Citrus Sinensis ID: 019110

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MDSQLGLIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLALDSDDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKVL
ccccccHHHHHHccccHHHHHHHHHHcccEEEEEccccccccEEEEcHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEcEEcccccEEEEEEEEEEEEcccccEEEEEEEEEEcccccccccccccccccccccccEEEEccccccccccccccccHHHccccccccccccccccccHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccccEEEEccccccccEEEEcHHHHHHHccccHHHccccccccccccccHHHHHHHHHHHHccccEEEEEEEEEccccEEEEEEEEEEEcccccccc
ccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccEEEEcHHHHHHHcccHHHHccccHHHHccccccHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEccccccccEEEEEEEEEccHHHHHHHHccccHHHHHHHcHHHHHHHcccHHHHHHcccccccccccccHHHHcHHHHcHHccccccccccccccccEEEEEccccccccccEccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccccccEEEEcHHHHHHHcccHHHHccccHHHHccccccHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEEcccccEc
MDSQLGLIEQSFNNRYTLWVHEALdelpdsftitdpsisghpivfasrgflkmsgfsraeiigrngrmfqgprtnrRTIMEIREAIREErpievnllnykkdgtpfWMLFKMSLVfgkedgratHFVAVQVPIvsrkhmrnsgmsysedgggsrlREIVFGScrrevcsdsLLDLDRVlaldsddtgleiedsceaSDLEKRKAATAIDNILSVLTHYSQLtgrlvcgkrcslpgmgfiSSSLYISLGRikqsfvlidphlpdmpmvyASDAFLKltgydrnevvgqncrflngvdtdTTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHispirnasgkvl
MDSQLGLIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEiigrngrmfqgprtnrrTIMEIReaireerpievnllnykkdgtpFWMLFKMSLVFGKEDGRATHFVAVqvpivsrkhmrnsgmsysedgggsrLREIVFGSCRREVCSDSLLDLDRVlaldsddtgleiedsceasdlEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIkesiqteqacTVRILNYRKDKssfwnllhispirnasgkvl
MDSQLGLIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNrrtimeireaireerpieVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLALDSDDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKVL
******LIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQVPIVSR******************LREIVFGSCRREVCSDSLLDLDRVLALDSDDTGLEI************KAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPI********
***QLGL***********WVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLALDSDDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKVL
MDSQLGLIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQVPIVSRKHMRNS*********GSRLREIVFGSCRREVCSDSLLDLDRVLALDSDDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKVL
****LGLIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLALDSDDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKVL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSQLGLIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLALDSDDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query346 2.2.26 [Sep-21-2011]
O64511399 Protein TWIN LOV 1 OS=Ara yes no 0.959 0.832 0.663 1e-129
P93025 915 Phototropin-2 OS=Arabidop no no 0.933 0.353 0.325 4e-46
O48963 996 Phototropin-1 OS=Arabidop no no 0.289 0.100 0.456 2e-25
Q2QYY8 921 Phototropin-1A OS=Oryza s no no 0.294 0.110 0.456 2e-25
Q2RBR1 921 Phototropin-1B OS=Oryza s no no 0.294 0.110 0.456 3e-25
Q9ST27 907 Phototropin-2 OS=Oryza sa no no 0.294 0.112 0.446 9e-25
Q8FW73 489 Blue-light-activated hist yes no 0.263 0.186 0.5 2e-23
A9WYQ7 489 Blue-light-activated hist yes no 0.263 0.186 0.5 2e-23
Q8YC53 489 Blue-light-activated hist yes no 0.263 0.186 0.5 2e-23
A9MBM8 489 Blue-light-activated hist yes no 0.263 0.186 0.5 2e-23
>sp|O64511|TLOV1_ARATH Protein TWIN LOV 1 OS=Arabidopsis thaliana GN=TLP1 PE=1 SV=2 Back     alignment and function desciption
 Score =  460 bits (1183), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 270/339 (79%), Gaps = 7/339 (2%)

Query: 11  SFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQ 70
           SF+ RYTLW+ EAL+ELP +FTITDP ISGHPIVFAS GFLKM+G+SR E+IGRNG++FQ
Sbjct: 19  SFSGRYTLWIKEALEELPHNFTITDPFISGHPIVFASLGFLKMTGYSREEVIGRNGKVFQ 78

Query: 71  GPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQ 130
           GP+TNRR+IMEIREAIREER ++V+LLNY+K G+PFWMLF M  VFGK+DG+ T+FVAVQ
Sbjct: 79  GPKTNRRSIMEIREAIREERSVQVSLLNYRKSGSPFWMLFHMCPVFGKDDGKVTNFVAVQ 138

Query: 131 VPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLALDSDD--TGL 188
           VPI  R+H R         G  S      FGSCRREVC  + +  DR L ++ DD   GL
Sbjct: 139 VPISGREHHRK---KLRNVGDLSSDTSPTFGSCRREVCFGNFVCQDRALPVECDDDEQGL 195

Query: 189 EIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLG 248
           E  + CEAS+ EK KA  AI+N+LS+L HYS+L+GRLVCGKR  L G+  +SSSL ISLG
Sbjct: 196 EDWEQCEASESEKLKATEAINNVLSILVHYSELSGRLVCGKRYCLRGVDCLSSSLVISLG 255

Query: 249 RIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKES 308
           RIKQSFVL +P LPDMP++YASDAFL LTGY R EV+GQNCRFL+GVDTD++VLY++KE 
Sbjct: 256 RIKQSFVLTNPCLPDMPIIYASDAFLTLTGYKRQEVLGQNCRFLSGVDTDSSVLYEMKEC 315

Query: 309 IQTEQACTVRILNY--RKDKSSFWNLLHISPIRNASGKV 345
           I   Q+CTV+ILNY  RKDKSSFWNLLHISP+RNASGK 
Sbjct: 316 ILKGQSCTVQILNYSNRKDKSSFWNLLHISPVRNASGKT 354

