.2 c.1.9.5 PDB: 1r9x_A 1ra5_A 1r9y_A 1r9z_A 1rak_A 3r0d_A* 3o7u_A* 3rn6_A* 1k6w_A 1k70_A 3g77_A Length = 430 Back     alignment and structure
>2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* Length = 416 Back     alignment and structure
>2qt3_A N-isopropylammelide isopropyl amidohydrolase; N-isopropylammelide isopropylaminohydrolase ATZC, structural genomics, NYSGXRC, target 9364B; 2.24A {Pseudomonas SP} Length = 403 Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Length = 417 Back     alignment and structure
>2vun_A Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} Length = 386 Back     alignment and structure
>3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structur initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* Length = 534 Back     alignment and structure
>2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} Length = 396 Back     alignment and structure
>2p9b_A Possible prolidase; protein structure initiative II, PSI-2, amidohydrolase, structural genomics; 1.70A {Bifidobacterium longum NCC2705} SCOP: b.92.1.10 c.1.9.17 Length = 458 Back     alignment and structure
>3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} Length = 396 Back     alignment and structure
>3ggm_A Uncharacterized protein BT9727_2919; bacillus cereus group., structural genomics, PSI-2, protein structure initiative; 2.00A {Bacillus thuringiensis serovarkonkukian} Length = 81 Back     alignment and structure
>3be7_A Zn-dependent arginine carboxypeptidase; unknown source, amidohydrolase, sargasso SEA, structural GEN protein structure initiative, PSI; HET: ARG; 2.30A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3dug_A* Length = 408 Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Length = 381 Back     alignment and structure
>2qs8_A XAA-Pro dipeptidase; amidohydrolase, TIM barrel, protein structure initiative, PSI-2, NYSGXRC, structural genomics; 2.33A {Alteromonas macleodii} SCOP: b.92.1.9 c.1.9.18 Length = 418 Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Length = 423 Back     alignment and structure
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Length = 382 Back     alignment and structure
>2gwn_A Dihydroorotase; zinc-binding prote structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; HET: KCX GOL; 1.85A {Porphyromonas gingivalis} Length = 452 Back     alignment and structure
>3nqb_A Adenine deaminase 2; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics, nysgxrc; 2.21A {Agrobacterium tumefaciens} PDB: 3t81_A 3t8l_A Length = 608 Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3mkv_A* Length = 426 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} Length = 448 Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Length = 376 Back     alignment and structure
>1xrt_A Dihydroorotase, dhoase; amidohydrolase, metalloenzyme, pyrimidine; 1.61A {Aquifex aeolicus} SCOP: b.92.1.3 c.1.9.6 PDB: 1xrf_A 3d6n_A* Length = 467 Back     alignment and structure
>3mpg_A Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus anthracis} Length = 428 Back     alignment and structure
>1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 Length = 458 Back     alignment and structure
>3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} Length = 473 Back     alignment and structure
>3gri_A Dihydroorotase, dhoase; hydrolase, IDP00795, metal-binding, pyrimidine biosynthesis, structural genomics; 2.00A {Staphylococcus aureus subsp} Length = 424 Back     alignment and structure
>1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* Length = 458 Back     alignment and structure
>3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} Length = 490 Back     alignment and structure
>2fty_A Dihydropyrimidinase; alpha/beta barrel, beta-sandwich, hydrolase; HET: KCX; 2.40A {Lachancea kluyveri} SCOP: b.92.1.3 c.1.9.6 PDB: 2fvk_A* 2fvm_A* Length = 559 Back     alignment and structure
>1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* Length = 390 Back     alignment and structure
>2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 Length = 521 Back     alignment and structure
>3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* Length = 461 Back     alignment and structure
>1rk6_A D-aminoacylase; TIM barrel, beta barrel, insertion, hydrolase; 1.43A {Alcaligenes faecalis} SCOP: b.92.1.6 b.92.1.6 c.1.9.11 PDB: 1rjp_A 1v51_A 1rjq_A 1rjr_A 1rk5_A 1v4y_A 1m7j_A Length = 496 Back     alignment and structure
>1nfg_A D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2.70A {Ralstonia pickettii} SCOP: b.92.1.3 c.1.9.6 Length = 457 Back     alignment and structure
>2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus} Length = 426 Back     alignment and structure
>2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} Length = 541 Back     alignment and structure
>2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A Length = 501 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
4aql_A 476 Guanine deaminase; hydrolase, purine metabolism; H 100.0
4dyk_A 451 Amidohydrolase; adenosine deaminase, nysgrc, struc 100.0
3lnp_A 468 Amidohydrolase family protein OLEI01672_1_465; TIM 100.0
4dzh_A 472 Amidohydrolase; adenosine deaminase, nysgrc, struc 100.0
3h4u_A 479 Amidohydrolase; signature of Zn ligands, structura 100.0
4f0r_A 447 5-methylthioadenosine/S-adenosylhomocysteine DEAM; 100.0
3ls9_A 456 Triazine hydrolase; atrazine chlorohydrolase TRZN; 100.0
3v7p_A 427 Amidohydrolase family protein; iron binding site, 100.0
2i9u_A 439 Cytosine/guanine deaminase related protein; protei 100.0
2paj_A 492 Putative cytosine/guanine deaminase; NYSGXRC, PSI- 100.0
3mdu_A 453 N-formimino-L-glutamate iminohydrolase; amonohydra 100.0
4f0l_A 458 Amidohydrolase; ssgcid, structural genomics, seatt 100.0
2ood_A 475 BLR3880 protein; PSI-II, PSI-2, guanine deaminase, 100.0
2imr_A420 Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, 100.0
1p1m_A 406 Hypothetical protein TM0936; putative metal depend 100.0
3hpa_A 479 Amidohydrolase; signature of Zn ligands, structura 100.0
1ra0_A430 Cytosine deaminase; alpha-beta barrel, hexamer, co 100.0
2qt3_A403 N-isopropylammelide isopropyl amidohydrolase; N-is 99.97
3feq_A423 Putative amidohydrolase; unknown source, sargasso 99.97