Arabidopsis thaliana (taxid: 3702)
>sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 Back     alignment and function description
>sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 Back     alignment and function description
>sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 Back     alignment and function description
>sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 Back     alignment and function description
>sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 Back     alignment and function description
>sp|Q8FW73|LOVHK_BRUSU Blue-light-activated histidine kinase OS=Brucella suis biovar 1 (strain 1330) GN=BRA0588 PE=3 SV=2 Back     alignment and function description
>sp|A9WYQ7|LOVHK_BRUSI Blue-light-activated histidine kinase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=BSUIS_B0585 PE=3 SV=2 Back     alignment and function description
>sp|Q8YC53|LOVHK_BRUME Blue-light-activated histidine kinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEII0679 PE=1 SV=1 Back     alignment and function description
>sp|A9MBM8|LOVHK_BRUC2 Blue-light-activated histidine kinase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=BCAN_B0589 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
224110804396 predicted protein [Populus trichocarpa] 0.976 0.853 0.706 1e-143
224102353396 predicted protein [Populus trichocarpa] 0.976 0.853 0.697 1e-142
225424899397 PREDICTED: protein TWIN LOV 1 [Vitis vin 0.991 0.863 0.717 1e-142
255558228375 twin lov protein, putative [Ricinus comm 0.959 0.885 0.704 1e-139
30678020397 protein TWIN LOV 1 [Arabidopsis thaliana 0.959 0.836 0.667 1e-128
42570655358 protein TWIN LOV 1 [Arabidopsis thaliana 0.956 0.924 0.669 1e-128
297817884386 pac motif-containing protein [Arabidopsi 0.950 0.852 0.666 1e-127
18395411399 protein TWIN LOV 1 [Arabidopsis thaliana 0.959 0.832 0.663 1e-127
350537683398 LOV/LOV protein [Solanum lycopersicum] g 0.991 0.861 0.617 1e-125
449434827385 PREDICTED: protein TWIN LOV 1-like [Cucu 0.965 0.867 0.622 1e-125
>gi|224110804|ref|XP_002315641.1| predicted protein [Populus trichocarpa] gi|222864681|gb|EEF01812.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 245/347 (70%), Positives = 291/347 (83%), Gaps = 9/347 (2%)

Query: 1   MDSQLGLIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAE 60
           M+SQL LIE+SFN RY+ WV EAL+ELP +FTITDP+ISGHPIVFAS GFLKMSGF R +
Sbjct: 1   MESQLALIEKSFNTRYSPWVREALEELPHNFTITDPTISGHPIVFASPGFLKMSGFRRDQ 60

Query: 61  IIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKED 120
           +IG NGRMFQGP+TNR+T+MEIREAIREER ++V+L NY+KDGTPFWMLF+MS VF KED
Sbjct: 61  VIGNNGRMFQGPKTNRKTVMEIREAIREERAVQVSLWNYRKDGTPFWMLFQMSPVFSKED 120

Query: 121 GRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLA 180
           GR  HF+ VQVPI+  K         ++DG  +   EIVFGSCRREVCSDSL++L RVLA
Sbjct: 121 GRVIHFIGVQVPILRNKRS-------TDDGADAAWNEIVFGSCRREVCSDSLVELGRVLA 173

Query: 181 LDS--DDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGF 238
           LD+  +  G+E E+  EASDLEK++AAT I+NILSVLTHYS+ TGRL CGKRCS P  G 
Sbjct: 174 LDTYTNCRGVETEEPWEASDLEKQRAATTINNILSVLTHYSESTGRLACGKRCSSPAAGL 233

Query: 239 ISSSLYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTD 298
           I+SSL ISLGRI QSFVLIDPHLP+MP+VYASDAFLKLTGYDR+EV+G N RFL+GV TD
Sbjct: 234 INSSLNISLGRINQSFVLIDPHLPNMPIVYASDAFLKLTGYDRHEVLGCNWRFLSGVGTD 293

Query: 299 TTVLYQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKV 345
           ++VL QI+ES+Q EQACTV  LNYRKDKS+FWNLLH+SP+RNA+GK+
Sbjct: 294 SSVLNQIQESMQVEQACTVCFLNYRKDKSTFWNLLHMSPVRNATGKI 340

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224102353|ref|XP_002312647.1| predicted protein [Populus trichocarpa] gi|222852467|gb|EEE90014.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225424899|ref|XP_002269901.1| PREDICTED: protein TWIN LOV 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255558228|ref|XP_002520141.1| twin lov protein, putative [Ricinus communis] gi|223540633|gb|EEF42196.1| twin lov protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|30678020|ref|NP_849928.1| protein TWIN LOV 1 [Arabidopsis thaliana] gi|18146960|dbj|BAB83170.1| twin LOV protein 1 [Arabidopsis thaliana] gi|330250519|gb|AEC05613.1| protein TWIN LOV 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42570655|ref|NP_973401.1| protein TWIN LOV 1 [Arabidopsis thaliana] gi|330250518|gb|AEC05612.1| protein TWIN LOV 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297817884|ref|XP_002876825.1| pac motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322663|gb|EFH53084.1| pac motif-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18395411|ref|NP_565288.1| protein TWIN LOV 1 [Arabidopsis thaliana] gi|75099072|sp|O64511.2|TLOV1_ARATH RecName: Full=Protein TWIN LOV 1 gi|15010682|gb|AAK74000.1| At2g02710/T20F6.15 [Arabidopsis thaliana] gi|16323302|gb|AAL15406.1| At2g02710/T20F6.15 [Arabidopsis thaliana] gi|20196957|gb|AAC05351.2| putative receptor-like protein kinase [Arabidopsis thaliana] gi|330250520|gb|AEC05614.1| protein TWIN LOV 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|350537683|ref|NP_001234816.1| LOV/LOV protein [Solanum lycopersicum] gi|311692316|dbj|BAJ24889.1| LOV/LOV protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|449434827|ref|XP_004135197.1| PREDICTED: protein TWIN LOV 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
TAIR|locus:2058852399 PLPB "PAS/LOV PROTEIN C" [Arab 0.962 0.834 0.623 1.3e-107
TAIR|locus:2155821 915 PHOT2 "phototropin 2" [Arabido 0.297 0.112 0.446 1.5e-41
UNIPROTKB|Q2QYY8 921 PHOT1A "Phototropin-1A" [Oryza 0.297 0.111 0.456 3.1e-41
UNIPROTKB|Q2RBR1 921 PHOT1B "Phototropin-1B" [Oryza 0.297 0.111 0.456 4e-41
UNIPROTKB|Q9ST27 907 PHOT2 "Phototropin-2" [Oryza s 0.297 0.113 0.446 1.6e-40
UNIPROTKB|Q8H935 963 Vfphot1a "Phototropin" [Vicia 0.297 0.106 0.456 1.5e-38
TAIR|locus:2102674 996 PHOT1 "phototropin 1" [Arabido 0.297 0.103 0.456 3.7e-23
UNIPROTKB|G4NFS7 961 MGG_08735 "Uncharacterized pro 0.286 0.103 0.372 4.7e-14
UNIPROTKB|Q887F0 425 PSPTO_1346 "Sensory box/GGDEF 0.306 0.249 0.345 5e-06
UNIPROTKB|F8WCG6195 KCNH8 "Potassium voltage-gated 0.271 0.482 0.371 2.1e-12
TAIR|locus:2058852 PLPB "PAS/LOV PROTEIN C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1064 (379.6 bits), Expect = 1.3e-107, P = 1.3e-107
 Identities = 212/340 (62%), Positives = 255/340 (75%)

Query:     9 EQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRM 68
             E SF+ RYTLW+ EAL+ELP +FTITDP ISGHPIVFAS GFLKM+G+SR E+IGRNG++
Sbjct:    17 EDSFSGRYTLWIKEALEELPHNFTITDPFISGHPIVFASLGFLKMTGYSREEVIGRNGKV 76