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 99.97
2r8c_A426 Putative amidohydrolase; unknown source, sargasso 99.97
2q09_A416 Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio 99.97
2bb0_A421 Imidazolonepropionase; TIM barrel, hydrolase; 2.00 99.97
2puz_A419 Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino 99.96
2qs8_A418 XAA-Pro dipeptidase; amidohydrolase, TIM barrel, p 99.96
3be7_A408 Zn-dependent arginine carboxypeptidase; unknown so 99.96
3icj_A534 Uncharacterized metal-dependent hydrolase; structu 99.94
2p9b_A458 Possible prolidase; protein structure initiative I 99.94
3ooq_A396 Amidohydrolase; structural genomics, protein struc 99.93
2fty_A 559 Dihydropyrimidinase; alpha/beta barrel, beta-sandw 99.91
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 99.89
2vun_A386 Enamidase; nicotinate degradation, binuclear metal 99.89
1xrt_A 467 Dihydroorotase, dhoase; amidohydrolase, metalloenz 99.89
1gkp_A 458 Hydantoinase; hydrolase, dihydropyrimidinase, cycl 99.89
2ics_A379 Adenine deaminase; TIM barrel, binuclear zinc, ade 99.88
3sfw_A 461 Dihydropyrimidinase; hydrolase, zinc binding; HET: 99.88
2ogj_A 417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 99.88
2z00_A 426 Dihydroorotase; zinc binding protein, hydrolase, m 99.88
1e9y_B 569 Urease subunit beta; hydrolase, dodecamer; HET: KC 99.88
1gkr_A 458 Hydantoinase, non-ATP dependent L-selective hydant 99.88
2vm8_A 501 Dihydropyrimidinase-related protein 2; neurogenesi 99.87
3e74_A 473 Allantoinase; (beta/alpha)8-barrel domain, small b 99.86
3gri_A 424 Dihydroorotase, dhoase; hydrolase, IDP00795, metal 99.86
3mpg_A 428 Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus 99.86
2gwn_A 452 Dihydroorotase; zinc-binding prote structural geno 99.86
3dc8_A 490 Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K 99.85
2vhl_A396 N-acetylglucosamine-6-phosphate deacetylase; N- ac 99.84
2ftw_A 521 Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba 99.84
4ubp_C 570 Protein (urease (chain C)); bacillus pasteurii, ni 99.84
4ac7_C 570 Urease subunit alpha; hydrolase, bacillus pasteuri 99.84
1nfg_A 457 D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2 99.84
3hm7_A 448 Allantoinase; metallo-dependent hydrolase, protein 99.83
2vr2_A 541 Dihydropyrimidinase; hydantoinase, metal-binding, 99.83
1rk6_A 496 D-aminoacylase; TIM barrel, beta barrel, insertion 99.82
1onw_A390 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 99.82
3nqb_A 608 Adenine deaminase 2; PSI-II, structural genomics, 99.8
2pgf_A371 Adenosine deaminase; metallo-dependent hydrolase, 99.79
3gip_A 480 N-acyl-D-glutamate deacylase; amidohydrolase famil 99.76
3mtw_A403 L-arginine carboxypeptidase CC2672; hydrolase; HET 99.76
3pao_A326 Adenosine deaminase; structural genomics, PSI-2, p 99.76
3rys_A343 Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2 99.75
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 99.72
3mkv_A 426 Putative amidohydrolase; sargasso SEA, structural 99.69
3ggm_A81 Uncharacterized protein BT9727_2919; bacillus cere 99.66
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 99.62
4gy7_A 840 Urease; JACK bean, hydrolase, ME binding, nickel; 99.6
3iar_A367 Adenosine deaminase; purine metabolism structural 99.58
4ep8_C 566 Urease subunit alpha; alpha-beta barrel, nickel me 99.4
4gxw_A380 Adenosine deaminase; amidohydrolase, COG1816, EFI, 99.28
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promis 99.11
3lgd_A508 Adenosine deaminase CECR1; TIM barrel, dimerizatio 99.07
3pnu_A359 Dihydroorotase; TIM barrel, zinc binding, hydrolas 99.06
2ob3_A330 Parathion hydrolase; metalloenzyme, TIM barrel, ne 99.05
2a3l_A701 AMP deaminase, AMPD; atampd, AT2G38280, adenosine 99.03
1bf6_A291 Phosphotriesterase homology protein; hypothetical 99.01
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, 98.72
3tn4_A360 Phosphotriesterase; lactonase, hydrolase; HET: KCX 98.69
2z26_A347 Dihydroorotase, dhoase; TIM barrel, hydrolase; HET 98.68
2y1h_A272 Putative deoxyribonuclease tatdn3; hydrolase; 2.50 98.68
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, z 98.59
3pnz_A330 Phosphotriesterase family protein; amidohydrolase 98.58
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protei 98.56
3gtx_A339 Organophosphorus hydrolase; mutant, amidohydrolase 98.47
3rcm_A287 TATD family hydrolase; HET: CIT; 2.05A {Pseudomona 98.47
3k2g_A364 Resiniferatoxin-binding, phosphotriesterase- relat 98.45
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seat 98.41
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW 98.32
3rhg_A365 Putative phophotriesterase; hydrolase, amidohydrol 98.2
1j6o_A268 TATD-related deoxyribonuclease; structural genomic 98.2
2xio_A301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19 98.12
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NE 98.11
3guw_A261 Uncharacterized protein AF_1765; alpha-beta protei 98.1
3gg7_A254 Uncharacterized metalloprotein; structural genomic 97.99
2ffi_A288 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; 97.66
4i6k_A294 Amidohydrolase family protein; enzyme function ini 97.44
2dvt_A327 Thermophilic reversible gamma-resorcylate decarbo; 97.24
3e2v_A401 3'-5'-exonuclease; structural genomics, hydrolase, 97.08
4do7_A303 Amidohydrolase 2; enzyme function initiative, EFI, 96.76
2f6k_A307 Metal-dependent hydrolase; metal dependent hydroly 96.75
4d9a_A303 2-pyrone-4,6-dicarbaxylate hydrolase; structural g 96.67
3cjp_A272 Predicted amidohydrolase, dihydroorotase family; s 96.6
3irs_A291 Uncharacterized protein BB4693; structural genomic 96.6
3ij6_A312 Uncharacterized metal-dependent hydrolase; structu 93.08
3qy7_A262 Tyrosine-protein phosphatase YWQE; TIM barrel, pol 91.71
2i5g_A325 Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, stru 86.03
2qpx_A376 Predicted metal-dependent hydrolase of the TIM-BA; 85.38
1itu_A369 Renal dipeptidase; glycoprotein, membrane-bound, z 81.88
>4aql_A Guanine deaminase; hydrolase, purine metabolism; HET: TXC; 1.99A {Homo sapiens} PDB: 2uz9_A* 3e0l_A Back     alignment and structure
Probab=100.00  E-value=2.7e-43  Score=332.17  Aligned_cols=324  Identities=21%  Similarity=0.318  Sum_probs=272.9