Query:    69 FQGPRTNXXXXXXXXXXXXXXXXXXVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVA 128
             FQGP+TN                  V+LLNY+K G+PFWMLF M  VFGK+DG+ T+FVA
Sbjct:    77 FQGPKTNRRSIMEIREAIREERSVQVSLLNYRKSGSPFWMLFHMCPVFGKDDGKVTNFVA 136

Query:   129 VQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLAL--DSDDT 186
             VQVPI  R+H R    +    G  S      FGSCRREVC  + +  DR L +  D D+ 
Sbjct:   137 VQVPISGREHHRKKLRNV---GDLSSDTSPTFGSCRREVCFGNFVCQDRALPVECDDDEQ 193

Query:   187 GLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYIS 246
             GLE  + CEAS+ EK KA  AI+N+LS+L HYS+L+GRLVCGKR  L G+  +SSSL IS
Sbjct:   194 GLEDWEQCEASESEKLKATEAINNVLSILVHYSELSGRLVCGKRYCLRGVDCLSSSLVIS 253

Query:   247 LGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIK 306
             LGRIKQSFVL +P LPDMP++YASDAFL LTGY R EV+GQNCRFL+GVDTD++VLY++K
Sbjct:   254 LGRIKQSFVLTNPCLPDMPIIYASDAFLTLTGYKRQEVLGQNCRFLSGVDTDSSVLYEMK 313

Query:   307 ESIQTEQACTVRILNY--RKDKSSFWNLLHISPIRNASGK 344
             E I   Q+CTV+ILNY  RKDKSSFWNLLHISP+RNASGK
Sbjct:   314 ECILKGQSCTVQILNYSNRKDKSSFWNLLHISPVRNASGK 353
GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0004871 "signal transducer activity" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA;ISS
GO:0023014 "signal transduction by phosphorylation" evidence=IEA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0046777 "protein autophosphorylation" evidence=RCA
TAIR|locus:2155821 PHOT2 "phototropin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QYY8 PHOT1A "Phototropin-1A" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q2RBR1 PHOT1B "Phototropin-1B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ST27 PHOT2 "Phototropin-2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8H935 Vfphot1a "Phototropin" [Vicia faba (taxid:3906)] Back     alignment and assigned GO terms
TAIR|locus:2102674 PHOT1 "phototropin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4NFS7 MGG_08735 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q887F0 PSPTO_1346 "Sensory box/GGDEF domain protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|F8WCG6 KCNH8 "Potassium voltage-gated channel subfamily H member 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O64511TLOV1_ARATHNo assigned EC number0.66370.95950.8320yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.13LOW CONFIDENCE prediction!
3rd Layer2.7.13.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_VIII1581
hypothetical protein (396 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
PRK13559 361 PRK13559, PRK13559, hypothetical protein; Provisio 2e-34
PRK13558 665 PRK13558, PRK13558, bacterio-opsin activator; Prov 2e-30
PRK13557 540 PRK13557, PRK13557, histidine kinase; Provisional 4e-30
PRK13558 665 PRK13558, PRK13558, bacterio-opsin activator; Prov 3e-27
PRK13557 540 PRK13557, PRK13557, histidine kinase; Provisional 3e-27
PRK13559361 PRK13559, PRK13559, hypothetical protein; Provisio 5e-27
pfam13426101 pfam13426, PAS_9, PAS domain 2e-21
pfam13426101 pfam13426, PAS_9, PAS domain 8e-20
TIGR02938 494 TIGR02938, nifL_nitrog, nitrogen fixation negative 7e-08
TIGR00229124 TIGR00229, sensory_box, PAS domain S-box 3e-07
TIGR02938 494 TIGR02938, nifL_nitrog, nitrogen fixation negative 1e-06
TIGR00229124 TIGR00229, sensory_box, PAS domain S-box 1e-05
pfam00989113 pfam00989, PAS, PAS fold 5e-05
cd00130103 cd00130, PAS, PAS domain; PAS motifs appear in arc 5e-05
COG2202232 COG2202, AtoS, FOG: PAS/PAC domain [Signal transdu 3e-04
cd00130103 cd00130, PAS, PAS domain; PAS motifs appear in arc 9e-04
smart0008643 smart00086, PAC, Motif C-terminal to PAS motifs (l 0.002
pfam00989113 pfam00989, PAS, PAS fold 0.003
>gnl|CDD|237427 PRK13559, PRK13559, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  129 bits (325), Expect = 2e-34
 Identities = 45/98 (45%), Positives = 63/98 (64%)

Query: 249 RIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKES 308
           + + +  + DPH PD+P+V A+ AFL LTGY   EVVG+NCRFL G  TD   + +I+ +
Sbjct: 51  QTRMAMCITDPHQPDLPIVLANQAFLDLTGYAAEEVVGRNCRFLQGAATDPIAVAKIRAA 110

Query: 309 IQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKVL 346
           I  E+   V +LNYRKD   FWN LH+ P+    G++L
Sbjct: 111 IAAEREIVVELLNYRKDGEPFWNALHLGPVYGEDGRLL 148