Q ss_pred             cceEEEEcCEEEecC-CCCceeeeeeEEEeC-CEEEEeccChhhh---hhhcCCCCeEEec-CCCEEeecccccccCCcc
Q 019100           18 SSTMILHNAVIVTMD-KESRVFRNGGVFVVQ-DRIKAIGQSADIL---QQFSQMADQIIDL-QSQILLPGFVNTHVHTSQ   91 (346)
Q Consensus        18 ~~~~li~n~~i~~~d-~~~~~~~~~~v~V~~-g~I~~v~~~~~~~---~~~~~~~~~viD~-~g~~v~PGfID~H~H~~~   91 (346)
                      +..++|+|..|.+.+ .+..++++++|+|++ |||++|++..+.+   ..+.....++||+ +|++|+|||||+|+|+.+
T Consensus        30 ~~~~~~~g~~i~~~~~~~~~~~~~~~v~I~~~g~I~~vg~~~~~~~~~~~~~~~~~~viD~~~g~~v~PG~ID~H~H~~~  109 (476)
T 4aql_A           30 PLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCFKPCEIRELSHHEFFMPGLVDTHIHASQ  109 (476)
T ss_dssp             -CCEEEEEEEEECCSSCSCEEEEEEEEEECTTSBEEEEEEGGGHHHHHHHTTCCGGGCEECCTTCEEEECEEEEEEEGGG
T ss_pred             CccEEEEccEEecCCCCceeEecCcEEEEecCCeEEEecCcchhhhhhhhccCCCceEEEcCCCCEEeCCeeccccchHH
Confidence            346899998888763 356678999999998 9999999875432   1112234689995 589999999999999999


Q ss_pred             cccccccCCCChhHhhhhhccccccCCCchHHHHHHHH-HHHHHHhcCceEeeecCcCCHHH---HHHHHHHhCCeEEEe
Q 019100           92 QLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLL-CGIELIHSGVTCFAEAGGQHVSE---MAKAVELLGLRACLV  167 (346)
Q Consensus        92 ~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~l~~GvTt~~d~~~~~~~~---~~~~~~~~g~~~~~~  167 (346)
                      +.+||...+.++.+|+...+|+....+++++.+..... .+.+++++||||+.++...+.+.   +.+.+.+.|+|..++
T Consensus       110 ~~~rg~~~d~~l~~wL~~~~~p~e~~~~~~~~~~~~~~~~~~e~l~~G~Tt~~~~~~~~~~~~~~~~~a~~~~G~r~~~~  189 (476)
T 4aql_A          110 YSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVG  189 (476)
T ss_dssp             GGGTTSCCCSCHHHHHHHTHHHHHHGGGSHHHHHHHHHHHHHHHHHTTEEEEEEECCSCHHHHHHHHHHHHHHTCEEEEE
T ss_pred             HHHHHHhcCCCHHHHHHHhhhhHHHhcCCHHHHHHHHHHHHHHHHHCCeeEEEEecccCchHHHHHHHHHHHhCCEEEEe
Confidence            99999999999999999999999888877765544443 44689999999999886555544   577888999999999


Q ss_pred             cccccCCCCCCcccccCChHHHHHHHHHHHHHHcCCCCCCeEEEEeecccccCCHHHHHHHHHHHHHcCCeEEEEecCCh
Q 019100          168 QSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIP  247 (346)
Q Consensus       168 ~~~~~~g~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~a~~~g~~v~~H~~~~~  247 (346)
                      +..++.+...+ . .....++.+++..++++++....+++++..++|+..+.++++.+++++++|+++|+++++|+.|+.
T Consensus       190 ~~~~d~~~~~p-~-~~~~~~~~l~~~~~~i~~~~~~~~~~v~~~l~p~~~~~~s~e~l~~~~~~A~~~g~~v~~H~~e~~  267 (476)
T 4aql_A          190 KVCMDLNDTFP-E-YKETTEESIKETERFVSEMLQKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENR  267 (476)
T ss_dssp             CEECSCCSSCT-T-SCCCHHHHHHHHHHHHHHHHHHTCSSEEECBEECCTTTSCHHHHHHHHHHHHHTTCCEEEEESCSH
T ss_pred             eccccCCCCCc-c-cccCHHHHHHHHHHHHHHHhcCCCCceEEEEeCCcCCcCCHHHHHHHHHHHHHcCCceEEEecCCH
Confidence            88887653222 2 334567888888899888876667889999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHhcCCCCCHHHHHHHcCCCCCCeeEEEeccCChhhHHHHHhcCCeEEEChhhhccc-cccccHHHHHHcCCcE
Q 019100          248 YENQVVMDTRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRM-LGFAPIKEMLHADICV  326 (346)
Q Consensus       248 ~~~~~~~~~~g~~~~~~~~l~~~g~l~~~~~~~H~~~~~~~~i~~l~~~g~~v~~~p~~~~~l-~~~~~~~~~~~~Gv~v  326 (346)
                      .+.+.+.+.++...++++++++.|+++++++++|++++++++++++++.|+.+++||.+|.++ .+..|+++++++|+++
T Consensus       268 ~e~~~~~~~~~~~~~~~~~~~~~g~l~~~~~~~H~~~l~~~~~~~l~~~g~~v~~~P~sn~~l~~g~~p~~~~~~~Gv~v  347 (476)
T 4aql_A          268 DEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSGFLNVLEVLKHEVKI  347 (476)
T ss_dssp             HHHHHHHHHCTTSSSHHHHHHTTTCCSTTEEEEECTTCCHHHHHHHHHHTCEEEECHHHHHHTTCCCCCHHHHHHTTCEE
T ss_pred             HHHHHHHHHhCCCCCHHHHHHHcCCCCCCEEEEeCCCCCHHHHHHHHHcCCEEEECchhhhhhCcchHHHHHHHHCCCcE
Confidence            999999988887556999999999999999999999999999999999999999999999888 8899999999999999


Q ss_pred             EEcCCCCCCCCCCCCCCC
Q 019100          327 SLGTDGAPSNNRMSIGPF  344 (346)
Q Consensus       327 ~~GTD~~~~~~~~~~~~~  344 (346)
                      ++|||+.+ +++.||+++
T Consensus       348 ~lGtD~~~-~~~~~~~~~  364 (476)
T 4aql_A          348 GLGTDVAG-GYSYSMLDA  364 (476)
T ss_dssp             EECCCTTT-SSCCCHHHH
T ss_pred             EEeCCCCC-CCCCCHHHH
Confidence            99999875 456787764