Length = 361
>gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional Back     alignment and domain information
>gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional Back     alignment and domain information
>gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|237427 PRK13559, PRK13559, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222120 pfam13426, PAS_9, PAS domain Back     alignment and domain information
>gnl|CDD|222120 pfam13426, PAS_9, PAS domain Back     alignment and domain information
>gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL Back     alignment and domain information
>gnl|CDD|232884 TIGR00229, sensory_box, PAS domain S-box Back     alignment and domain information
>gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL Back     alignment and domain information
>gnl|CDD|232884 TIGR00229, sensory_box, PAS domain S-box Back     alignment and domain information
>gnl|CDD|216228 pfam00989, PAS, PAS fold Back     alignment and domain information
>gnl|CDD|238075 cd00130, PAS, PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>gnl|CDD|225112 COG2202, AtoS, FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238075 cd00130, PAS, PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>gnl|CDD|197509 smart00086, PAC, Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>gnl|CDD|216228 pfam00989, PAS, PAS fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 346
PRK13560 807 hypothetical protein; Provisional 99.94
PRK09776 1092 putative diguanylate cyclase; Provisional 99.93
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 99.93
PRK09776 1092 putative diguanylate cyclase; Provisional 99.92
PRK13560 807 hypothetical protein; Provisional 99.9
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 99.89
TIGR02040 442 PpsR-CrtJ transcriptional regulator PpsR. This mod 99.88
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 99.88
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 99.78
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 99.73
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 99.72
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 99.72
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 99.65
PRK10060 663 RNase II stability modulator; Provisional 99.63
PRK11091 779 aerobic respiration control sensor protein ArcB; P 99.57
PRK13559361 hypothetical protein; Provisional 99.56
PRK13557 540 histidine kinase; Provisional 99.55
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 99.53
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 99.53
PRK13558 665 bacterio-opsin activator; Provisional 99.45
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 99.41
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 99.4
PRK13557 540 histidine kinase; Provisional 99.4
PRK13559 361 hypothetical protein; Provisional 99.34
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 99.33
PRK10060 663 RNase II stability modulator; Provisional 99.27
PRK11091 779 aerobic respiration control sensor protein ArcB; P 99.25
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 99.23
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 99.21
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 99.14
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 99.13
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 99.12
PRK13558 665 bacterio-opsin activator; Provisional 99.11
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 99.1
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 99.09
PF12860115 PAS_7: PAS fold 99.08
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 99.05
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 99.02
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 99.02
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 99.01
PRK11360607 sensory histidine kinase AtoS; Provisional 98.96
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 98.89
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 98.84
TIGR02966 333 phoR_proteo phosphate regulon sensor kinase PhoR. 98.8
PRK11073 348 glnL nitrogen regulation protein NR(II); Provision 98.76
COG5002459 VicK Signal transduction histidine kinase [Signal 98.75
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 98.73
PRK11006430 phoR phosphate regulon sensor protein; Provisional 98.68
COG3829 560 RocR Transcriptional regulator containing PAS, AAA 98.67
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 98.54
KOG0501 971 consensus K+-channel KCNQ [Inorganic ion transport 98.5
KOG1229 775 consensus 3'5'-cyclic nucleotide phosphodiesterase 98.49
PRK11360 607 sensory histidine kinase AtoS; Provisional 98.44
PF1318864 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. 98.43
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 98.38
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mech 98.37
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mech 98.34
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 98.32
PRK10820 520 DNA-binding transcriptional regulator TyrR; Provis 98.31
PF12860115 PAS_7: PAS fold 98.26
PF1318864 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A. 98.26
PRK11086542 sensory histidine kinase DcuS; Provisional 98.16
PF08670148 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEK 98.07
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 98.0
PRK11006 430 phoR phosphate regulon sensor protein; Provisional 97.97
PF08670148 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEK 97.92
TIGR02373124 photo_yellow photoactive yellow protein. Members o 97.91
COG5000712 NtrY Signal transduction histidine kinase involved 97.91
KOG1229 775 consensus 3'5'-cyclic nucleotide phosphodiesterase 97.88
PRK11388 638 DNA-binding transcriptional regulator DhaR; Provis 97.86
smart0009167 PAS PAS domain. PAS motifs appear in archaea, euba 97.81
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 97.74
COG3852 363 NtrB Signal transduction histidine kinase, nitroge 97.71
COG3290537 CitA Signal transduction histidine kinase regulati 97.67
TIGR02373124 photo_yellow photoactive yellow protein. Members o 97.66
PRK09959 1197 hybrid sensory histidine kinase in two-component r 97.64
KOG3753 1114 consensus Circadian clock protein period [Signal t 97.64
smart0009167 PAS PAS domain. PAS motifs appear in archaea, euba 97.54
COG2461409 Uncharacterized conserved protein [Function unknow 97.52
PRK11086 542 sensory histidine kinase DcuS; Provisional 97.24
COG3852363 NtrB Signal transduction histidine kinase, nitroge 97.23
COG5002 459 VicK Signal transduction histidine kinase [Signal 97.2
PRK15053 545 dpiB sensor histidine kinase DpiB; Provisional 97.09
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 97.0
COG3290 537 CitA Signal transduction histidine kinase regulati 96.79
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 96.69
smart0008643 PAC Motif C-terminal to PAS motifs (likely to cont 96.61
PF07310137 PAS_5: PAS domain; InterPro: IPR009922 This family 96.59
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 96.33
COG3283 511 TyrR Transcriptional regulator of aromatic amino a 96.09
COG5000 712 NtrY Signal transduction histidine kinase involved 95.81
PF07310137 PAS_5: PAS domain; InterPro: IPR009922 This family 95.8
COG2461409 Uncharacterized conserved protein [Function unknow 95.75
PF08446110 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold 95.3
PRK09959 1197 hybrid sensory histidine kinase in two-component r 94.92
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 94.83
KOG3559598 consensus Transcriptional regulator SIM1 [Transcri 94.65
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 94.23
PRK10841 924 hybrid sensory kinase in two-component regulatory 94.22
PF08446110 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold 92.85
COG3284 606 AcoR Transcriptional activator of acetoin/glycerol 92.51
KOG3753 1114 consensus Circadian clock protein period [Signal t 91.83
PRK10618 894 phosphotransfer intermediate protein in two-compon 87.33
smart0008643 PAC Motif C-terminal to PAS motifs (likely to cont 87.0
PRK13719217 conjugal transfer transcriptional regulator TraJ; 85.22
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 82.98
PRK13719217 conjugal transfer transcriptional regulator TraJ; 81.39
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information 
Probab=99.94  E-value=2.4e-25  Score=213.71  Aligned_cols=240  Identities=14%  Similarity=0.138  Sum_probs=184.6

Q ss_pred             hhhhHHHHHhhhHHHHHHHHhhCCCcEEEecCCCCCCCEEEEehhHHhhhCCCchhhcCCCCCcccCCCCChhhHHHHHH
Q 019110            5 LGLIEQSFNNRYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIRE   84 (346)
Q Consensus         5 ~~~~e~~~~~~~~~~~~~~~~~~~~~i~~~d~~~~d~~i~~~N~~~~~l~G~~~~e~~g~~~~~~~~~~~~~~~~~~~~~   84 (346)
                      .++.|++++ +++++++.+++++|+++++.|.+   |+++++|+++++++||++++++|+++.++.++............
T Consensus       192 rk~ae~~l~-~~~~~l~~l~e~~~~~i~~~d~~---g~i~~~N~~~~~~~G~~~~e~~g~~~~~~~~~~~~~~~~~~~~~  267 (807)
T PRK13560        192 RKRAEERID-EALHFLQQLLDNIADPAFWKDED---AKVFGCNDAACLACGFRREEIIGMSIHDFAPAQPADDYQEADAA  267 (807)
T ss_pred             HHHHHHHHH-HHHHHHHHHHhhCCCeEEEEcCC---CCEEEEhHHHHHHhCCCHHHHcCCcchhcCCcchhHHHHHHHHH
Confidence            345566665 77889999999999999999996   99999999999999999999999998888766544443344445


Q ss_pred             HHhcCCceEEEEEeeeCCCCeEEEEeee--cccccCCCCceeEEEEEeeccccccccccccccccccCCCCcchhhhccc
Q 019110           85 AIREERPIEVNLLNYKKDGTPFWMLFKM--SLVFGKEDGRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGS  162 (346)
Q Consensus        85 ~~~~~~~~~~e~~~~~~dg~~~~~~~~~--~~~~~~~~g~~~~~~~~~~DIT~~k~~~~~~~~~~~~~~~~~~~~~~~~~  162 (346)
                      .+..+....++.+++++||..+|+.+..  .|+.+ .+|.+.+++++++|||++|+++++                    
T Consensus       268 ~~~~~~~~~~e~~~~~~dG~~~~~~~~~~~~~~~~-~~g~~~g~~~~~~DITerk~~e~~--------------------  326 (807)
T PRK13560        268 KFDADGSQIIEAEFQNKDGRTRPVDVIFNHAEFDD-KENHCAGLVGAITDISGRRAAERE--------------------  326 (807)
T ss_pred             HhccCCceEEEEEEEcCCCCEEEEEEEecceEEEc-CCCCEEEEEEEEEechHHHHHHHH--------------------
Confidence            5556667778888999999999766654  45677 789999999999999999998111                    