>4dyk_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO PSI-biology, NEW YORK structural genomics research consorti hydrolase; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3lnp_A Amidohydrolase family protein OLEI01672_1_465; TIM barrel, beta-fold, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Oleispira antarctica} Back     alignment and structure
>4dzh_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO YORK structural genomics research consortium; 1.55A {Xanthomonas campestris PV} Back     alignment and structure
>4f0r_A 5-methylthioadenosine/S-adenosylhomocysteine DEAM; structural genomics, PSI-biology; HET: MSE MTA; 1.80A {Chromobacterium violaceum} PDB: 4f0s_A* Back     alignment and structure
>3ls9_A Triazine hydrolase; atrazine chlorohydrolase TRZN; 1.40A {Arthrobacter aurescens} PDB: 3lsc_A* 3lsb_A* Back     alignment and structure
>3v7p_A Amidohydrolase family protein; iron binding site, enzyme functio initiative, EFI; HET: TLA; 1.35A {Nitratiruptor SP} Back     alignment and structure
>2i9u_A Cytosine/guanine deaminase related protein; protein structure initiative II (PSI-II), amidohydrol guanine deaminase; HET: GUN; 2.05A {Clostridium acetobutylicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>2paj_A Putative cytosine/guanine deaminase; NYSGXRC, PSI-II, amidohydrolase, sargasso SEA, enviro sample, structural genomics; 2.70A {Unidentified} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>3mdu_A N-formimino-L-glutamate iminohydrolase; amonohydralase family, N-formimino-L-glutamate iminohydrolas guanidino-L-glutamate; HET: NGQ; 1.40A {Pseudomonas aeruginosa} PDB: 3mdw_A* Back     alignment and structure
>4f0l_A Amidohydrolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>2ood_A BLR3880 protein; PSI-II, PSI-2, guanine deaminase, guanine, structural genomics, protein structure initiative; HET: GUN; 2.62A {Bradyrhizobium japonicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>2imr_A Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, structural genomics, protein structure initiative; 1.78A {Deinococcus radiodurans} SCOP: b.92.1.11 c.1.9.16 Back     alignment and structure
>1p1m_A Hypothetical protein TM0936; putative metal dependent hydrolase, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: b.92.1.4 c.1.9.9 PDB: 2plm_A* 1j6p_A Back     alignment and structure
>3hpa_A Amidohydrolase; signature of Zn ligands, structural genomics, NYSGXRC, target 9236E, PSI-2, protein structure initiative; 2.20A {Unidentified} Back     alignment and structure
>1ra0_A Cytosine deaminase; alpha-beta barrel, hexamer, conformation change, D314G mutant, hydrolase; 1.12A {Escherichia coli} SCOP: b.92.1.2 c.1.9.5 PDB: 1r9x_A 1ra5_A 1r9y_A 1r9z_A 1rak_A 3r0d_A* 3o7u_A* 3rn6_A* 1k6w_A 1k70_A 3g77_A Back     alignment and structure
>2qt3_A N-isopropylammelide isopropyl amidohydrolase; N-isopropylammelide isopropylaminohydrolase ATZC, structural genomics, NYSGXRC, target 9364B; 2.24A {Pseudomonas SP} Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* Back     alignment and structure
>2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* Back     alignment and structure
>2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A Back     alignment and structure
>2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A Back     alignment and structure
>2qs8_A XAA-Pro dipeptidase; amidohydrolase, TIM barrel, protein structure initiative, PSI-2, NYSGXRC, structural genomics; 2.33A {Alteromonas macleodii} SCOP: b.92.1.9 c.1.9.18 Back     alignment and structure
>3be7_A Zn-dependent arginine carboxypeptidase; unknown source, amidohydrolase, sargasso SEA, structural GEN protein structure initiative, PSI; HET: ARG; 2.30A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3dug_A* Back     alignment and structure
>3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structur initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* Back     alignment and structure
>2p9b_A Possible prolidase; protein structure initiative II, PSI-2, amidohydrolase, structural genomics; 1.70A {Bifidobacterium longum NCC2705} SCOP: b.92.1.10 c.1.9.17 Back     alignment and structure
>3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} Back     alignment and structure
>2fty_A Dihydropyrimidinase; alpha/beta barrel, beta-sandwich, hydrolase; HET: KCX; 2.40A {Lachancea kluyveri} SCOP: b.92.1.3 c.1.9.6 PDB: 2fvk_A* 2fvm_A* Back     alignment and structure
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Back     alignment and structure
>2vun_A Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} Back     alignment and structure
>1xrt_A Dihydroorotase, dhoase; amidohydrolase, metalloenzyme, pyrimidine; 1.61A {Aquifex aeolicus} SCOP: b.92.1.3 c.1.9.6 PDB: 1xrf_A 3d6n_A* Back     alignment and structure
>1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* Back     alignment and structure
>2ics_A Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} SCOP: b.92.1.8 c.1.9.14 Back     alignment and structure
>3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Back     alignment and structure
>2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus} Back     alignment and structure
>1e9y_B Urease subunit beta; hydrolase, dodecamer; HET: KCX; 3.00A {Helicobacter pylori} SCOP: b.92.1.1 c.1.9.2 PDB: 1e9z_B* 3qga_C* 3qgk_C* Back     alignment and structure
>1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A Back     alignment and structure
>3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} Back     alignment and structure
>3gri_A Dihydroorotase, dhoase; hydrolase, IDP00795, metal-binding, pyrimidine biosynthesis, structural genomics; 2.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3mpg_A Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus anthracis} Back     alignment and structure
>2gwn_A Dihydroorotase; zinc-binding prote structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; HET: KCX GOL; 1.85A {Porphyromonas gingivalis} Back     alignment and structure
>3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} Back     alignment and structure
>2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} Back     alignment and structure
>2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>4ubp_C Protein (urease (chain C)); bacillus pasteurii, nickel, acetohydroxamic acid, metalloenzyme, hydrolase; HET: KCX; 1.55A {Sporosarcina pasteurii} SCOP: b.92.1.1 c.1.9.2 PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 1ie7_C* Back     alignment and structure
>4ac7_C Urease subunit alpha; hydrolase, bacillus pasteurii; HET: CXM KCX FLC; 1.50A {Sporosarcina pasteurii} PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 4ubp_C* 1ie7_C* Back     alignment and structure
>1nfg_A D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2.70A {Ralstonia pickettii} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} Back     alignment and structure
>2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>1rk6_A D-aminoacylase; TIM barrel, beta barrel, insertion, hydrolase; 1.43A {Alcaligenes faecalis} SCOP: b.92.1.6 b.92.1.6 c.1.9.11 PDB: 1rjp_A 1v51_A 1rjq_A 1rjr_A 1rk5_A 1v4y_A 1m7j_A Back     alignment and structure
>1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* Back     alignment and structure
>3nqb_A Adenine deaminase 2; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics, nysgxrc; 2.21A {Agrobacterium tumefaciens} PDB: 3t81_A 3t8l_A Back     alignment and structure
>2pgf_A Adenosine deaminase; metallo-dependent hydrolase, structural genomics, medical ST genomics of pathogenic protozoa consortium, MSGPP; HET: MSE ADN; 1.89A {Plasmodium vivax} PDB: 2pgr_A* 2qvn_A* 3ewc_A* 3ewd_A* 2amx_A Back     alignment and structure
>3gip_A N-acyl-D-glutamate deacylase; amidohydrolase family, hydrolase; 1.50A {Bordetella bronchiseptica} PDB: 3giq_A* Back     alignment and structure
>3mtw_A L-arginine carboxypeptidase CC2672; hydrolase; HET: KCX M3R; 1.70A {Caulobacter vibrioides} Back     alignment and structure
>3pao_A Adenosine deaminase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; HET: ADE; 2.49A {Pseudomonas aeruginosa} PDB: 3pan_A* 3ou8_A* 3pbm_A* Back     alignment and structure