Q ss_pred             hhhhhhcchhhhhHhhhhcccCCCCCCccccchhhHHHHHHHhhhhhhHHHhhhhcccccCeEEeeeEecCCCccchhHH
Q 019110          163 CRREVCSDSLLDLDRVLALDSDDTGLEIEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSS  242 (346)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~  242 (346)
                                                            .                                   ...+..
T Consensus       327 --------------------------------------L-----------------------------------~~se~~  333 (807)
T PRK13560        327 --------------------------------------L-----------------------------------LEKEDM  333 (807)
T ss_pred             --------------------------------------H-----------------------------------HHHHHH
Confidence                                                  1                                   112234


Q ss_pred             HHHHHhccCCcEEEEcCCCCCCCeeee-cHhHHHHcCCChhhhhcCCccccccCCcchh---------------HH--HH
Q 019110          243 LYISLGRIKQSFVLIDPHLPDMPMVYA-SDAFLKLTGYDRNEVVGQNCRFLNGVDTDTT---------------VL--YQ  304 (346)
Q Consensus       243 l~~~~~~~~~~i~~~d~~~~dg~i~~~-N~~~~~l~G~~~~e~~g~~~~~l~~~~~~~~---------------~~--~~  304 (346)
                      ++.++++++++++++|.   +|.++++ |+++++++||+.++++|+++..+.+......               ..  ..
T Consensus       334 l~~l~~~~~~~i~~~d~---~g~i~~~nn~~~~~~~G~~~~e~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  410 (807)
T PRK13560        334 LRAIIEAAPIAAIGLDA---DGNICFVNNNAAERMLGWSAAEVMGKPLPGMDPELNEEFWCGDFQEWYPDGRPMAFDACP  410 (807)
T ss_pred             HHHHHHhCcccEEEEcC---CCCEEEecCHHHHHHhCCCHHHHcCCCccccChhhhhhhhhchhhhcCCcCCcchhhhhh
Confidence            77788999999999999   9999987 6788889999999999998655432211111               00  11


Q ss_pred             HHHHHhcCCce-EEEEEeEecCCCeEEEEEEeeeeecCCCcc
Q 019110          305 IKESIQTEQAC-TVRILNYRKDKSSFWNLLHISPIRNASGKV  345 (346)
Q Consensus       305 ~~~~~~~~~~~-~~e~~~~~~dG~~~~~~~~~~~i~d~~G~v  345 (346)
                      +...+..+..+ ..+++..+++|..+|+.....|+.|.+|++
T Consensus       411 ~~~~~~~~~~~~~~e~~~~~~~g~~~~~~~~~~p~~d~~g~~  452 (807)
T PRK13560        411 MAKTIKGGKIFDGQEVLIEREDDGPADCSAYAEPLHDADGNI  452 (807)
T ss_pred             HHHHHhcCCcccCceEEEEcCCCCeEEEEEEEeeeECCCCCE
Confidence            23335555554 357888999999999999999999999975