>3rys_A Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2.60A {Arthrobacter aurescens} SCOP: c.1.9.0 Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Back     alignment and structure
>3mkv_A Putative amidohydrolase; sargasso SEA, structural genomics, protein structure initiat NEW YORK structural genomix research consortium, nysgxrc; HET: KCX; 2.40A {Undefined} Back     alignment and structure
>3ggm_A Uncharacterized protein BT9727_2919; bacillus cereus group., structural genomics, PSI-2, protein structure initiative; 2.00A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Back     alignment and structure
>4gy7_A Urease; JACK bean, hydrolase, ME binding, nickel; HET: CME KCX; 1.49A {Canavalia ensiformis} PDB: 3la4_A* 4h9m_A* Back     alignment and structure
>3iar_A Adenosine deaminase; purine metabolism structural genomics, structural genomics consortium, SGC, D mutation, hereditary hemolytic anemia, hydrolase; HET: 3D1; 1.52A {Homo sapiens} SCOP: c.1.9.1 PDB: 2bgn_E* 1w1i_E* 1qxl_A* 1krm_A* 1vfl_A 1ndv_A* 1ndy_A* 1ndz_A* 1o5r_A* 1uml_A* 1v79_A* 1v7a_A* 1ndw_A 1wxy_A* 1wxz_A* 2e1w_A* 2z7g_A* 2ada_A* 3mvi_A 1a4l_A* ... Back     alignment and structure
>4ep8_C Urease subunit alpha; alpha-beta barrel, nickel metalloenzyme, hydrolase, radiatio; HET: KCX; 1.55A {Enterobacter aerogenes} PDB: 1ef2_A* 4epb_C* 4epd_C* 4epe_C* 1ejx_C* 1ejw_C* 1fwj_C* 1kra_C 2kau_C* 1a5k_C 1ejv_C* 1ejt_C* 1eju_C* 1ejs_C* 1a5m_C 1a5n_C 1ejr_C* 1a5l_C 1a5o_C 1fwa_C* ... Back     alignment and structure
>4gxw_A Adenosine deaminase; amidohydrolase, COG1816, EFI, structural genomics, hydrolase; 1.30A {Burkholderia ambifaria} Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Back     alignment and structure
>3lgd_A Adenosine deaminase CECR1; TIM barrel, dimerization and receptor binding domains, glyco hydrolase, growth factor, secreted; HET: NAG; 2.00A {Homo sapiens} PDB: 3lgg_A* Back     alignment and structure
>3pnu_A Dihydroorotase; TIM barrel, zinc binding, hydrolase, structu genomics, center for structural genomics of infectious DISE csgid; HET: KCX; 2.40A {Campylobacter jejuni subsp} Back     alignment and structure
>2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Back     alignment and structure
>2a3l_A AMP deaminase, AMPD; atampd, AT2G38280, adenosine 5'-monophosphate deaminase, COF 5'-phosphate, structural genomics; HET: CF5; 3.34A {Arabidopsis thaliana} SCOP: c.1.9.1 Back     alignment and structure
>1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>3tn4_A Phosphotriesterase; lactonase, hydrolase; HET: KCX; 1.50A {Geobacillus kaustophilus} PDB: 3tnb_A* 3tn3_A* 3tn5_A* 3tn6_A* 3ojg_A* 3orw_A* 3f4c_A* 3f4d_A* Back     alignment and structure
>2z26_A Dihydroorotase, dhoase; TIM barrel, hydrolase; HET: KCX DOR NCD; 1.29A {Escherichia coli} PDB: 2z24_A* 2z25_A* 2eg6_A* 1xge_A* 2eg7_A* 2eg8_A* 2z27_A* 2e25_A* 2z28_A* 2z29_A* 3mjm_A* 2z2a_A* 1j79_A* 2z2b_A* 3ihn_A* 3jze_A* Back     alignment and structure
>2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens} Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>3pnz_A Phosphotriesterase family protein; amidohydrolase fold; HET: KCX; 1.60A {Listeria monocytogenes serotype 4b strorganism_taxid} SCOP: c.1.9.0 Back     alignment and structure
>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Back     alignment and structure
>3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* Back     alignment and structure
>3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} Back     alignment and structure
>3k2g_A Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>3rhg_A Putative phophotriesterase; hydrolase, amidohydrolase, zinc binding site, enzyme functio initiative, EFI; HET: SO4; 1.53A {Proteus mirabilis} Back     alignment and structure
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Back     alignment and structure
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} SCOP: c.1.9.0 Back     alignment and structure
>2ffi_A 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; TIM-barrel protein., structural genomics, PSI, protein struc initiative; 2.61A {Pseudomonas putida} SCOP: c.1.9.15 Back     alignment and structure
>4i6k_A Amidohydrolase family protein; enzyme function initiative, isomerase, structural; HET: CIT; 2.28A {Acinetobacter baumannii} Back     alignment and structure
>2dvt_A Thermophilic reversible gamma-resorcylate decarbo; TIM barrel, lyase; 1.70A {Rhizobium SP} SCOP: c.1.9.15 PDB: 2dvu_A* 2dvx_A* 3s4t_A* Back     alignment and structure
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein initiative, NEW YORK SGX research center for structural GEN nysgxrc; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4do7_A Amidohydrolase 2; enzyme function initiative, EFI, structural TIM-barrel fold, putative lactonase; 1.70A {Burkholderia multivorans} PDB: 4dlm_A 4dnm_A* 4dlf_A Back     alignment and structure
>2f6k_A Metal-dependent hydrolase; metal dependent hydrolyse, aminohydro_2, ACMDS, ACMS, trypto metabolism, quinolinic acid, QUIN; 2.50A {Lactobacillus plantarum} SCOP: c.1.9.15 Back     alignment and structure
>3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TI protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A Back     alignment and structure
>3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Back     alignment and structure
>3qy7_A Tyrosine-protein phosphatase YWQE; TIM barrel, polymerase and histindinol phosphatase(PHP)-like phosphatase, hydrolase; 1.62A {Bacillus subtilis} PDB: 3qy6_A Back     alignment and structure
>2i5g_A Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, structural genomics, protein structure initiative; 2.60A {Pseudomonas aeruginosa} Back     alignment and structure
>2qpx_A Predicted metal-dependent hydrolase of the TIM-BA; YP_805737.1, putative metal-dependent hydrolase; HET: KCX MSE; 1.40A {Lactobacillus casei} Back     alignment and structure
>1itu_A Renal dipeptidase; glycoprotein, membrane-bound, zinc protease BET lactamase, cilastatin, complex (hydrolase-inhibitor), hydro; HET: NAG CIL; 2.00A {Homo sapiens} SCOP: c.1.9.7 PDB: 1itq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 346
d2uz9a2313 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo 2e-35
d1p1ma2281 c.1.9.9 (A:50-330) Hypothetical protein TM0936, pr 7e-33
d2i9ua2310 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium 8e-33
d2paja2336 c.1.9.9 (A:70-405) Hypothetical protein GOS_194309 2e-27
d2ooda2325 c.1.9.9 (A:73-397) Guanine deaminase {Bradyrhizobi 2e-27
d2imra2308 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {D 6e-22
d1ra0a2320 c.1.9.5 (A:56-375) Cytosine deaminase catalytic do 1e-13
d2p9ba2324 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 6e-11
d2puza2301 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobac 4e-10
d2q09a2301 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propa 1e-09
d2p9ba1118 b.92.1.10 (A:9-70,A:395-450) Uncharacterized prote 2e-07
d2bb0a2300 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillu 2e-06
d2r8ca1102 b.92.1.9 (A:2-57,A:369-414) Uncharacterized protei 4e-06
d3be7a2303 c.1.9.18 (A:57-359) Zn-dependent arginine carboxyp 7e-06
d1ynya1127 b.92.1.3 (A:2-52,A:385-460) D-hydantoinase {Bacill 7e-06
d2qs8a2310 c.1.9.18 (A:64-373) Xaa-Pro dipeptidase {Alteromon 1e-05
d2vhla191 b.92.1.5 (A:3-57,A:359-394) N-acetylglucosamine-6- 1e-05
d1onwa1105 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidas 2e-05
d1yrra185 b.92.1.5 (A:1-53,A:351-382) N-acetylglucosamine-6- 4e-05
d2r8ca2311 c.1.9.18 (A:58-368) Uncharacterized protein EAJ561 3e-04
d2puza1103 b.92.1.10 (A:17-79,A:381-420) Imidazolonepropionas 6e-04
d1m7ja155 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolas 7e-04
d2amxa1357 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plas 0.003
>d2uz9a2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: SAH/MTA deaminase-like
domain: Guanine deaminase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  129 bits (323), Expect = 2e-35
 Identities = 59/263 (22%), Positives = 110/263 (41%), Gaps = 7/263 (2%)

Query: 80  PGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEEDSYISTLLCGI-ELIHSG 138
           PG V+TH+H SQ    G + D+ L+ WL    +P E      D         +   + +G
Sbjct: 1   PGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNG 60

Query: 139 VTCFAEAGGQH---VSEMAKAVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKE 195
            T        H      +A   +  G RA + +  MD  +         TT++ I+  + 
Sbjct: 61  TTTACYFATIHTDSSLLLADITDKFGQRAFVGKVCMDLND--TFPEYKETTEESIKETER 118

Query: 196 LYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREFKTGIHMHVAEIPYENQVVMD 255
             ++       R++     R  ++ ++ L+ E  ++A+     I  H++E   E + V +
Sbjct: 119 FVSEMLQKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEAVKN 178

Query: 256 TRKVDHGTVTFLDKIEFLQNNLLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRML-GFA 314
                    +  DK   L N  + AH  +++  E+ +    G  ++HCP S + +  GF 
Sbjct: 179 LYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNLSLSSGFL 238

Query: 315 PIKEMLHADICVSLGTDGAPSNN 337
            + E+L  ++ + LGTD A   +
Sbjct: 239 NVLEVLKHEVKIGLGTDVAGGYS 261


>d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 281 Back     information, alignment and structure
>d2i9ua2 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} Length = 310 Back     information, alignment and structure
>d2paja2 c.1.9.9 (A:70-405) Hypothetical protein GOS_1943094 {Environmental samples} Length = 336 Back     information, alignment and structure
>d2ooda2 c.1.9.9 (A:73-397) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]} Length = 325 Back     information, alignment and structure
>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} Length = 308 Back     information, alignment and structure
>d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]} Length = 320 Back     information, alignment and structure
>d2p9ba2 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Length = 324 Back     information, alignment and structure
>d2puza2 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Length = 301 Back     information, alignment and structure
>d2q09a2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} Length = 301 Back     information, alignment and structure
>d2p9ba1 b.92.1.10 (A:9-70,A:395-450) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Length = 118 Back     information, alignment and structure
>d2bb0a2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} Length = 300 Back     information, alignment and structure
>d2r8ca1 b.92.1.9 (A:2-57,A:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} Length = 102 Back     information, alignment and structure
>d3be7a2 c.1.9.18 (A:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} Length = 303 Back     information, alignment and structure
>d1ynya1 b.92.1.3 (A:2-52,A:385-460) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Length = 127 Back     information, alignment and structure
>d2qs8a2 c.1.9.18 (A:64-373) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]} Length = 310 Back     information, alignment and structure
>d1onwa1 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]} Length = 105 Back     information, alignment and structure
>d1yrra1 b.92.1.5 (A:1-53,A:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure
>d2r8ca2 c.1.9.18 (A:58-368) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} Length = 311 Back     information, alignment and structure
>d2puza1 b.92.1.10 (A:17-79,A:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Length = 103 Back     information, alignment and structure
>d1m7ja1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis [TaxId: 511]} Length = 55 Back     information, alignment and structure
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Length = 357 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
d2i9ua2310 Guanine deaminase {Clostridium acetobutylicum [Tax 100.0
d1p1ma2281 Hypothetical protein TM0936, probable catalytic do 100.0
d2uz9a2313 Guanine deaminase {Human (Homo sapiens) [TaxId: 96 100.0
d2paja2336 Hypothetical protein GOS_1943094 {Environmental sa 99.96
d2imra2308 Hypothetical protein DR0824 {Deinococcus radiodura 99.94
d2ooda2325 Guanine deaminase {Bradyrhizobium japonicum [TaxId 99.85
d2p9ba1118 Uncharacterized protein BL1453 {Bifidobacterium lo 99.71
d2bb0a2300 Imidazolonepropionase {Bacillus subtilis [TaxId: 1 99.66
d1yrra185 N-acetylglucosamine-6-phosphate deacetylase, NagA 99.66
d1ra0a2320 Cytosine deaminase catalytic domain {Escherichia c 99.64
d2q09a2301 Probable 4-imidazolone-5-propanoate amidohydrolase 99.62
d2puza2301 Imidazolonepropionase {Agrobacterium tumefaciens [ 99.61
d1onwa1105 Isoaspartyl dipeptidase {Escherichia coli [TaxId: 99.6
d2r8ca1102 Uncharacterized protein EAJ56179 {Unidentified org 99.54
d2qs8a196 Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 99.46
d1ynya1127 D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} 99.45
d1nfga1127 D-hydantoinase {Burkholderia pickettii [TaxId: 329 99.44
d2fvka1156 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 99.42
d2amxa1357 Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI 99.41
d1k1da1128 D-hydantoinase {Bacillus stearothermophilus [TaxId 99.37
d1ejxc1181 alpha-Subunit of urease {Klebsiella aerogenes [Tax 99.35
d2p9ba2324 Uncharacterized protein BL1453 {Bifidobacterium lo 99.33
d1gkra1126 L-hydantoinase {Arthrobacter aurescens [TaxId: 436 99.3
d2vhla191 N-acetylglucosamine-6-phosphate deacetylase, NagA 99.29
d3be7a2303 Zn-dependent arginine carboxypeptidase {Unidentifi 99.29
d1a4ma_349 Adenosine deaminase (ADA) {Mouse (Mus musculus) [T 99.26
d1gkpa1123 D-hydantoinase {Thermus sp. [TaxId: 275]} 99.22
d1m7ja155 N-acyl-D-aminoacid amidohydrolase {Alcaligenes fae 99.21
d2qs8a2310 Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 99.15
d1kcxa1142 Dihydropyrimidinase related protein-1 {Mouse (Mus 99.07
d2r8ca2311 Uncharacterized protein EAJ56179 {Unidentified org 99.01
d1bf6a_291 Phosphotriesterase homology protein {Escherichia c 99.0
d2ftwa1150 Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli 98.95
d1i0da_331 Phosphotriesterase (parathion hydrolase, PTE) {Pse 98.94
d1kcxa2334 Dihydropyrimidinase related protein-1 {Mouse (Mus 98.94
d1ynya2332 D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} 98.85
d1xrta1112 Two-domain dihydroorotase {Aquifex aeolicus [TaxId 98.75
d2ftwa2334 Dihydropyrimidine amidohydrolase Pyd2 {Dictyosteli 98.69
d2fvka2 384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 98.65
d2puza1103 Imidazolonepropionase {Agrobacterium tumefaciens [ 98.6
d1gkpa2335 D-hydantoinase {Thermus sp. [TaxId: 275]} 98.53
d4ubpc1180 alpha-Subunit of urease {Bacillus pasteurii [TaxId 98.53
d1gkra2325 L-hydantoinase {Arthrobacter aurescens [TaxId: 436 98.52
d1nfga2330 D-hydantoinase {Burkholderia pickettii [TaxId: 329 98.51
d1zzma1259 Putative deoxyribonuclease YjjV {Escherichia coli 98.46
d1e9yb1180 alpha-Subunit of urease {Helicobacter pylori [TaxI 98.33
d1xrta2310 Two-domain dihydroorotase {Aquifex aeolicus [TaxId 98.3
d1j6oa_260 Hypothetical protein TM0667 {Thermotoga maritima [ 98.24
d1xwya1260 Deoxyribonuclease TatD (MttC) {Escherichia coli [T 98.24
d2icsa2267 Putative adenine deaminase EF0837 {Enterococcus fa 98.11
d1yixa1265 Putative deoxyribonuclease YcfH {Escherichia coli 97.97
d1m7ja3 358 N-acyl-D-aminoacid amidohydrolase, catalytic domai 97.68
d2q09a1103 Probable 4-imidazolone-5-propanoate amidohydrolase 97.64
d1o12a176 N-acetylglucosamine-6-phosphate deacetylase, NagA 97.58
d1yrra2297 N-acetylglucosamine-6-phosphate deacetylase, NagA, 97.5
d1onwa2284 Isoaspartyl dipeptidase, catalytic domain {Escheri 97.37
d4ubpc2 390 alpha-subunit of urease, catalytic domain {Bacillu 97.17
d2a3la1628 AMP deaminase (AMPD), catalytic domain {Thale cres 97.15
d1e9yb2 389 alpha-subunit of urease, catalytic domain {Helicob 96.9
d1ejxc2 385 alpha-subunit of urease, catalytic domain {Klebsie 96.9
d2icsa1101 Putative adenine deaminase EF0837 {Enterococcus fa 96.21
d2eg6a1343 Dihydroorotase {Escherichia coli [TaxId: 562]} 95.93
d1ra0a1103 Cytosine deaminase {Escherichia coli [TaxId: 562]} 95.9
d2vhla2301 N-acetylglucosamine-6-phosphate deacetylase, NagA, 95.36
d2ooda1140 Guanine deaminase {Bradyrhizobium japonicum [TaxId 94.52
d1o12a2288 N-acetylglucosamine-6-phosphate deacetylase, NagA, 94.35
d2dvta1325 Thermophilic reversible gamma-resorcylate decarbox 93.48
d3be7a195 Zn-dependent arginine carboxypeptidase {Unidentifi 89.72
>d2i9ua2 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: SAH/MTA deaminase-like
domain: Guanine deaminase
species: Clostridium acetobutylicum [TaxId: 1488]
Probab=100.00  E-value=6.2e-36  Score=264.86  Aligned_cols=261  Identities=23%  Similarity=0.325  Sum_probs=220.7

Q ss_pred             ecccccccCCcccccccccCCCChhHhhhhhccccccCCCchH-HHHHHHHHHHHHHhcCceEeeecCcCCH---HHHHH
Q 019100           80 PGFVNTHVHTSQQLAKGIADDVDLMTWLHDRIWPYESNMTEED-SYISTLLCGIELIHSGVTCFAEAGGQHV---SEMAK  155 (346)
Q Consensus        80 PGfID~H~H~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~l~~GvTt~~d~~~~~~---~~~~~  155 (346)
                      |||||+|+|+.++.+||...+.++.+|+...+|+....+.+++ .+......+.+++++|||++.++...+.   ....+
T Consensus         1 PG~vdaH~H~~~~~~rg~~~~~~l~~wl~~~~~p~~~~~~~~d~~~~~~~~~~~e~l~~GtTtv~d~~~~~~~~~~~~~~   80 (310)
T d2i9ua2           1 PGMNDLHAHASQYKNLGIGMDKELLPWLNNYTFPEEAKFLNVDYAKKTYGRLIKDLIKNGTTRVALFATLHKDSTIELFN   80 (310)
T ss_dssp             ECEEEEEEEGGGGGGTTCCCSSCHHHHHHHTHHHHHHGGGSHHHHHHHHHHHHHHHHHTTEEEEEEECCSCHHHHHHHHH
T ss_pred             CCCEehhhChhhhhhhhccCCCCHHHHHHHhHHHHHHhcCCHHHHHHHHHHHHHHHHHcCCcceeeeeccchhhhHHHHH
Confidence            9999999999999999999999999999999888766655444 4445566788999999999999875443   45567


Q ss_pred             HHHHhCCeEEEecccccCCCCCCcccccCChHHHHHHHHHHHHHHcCCCCCCeEEEEeecccccCCHHHHHHHHHHHHHc
Q 019100          156 AVELLGLRACLVQSTMDCGEGLPASWAVRTTDDCIQSQKELYAKHHHAADGRIRIWFGIRQIMNATDRLLLETRDMAREF  235 (346)
Q Consensus       156 ~~~~~g~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~a~~~  235 (346)
                      ...+.|+|.+++....+.+.   ..+......+.+.+..++.+.+... .+++.+.++|+..+.++++.++.+.+.++++
T Consensus        81 a~~~~gir~~~~~~~~~~~~---~~~~~~~~~~~l~~~~~~~~~~~~~-~~~i~~~~~~~~~~~~~~e~~~~~~~~a~~~  156 (310)
T d2i9ua2          81 MLIKSGIGAYVGKVNMDYNC---PDYLTENYITSLNDTEEIILKYKDK-SNIVKPIITPRFVPSCSNELMDGLGKLSYKY  156 (310)
T ss_dssp             HHHHHTCEEEEECEECCSSC---CTTSCCCHHHHHHHHHHHHHHHTTT-CSSEEECBEECCGGGCCHHHHHHHHHHHHHH
T ss_pred             HHHHhCccccccceeccCCc---cccchhhHHHHHHHHHHHHHHhhcc-ccccceeecccCCCccCHHHHHHHHHHhhcc
Confidence            78889999999887776552   2222334566677777777777654 4678888999999999999999999999999