>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1229 consensus 3'5'-cyclic nucleotide phosphodiesterases [Signal transduction mechanisms] Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>PF13188 PAS_8: PAS domain; PDB: 2JHE_D 3VOL_A Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PF08670 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PF08670 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins Back     alignment and domain information
>TIGR02373 photo_yellow photoactive yellow protein Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>KOG1229 consensus 3'5'-cyclic nucleotide phosphodiesterases [Signal transduction mechanisms] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02373 photo_yellow photoactive yellow protein Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>KOG3753 consensus Circadian clock protein period [Signal transduction mechanisms] Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>COG2461 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>PF07310 PAS_5: PAS domain; InterPro: IPR009922 This family contains a number of hypothetical bacterial proteins of unknown function approximately 200 residues long Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PF07310 PAS_5: PAS domain; InterPro: IPR009922 This family contains a number of hypothetical bacterial proteins of unknown function approximately 200 residues long Back     alignment and domain information
>COG2461 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08446 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PF08446 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>KOG3753 consensus Circadian clock protein period [Signal transduction mechanisms] Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PRK13719 conjugal transfer transcriptional regulator TraJ; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
2v0u_A146 N- And C-terminal Helices Of Oat Lov2 (404-546) Are 2e-26
2v1a_A144 N- And C-Terminal Helices Of Oat Lov2 (404-546) Are 3e-26
2wkp_A 332 Structure Of A Photoactivatable Rac1 Containing Lov 3e-26
1n9l_A109 Crystal Structure Of The Phot-lov1 Domain From Chla 7e-26
2z6c_A129 Crystal Structure Of Lov1 Domain Of Phototropin1 Fr 2e-25
2wkq_A 332 Structure Of A Photoactivatable Rac1 Containing The 3e-25
2wkr_A 332 Structure Of A Photoactivatable Rac1 Containing The 5e-25
4eeu_A118 Crystal Structure Of Philov2.1 Length = 118 1e-24
4eep_A115 Crystal Structure Of Lov2 Domain Of Arabidopsis Tha 2e-24
3t50_A128 X-Ray Structure Of The Lov Domain From The Lov-Hk S 2e-24
4ees_A115 Crystal Structure Of Ilov Length = 115 3e-24
4eer_A115 Crystal Structure Of Lov2 Domain Of Arabidopsis Tha 2e-23
2z6d_A130 Crystal Structure Of Lov1 Domain Of Phototropin2 Fr 1e-22
1g28_A104 Structure Of A Flavin-Binding Domain, Lov2, From Th 1e-22
3ulf_A170 The Light State Structure Of The Blue-light Photore 6e-21
3ue6_A166 The Dark Structure Of The Blue-light Photoreceptor 6e-21
2pr5_A132 Structural Basis For Light-dependent Signaling In T 6e-19
3p7n_A258 Crystal Structure Of Light Activated Transcription 2e-14
3rh8_B148 Crystal Structure Of The Light-State Dimer Of Funga 2e-13
3sw1_A162 Structure Of A Full-Length Bacterial Lov Protein Le 2e-13
3hjk_A154 2.0 Angstrom Structure Of The Ile74val Variant Of V 5e-13
3is2_A154 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic 6e-13
3d72_A149 1.65 Angstrom Crystal Structure Of The Cys71val Var 6e-13
3hji_A154 1.8 Angstrom Crystal Structure Of The I74v:i85v Var 6e-13
3is2_B154 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic 7e-13
2pd8_A149 1.8 Angstrom Crystal Structure Of The Cys71ser Muta 8e-13
2pd7_A149 2.0 Angstrom Crystal Structure Of The Fungal Blue-L 9e-13
4hj4_A177 Crystal Structure Of Rhodobacter Sphaeroides Lov Pr 9e-12
4hj6_A178 Crystal Structure Of Rhodobacter Sphaeroides Lov Pr 9e-12
4hj3_A176 Crystal Structure Of Rhodobacter Sphaeroides Lov Pr 1e-11
4hia_A176 Crystal Structure Of Rhodobacter Sphaeroides Lov Pr 1e-11
2l0w_A138 Solution Nmr Structure Of The N-Terminal Pas Domain 1e-07
2l4r_A135 Nmr Solution Structure Of The N-Terminal Pas Domain 1e-07
2l1m_A150 Solution Structure Of The Eag Domain Of The Herg (K 1e-07
1byw_A110 Structure Of The N-Terminal Domain Of The Human-Erg 9e-07
2gj3_A120 Crystal Structure Of The Fad-Containing Pas Domain 1e-04
3ewk_A227 Structure Of The Redox Sensor Domain Of Methylococc 4e-04
>pdb|2V0U|A Chain A, N- And C-terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-induced Signal Transduction (cryo Dark Structure Of Lov2 (404-546)) Length = 146 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 73/103 (70%)
Query: 243 LYISLGRIKQSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVL 302
           L  +L RI+++FV+ DP LPD P+++ASD+FL+LT Y R E++G+NCRFL G +TD   +
Sbjct: 4   LATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATV 63
Query: 303 YQIKESIQTEQACTVRILNYRKDKSSFWNLLHISPIRNASGKV 345
            +I+++I  +   TV+++NY K    FWNL H+ P+R+  G V
Sbjct: 64  RKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDV 106
>pdb|2V1A|A Chain A, N- And C-Terminal Helices Of Oat Lov2 (404-546) Are Involved In Light-Induced Signal Transduction (Room Temperature (293k) Dark Structure Of Lov2 (404-546)) Length = 144 Back     alignment and structure
>pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 Back     alignment and structure
>pdb|1N9L|A Chain A, Crystal Structure Of The Phot-lov1 Domain From Chlamydomonas Reinhardtii In The Dark State. Length = 109 Back     alignment and structure
>pdb|2Z6C|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin1 From Arabidopsis Thaliana Length = 129 Back     alignment and structure
>pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 Back     alignment and structure
>pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 Back     alignment and structure
>pdb|4EEU|A Chain A, Crystal Structure Of Philov2.1 Length = 118 Back     alignment and structure
>pdb|4EEP|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 Length = 115 Back     alignment and structure
>pdb|3T50|A Chain A, X-Ray Structure Of The Lov Domain From The Lov-Hk Sensory Protein From Brucella Abortus (Dark State). Length = 128 Back     alignment and structure
>pdb|4EES|A Chain A, Crystal Structure Of Ilov Length = 115 Back     alignment and structure
>pdb|4EER|A Chain A, Crystal Structure Of Lov2 Domain Of Arabidopsis Thaliana Phototropin 2 C426a Mutant Length = 115 Back     alignment and structure
>pdb|2Z6D|A Chain A, Crystal Structure Of Lov1 Domain Of Phototropin2 From Arabidopsis Thaliana Length = 130 Back     alignment and structure
>pdb|1G28|A Chain A, Structure Of A Flavin-Binding Domain, Lov2, From The Chimeric PhytochromePHOTOTROPIN PHOTORECEPTOR PHY3 Length = 104 Back     alignment and structure
>pdb|3ULF|A Chain A, The Light State Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 170 Back     alignment and structure
>pdb|3UE6|A Chain A, The Dark Structure Of The Blue-light Photoreceptor Aureochrome1 Lov Length = 166 Back     alignment and structure
>pdb|2PR5|A Chain A, Structural Basis For Light-dependent Signaling In The Dimeric Lov Photosensor Ytva (dark Structure) Length = 132 Back     alignment and structure
>pdb|3P7N|A Chain A, Crystal Structure Of Light Activated Transcription Factor El222 From Erythrobacter Litoralis Length = 258 Back     alignment and structure
>pdb|3RH8|B Chain B, Crystal Structure Of The Light-State Dimer Of Fungal Blue-Light Photoreceptor Vivid Length = 148 Back     alignment and structure
>pdb|3SW1|A Chain A, Structure Of A Full-Length Bacterial Lov Protein Length = 162 Back     alignment and structure
>pdb|3HJK|A Chain A, 2.0 Angstrom Structure Of The Ile74val Variant Of Vivid (Vvd). Length = 154 Back     alignment and structure
>pdb|3IS2|A Chain A, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 Back     alignment and structure
>pdb|3D72|A Chain A, 1.65 Angstrom Crystal Structure Of The Cys71val Variant In The Fungal Photoreceptor Vvd Length = 149 Back     alignment and structure
>pdb|3HJI|A Chain A, 1.8 Angstrom Crystal Structure Of The I74v:i85v Variant Of Vivid (Vvd). Length = 154 Back     alignment and structure
>pdb|3IS2|B Chain B, 2.3 Angstrom Crystal Structure Of A Cys71 Sulfenic Acid Form Of Vivid Length = 154 Back     alignment and structure
>pdb|2PD8|A Chain A, 1.8 Angstrom Crystal Structure Of The Cys71ser Mutant Of Vivid Length = 149 Back     alignment and structure
>pdb|2PD7|A Chain A, 2.0 Angstrom Crystal Structure Of The Fungal Blue-Light Photoreceptor Vivid Length = 149 Back     alignment and structure
>pdb|4HJ4|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 177 Back     alignment and structure
>pdb|4HJ6|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 178 Back     alignment and structure
>pdb|4HJ3|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 176 Back     alignment and structure
>pdb|4HIA|A Chain A, Crystal Structure Of Rhodobacter Sphaeroides Lov Protein Length = 176 Back     alignment and structure
>pdb|2L0W|A Chain A, Solution Nmr Structure Of The N-Terminal Pas Domain Of Herg Potassium Channel Length = 138 Back     alignment and structure
>pdb|2L4R|A Chain A, Nmr Solution Structure Of The N-Terminal Pas Domain Of Herg Length = 135 Back     alignment and structure
>pdb|2L1M|A Chain A, Solution Structure Of The Eag Domain Of The Herg (Kv11.1) K+ Channel Length = 150 Back     alignment and structure
>pdb|1BYW|A Chain A, Structure Of The N-Terminal Domain Of The Human-Erg Potassium Channel Length = 110 Back     alignment and structure
>pdb|2GJ3|A Chain A, Crystal Structure Of The Fad-Containing Pas Domain Of The Protein Nifl From Azotobacter Vinelandii. Length = 120 Back     alignment and structure
>pdb|3EWK|A Chain A, Structure Of The Redox Sensor Domain Of Methylococcus Capsulatus (Bath) Mmos Length = 227 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 3e-50
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 7e-46
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 3e-49
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 4e-48
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 9e-49
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 5e-47
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 4e-48
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 1e-46
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 6e-48
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 6e-45
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 1e-47
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 3e-45
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 7e-47
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 3e-42
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 1e-46
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 9e-42
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 2e-45
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 8e-44
1byw_A110 Protein (human ERG potassium channel); PAS domain, 2e-45
1byw_A110 Protein (human ERG potassium channel); PAS domain, 1e-42
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 8e-45
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 7e-42
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 9e-43
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 4e-35
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 1e-42
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 3e-42
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 2e-18
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 9e-13
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 3e-18
3ewk_A 227 Sensor protein; PAS domain, alpha/beta fold, kinas 8e-17
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 2e-16
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 9e-16
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 2e-13
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 5e-13
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 3e-10
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 3e-08
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 2e-07
3mjq_A126 Uncharacterized protein; NESG, structural genomics 2e-07
2r78_A117 Sensor protein; sensory box sensor histidine kinas 3e-06
2r78_A117 Sensor protein; sensory box sensor histidine kinas 6e-04
3b33_A115 Sensor protein; structural genomics, PAS domain, n 3e-05
3olo_A118 Two-component sensor histidine kinase; structural 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 4e-04
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 4e-04
3icy_A118 Sensor protein; sensory box histidine kinase/respo 4e-04
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 7e-04
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 Back     alignment and structure
 Score =  163 bits (414), Expect = 3e-50
 Identities = 46/127 (36%), Positives = 71/127 (55%), Gaps = 1/127 (0%)

Query: 15  RYTLWVHEALDELPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRT 74
           R +  +  AL  L  +F ++D +    PIV+AS GF  M+G+S  EI+GRN R  QGP T
Sbjct: 3   RVSQELKTALSTLQQTFVVSDATQPHCPIVYASSGFFTMTGYSSKEIVGRNCRFLQGPDT 62

Query: 75  NRRTIMEIREAIREERPIEVNLLNYKKDGTPFWMLFKMSLVFGKEDGRATHFVAVQVPIV 134
           ++  + +IR+ ++  +     LLNYKKDGTPFW L  ++ +   + G    F+ +QV + 
Sbjct: 63  DKNEVAKIRDCVKNGKSYCGRLLNYKKDGTPFWNLLTVTPIKD-DQGNTIKFIGMQVEVS 121

Query: 135 SRKHMRN 141
                 N
Sbjct: 122 KYTEGVN 128
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Length = 124 Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Length = 124 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Length = 227 Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Length = 120 Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Length = 120 Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Length = 120 Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Length = 120 Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Length = 126 Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Length = 126 Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Length = 117 Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Length = 117 Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Length = 115 Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Length = 118 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Length = 129 Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Length = 125 Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Length = 118 Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 100.0
4f3l_A361 Mclock, circadian locomoter output cycles protein 99.92
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.89
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 99.89
3rty_A339 Period circadian protein; PAS domain, signalling, 99.89
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 99.87
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 99.84
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 99.83
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 99.82
3mr0_A142 Sensory box histidine kinase/response regulator; P 99.82
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 99.81
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 99.81
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 99.81
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 99.81
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 99.8
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 99.8
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 99.8
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 99.79
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 99.78
3nja_A125 Probable ggdef family protein; structural genomics 99.78
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 99.77
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 99.77
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 99.76
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 99.76
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 99.76
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 99.76
2r78_A117 Sensor protein; sensory box sensor histidine kinas 99.74
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 99.74
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 99.73
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 99.73
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 99.72
3icy_A118 Sensor protein; sensory box histidine kinase/respo 99.72
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 99.72
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 99.72
2r78_A117 Sensor protein; sensory box sensor histidine kinas 99.71
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 99.71
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.7
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 99.7
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 99.69
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 99.69
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 99.69
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 99.69
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 99.68
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 99.68
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 99.68
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 99.67
3mr0_A142 Sensory box histidine kinase/response regulator; P 99.67
3eeh_A125 Putative light and redox sensing histidine kinase; 99.67
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 99.66
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 99.66
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 99.66
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 99.66
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 99.65
3nja_A125 Probable ggdef family protein; structural genomics 99.64
3icy_A118 Sensor protein; sensory box histidine kinase/respo 99.64
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 99.64
3mjq_A126 Uncharacterized protein; NESG, structural genomics 99.63
3olo_A118 Two-component sensor histidine kinase; structural 99.63
1byw_A110 Protein (human ERG potassium channel); PAS domain, 99.62
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 99.62
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 99.62
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 99.62
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 99.62
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 99.61
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 99.61
3eeh_A125 Putative light and redox sensing histidine kinase; 99.6
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 99.59
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 99.59
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 99.58
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.58
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 99.57
3olo_A118 Two-component sensor histidine kinase; structural 99.57
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 99.56
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 99.56
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 99.55
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 99.54
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 99.54
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 99.53
3vol_A233 Aerotaxis transducer AER2; heme, oxygen sensor pro 99.51
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 99.51
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 99.51
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.49
4f3l_A361 Mclock, circadian locomoter output cycles protein 99.49
2qkp_A151 Uncharacterized protein; structural genomics, unkn 99.48
1byw_A110 Protein (human ERG potassium channel); PAS domain, 99.48
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 99.47
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 99.46
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 99.44
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 99.44
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 99.42
3mjq_A126 Uncharacterized protein; NESG, structural genomics 99.4
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 99.38
3b33_A115 Sensor protein; structural genomics, PAS domain, n 99.37
3b33_A115 Sensor protein; structural genomics, PAS domain, n 99.36
3rty_A339 Period circadian protein; PAS domain, signalling, 99.35
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 99.34
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 99.33
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 99.33
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 99.32
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 99.32
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 99.31
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 99.31
3cax_A369 Uncharacterized protein PF0695; structural genomic 99.29
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 99.26
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 99.24
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 99.22
2qkp_A151 Uncharacterized protein; structural genomics, unkn 99.22
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 99.19
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 99.19
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 99.18
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 99.17
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 99.17
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 99.15
3vol_A 233 Aerotaxis transducer AER2; heme, oxygen sensor pro 99.14
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 99.09
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 99.09
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 99.02
3cax_A369 Uncharacterized protein PF0695; structural genomic 98.9
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 98.85
3a0r_A 349 Sensor protein; four helix bundle, PAS fold, kinas 98.82
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 98.65
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 98.07
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 98.06
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 98.36
2ool_A 337 Sensor protein; bacteriophytochrome, photoconversi 96.25
2ool_A337 Sensor protein; bacteriophytochrome, photoconversi 94.6
4ew7_A127 Conjugative transfer: regulation; alpha-beta-alpha 92.26
4dah_A217 Sporulation kinase D; alpha-beta-alpha structure, 91.77
4ew7_A127 Conjugative transfer: regulation; alpha-beta-alpha 91.06
3s7o_A 343 Bacteriophytochrome; biliverdin, PAS, GAF, photore 86.72
4e04_A 327 Bacteriophytochrome (light-regulated signal trans 86.46
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
Probab=100.00  E-value=8.5e-36  Score=241.18  Aligned_cols=213  Identities=21%  Similarity=0.421  Sum_probs=190.4

Q ss_pred             cEEEecCCCCCCCEEEEehhHHhhhCCCchhhcCCCCCcccCCCCChhhHHHHHHHHhcCCceEEEEEeeeCCCCeEEEE
Q 019110           30 SFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPFWML  109 (346)
Q Consensus        30 ~i~~~d~~~~d~~i~~~N~~~~~l~G~~~~e~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dg~~~~~~  109 (346)
                      .|+++|.+   |+|+++|++|++++||++++++|+++..+.++.........+.+.+..+..+..+++.+++||+.+|+.
T Consensus         1 ~i~i~D~~---g~i~~~N~a~~~l~Gy~~~el~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dG~~~~~~   77 (227)
T 3ewk_A            1 LVSITDLQ---GRILYANDNFCAVSRYGREELVGQDHRIVNSGYHGKAYIRDMWRTISRGNIWQGEFCNRRKDGTRYWVD   77 (227)
T ss_dssp             CEEEEETT---CBEEEECHHHHHHTTCCHHHHTTSBGGGGCCSCSCHHHHHHHHHHHTTTCCEEEEEEEECSSSCEEEEE
T ss_pred             CEEEECCC---CcEEehHHHHHHHHCcCHHHHcCCCHHHcCCCCCCHHHHHHHHHHHHcCCeEEEEEEEEcCCCCEEeee
Confidence            36788986   999999999999999999999999988777766666667777888888889999999999999999999


Q ss_pred             eeecccccCCCCceeEEEEEeeccccccccccccccccccCCCCcchhhhccchhhhhhcchhhhhHhhhhcccCCCCCC
Q 019110          110 FKMSLVFGKEDGRATHFVAVQVPIVSRKHMRNSGMSYSEDGGGSRLREIVFGSCRREVCSDSLLDLDRVLALDSDDTGLE  189 (346)
Q Consensus       110 ~~~~~~~~~~~g~~~~~~~~~~DIT~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  189 (346)
                      ++..|+++ .+|.+.+++++.+|||++|+++                         +                       
T Consensus        78 ~~~~p~~d-~~g~~~~~~~~~~DIT~~k~~e-------------------------~-----------------------  108 (227)
T 3ewk_A           78 STIVPLMD-NAGKPRQYISIRRDITAQKEAE-------------------------A-----------------------  108 (227)
T ss_dssp             EEEEEEEC-SSSCEEEEEEEEEECTTTTHHH-------------------------H-----------------------
T ss_pred             eEEEEEEc-CCCCEEEEEEEEEehhhHHHHH-------------------------H-----------------------
Confidence            99999999 9999999999999999999981                         1                       


Q ss_pred             ccccchhhHHHHHHHhhhhhhHHHhhhhcccccCeEEeeeEecCCCccchhHHHHHHHhccCCcEEEEcCCCCCCCeeee
Q 019110          190 IEDSCEASDLEKRKAATAIDNILSVLTHYSQLTGRLVCGKRCSLPGMGFISSSLYISLGRIKQSFVLIDPHLPDMPMVYA  269 (346)
Q Consensus       190 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~i~~~d~~~~dg~i~~~  269 (346)
                                ..+                                       .+..++++++++|+++|.   +|+|+++
T Consensus       109 ----------~l~---------------------------------------~~~~~~~~~~~~i~~~d~---~g~i~~~  136 (227)
T 3ewk_A          109 ----------QLA---------------------------------------RLKQAMDANSEMILLTDR---AGRIIYA  136 (227)
T ss_dssp             ----------HHH---------------------------------------HHHHHHHTCCSEEEEECT---TSCEEEE
T ss_pred             ----------HHH---------------------------------------HHHHHHhcCcCeEEEEcC---CCcEEEE
Confidence                      111                                       134457888999999999   9999999


Q ss_pred             cHhHHHHcCCChhhhhcCCccccccCCcchhHHHHHHHHHhcCCceEEEEEeEecCCC------eEEEEEEeeeeecCCC
Q 019110          270 SDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQTEQACTVRILNYRKDKS------SFWNLLHISPIRNASG  343 (346)
Q Consensus       270 N~~~~~l~G~~~~e~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dG~------~~~~~~~~~~i~d~~G  343 (346)
                      |++|++++||+++|++|+++..+.++.+.......+.+.+..+++|.+|++.++|||+      .+|++++++|++|.+|
T Consensus       137 N~~~~~~~G~~~~e~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~k~G~~~~dg~~~~~~~~~~pi~d~~g  216 (227)
T 3ewk_A          137 NPALCRFSGMAEGELLGQSPSILDSPLADQETLAAMQEALQAGQPWSGRLLNRRRTGPAPHDAEDYWAEISTTPIHTDGN  216 (227)
T ss_dssp             CHHHHHHHTCCTHHHHSSCGGGGBCTTSCHHHHHHHHHHHHHTCCEECCEEEEEECCSSSSCEEEEEEEEEEEEEECSSS
T ss_pred             chHHHHHhCCCHHHHcCCChhhccCCCCCHHHHHHHHHHHHcCCceeEEEEEECCCCCcCcccceEEEEEEEEEEECCCC
Confidence            9999999999999999999999988888888889999999999999999999999997      8999999999999999


Q ss_pred             ccC
Q 019110          344 KVL  346 (346)
Q Consensus       344 ~v~  346 (346)
                      +++
T Consensus       217 ~~~  219 (227)
T 3ewk_A          217 GLV  219 (227)
T ss_dssp             CEE
T ss_pred             CEE
Confidence            863
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>2ool_A Sensor protein; bacteriophytochrome, photoconversion, photoreceptor, biliver signaling protein; HET: LBV; 2.20A {Rhodopseudomonas palustris} SCOP: d.110.2.1 d.110.3.9 Back     alignment and structure
>2ool_A Sensor protein; bacteriophytochrome, photoconversion, photoreceptor, biliver signaling protein; HET: LBV; 2.20A {Rhodopseudomonas palustris} SCOP: d.110.2.1 d.110.3.9 Back     alignment and structure
>4ew7_A Conjugative transfer: regulation; alpha-beta-alpha structure, structural genomics, midwest CEN structural genomics (MCSG), PSI-biology; 1.67A {Salmonella enterica subsp} Back     alignment and structure
>4ew7_A Conjugative transfer: regulation; alpha-beta-alpha structure, structural genomics, midwest CEN structural genomics (MCSG), PSI-biology; 1.67A {Salmonella enterica subsp} Back     alignment and structure
>3s7o_A Bacteriophytochrome; biliverdin, PAS, GAF, photoreceptor, fluorescent protein; HET: LBV GOL; 1.24A {Deinococcus radiodurans} PDB: 3s7n_A* 3s7p_A* 3s7q_A* 2o9c_A* 2o9b_A* 1ztu_A* Back     alignment and structure
>4e