Q ss_pred             CCeEEEEecCChhhHHHHHHhcCCCCCHHHHHHHcCCCCCC-eeEEEeccCChhhHHHHHhcCCeEEEChhhhccc-ccc
Q 019100          236 KTGIHMHVAEIPYENQVVMDTRKVDHGTVTFLDKIEFLQNN-LLSAHTVWVNHTEIGLLSRAGVKVSHCPASAMRM-LGF  313 (346)
Q Consensus       236 g~~v~~H~~~~~~~~~~~~~~~g~~~~~~~~l~~~g~l~~~-~~~~H~~~~~~~~i~~l~~~g~~v~~~p~~~~~l-~~~  313 (346)
                      ++++++|+.|+..+.+.....++......+.+.+.|+++.+ ++++|+.+++++|++++++.|+.+++||.+|.++ .+.
T Consensus       157 ~~~~~~H~~E~~~e~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~H~~~~~~~~i~~la~~g~~vv~cP~sn~~l~~g~  236 (310)
T d2i9ua2         157 RLPVQSHLSENLDEIAVVKSLHKKSNFYGEVYDKFGLFGNTPTLMAHCIHSSKEEINLIKRNNVTIVHCPTSNFNLGSGM  236 (310)
T ss_dssp             TCCEEEEESCCHHHHHHHHHHCTTCSSHHHHHHHTTCSSSSCEEEEECCSCCHHHHHHHHHTTCEEEECHHHHHHTTCCC
T ss_pred             ccceeehhccchHHHHHHHHHhcccccHHHHHHhcCCccCCceeeeeeeeechhHHHHHHhcCCEEEEeecccccccCCc
Confidence            99999999999999999888888877778899999998765 7779999999999999999999999999999999 889


Q ss_pred             ccHHHHHHcCCcEEEcCCCCCCCCCCCCCCCC
Q 019100          314 APIKEMLHADICVSLGTDGAPSNNRMSIGPFY  345 (346)
Q Consensus       314 ~~~~~~~~~Gv~v~~GTD~~~~~~~~~~~~~~  345 (346)
                      +|+++|+++||+|++|||+.+++ +.|||+++
T Consensus       237 ~pv~~l~~~Gv~v~lGTD~~~~~-~~dm~~~m  267 (310)
T d2i9ua2         237 MPVRKYLNLGINVVLGSDISAGH-TCSLFKVI  267 (310)
T ss_dssp             CCHHHHHHTTCEEEECCCBTTBC-CSCHHHHH
T ss_pred             ccccchhccCceEEEecCCCCCC-CCCHHHHH
Confidence            99999999999999999998654 67998763



>d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2uz9a2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2paja2 c.1.9.9 (A:70-405) Hypothetical protein GOS_1943094 {Environmental samples} Back     information, alignment and structure
>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2ooda2 c.1.9.9 (A:73-397) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2p9ba1 b.92.1.10 (A:9-70,A:395-450) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Back     information, alignment and structure
>d2bb0a2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrra1 b.92.1.5 (A:1-53,A:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q09a2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} Back     information, alignment and structure
>d2puza2 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1onwa1 b.92.1.7 (A:1-62,A:347-389) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r8ca1 b.92.1.9 (A:2-57,A:369-414) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d2qs8a1 b.92.1.9 (A:7-63,A:374-412) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]} Back     information, alignment and structure
>d1ynya1 b.92.1.3 (A:2-52,A:385-460) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Back     information, alignment and structure
>d1nfga1 b.92.1.3 (A:1-51,A:382-457) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Back     information, alignment and structure
>d2fvka1 b.92.1.3 (A:2-56,A:441-541) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1k1da1 b.92.1.3 (A:1-52,A:385-460) D-hydantoinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ejxc1 b.92.1.1 (C:1002-1129,C:1423-1475) alpha-Subunit of urease {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d2p9ba2 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Back     information, alignment and structure
>d1gkra1 b.92.1.3 (A:1-54,A:380-451) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d3be7a2 c.1.9.18 (A:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d1a4ma_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkpa1 b.92.1.3 (A:2-54,A:390-459) D-hydantoinase {Thermus sp. [TaxId: 275]} Back     information, alignment and structure
>d1m7ja1 b.92.1.6 (A:7-61) N-acyl-D-aminoacid amidohydrolase {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d2qs8a2 c.1.9.18 (A:64-373) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]} Back     information, alignment and structure
>d1kcxa1 b.92.1.3 (A:15-66,A:401-490) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2r8ca2 c.1.9.18 (A:58-368) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ftwa1 b.92.1.3 (A:7-59,A:394-490) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Back     information, alignment and structure
>d1kcxa2 c.1.9.6 (A:67-400) Dihydropyrimidinase related protein-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ynya2 c.1.9.6 (A:53-384) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Back     information, alignment and structure
>d1xrta1 b.92.1.3 (A:1-55,A:366-422) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ftwa2 c.1.9.6 (A:60-393) Dihydropyrimidine amidohydrolase Pyd2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d2puza1 b.92.1.10 (A:17-79,A:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gkpa2 c.1.9.6 (A:55-389) D-hydantoinase {Thermus sp. [TaxId: 275]} Back     information, alignment and structure
>d4ubpc1 b.92.1.1 (C:1-131,C:435-483) alpha-Subunit of urease {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1gkra2 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d1nfga2 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9yb1 b.92.1.1 (B:1-131,B:432-480) alpha-Subunit of urease {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d2q09a1 b.92.1.10 (A:4-65,A:367-407) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} Back     information, alignment and structure
>d1o12a1 b.92.1.5 (A:1-43,A:332-364) N-acetylglucosamine-6-phosphate deacetylase, NagA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrra2 c.1.9.10 (A:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d2a3la1 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e9yb2 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of urease, catalytic domain {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ejxc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d2icsa1 b.92.1.8 (A:4-54,A:322-371) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2eg6a1 c.1.9.4 (A:4-346) Dihydroorotase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ra0a1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ooda1 b.92.1.4 (A:3-72,A:398-467) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1o12a2 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} Back     information, alignment and structure
>d3be7a1 b.92.1.9 (A:3-56,A:360-400) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure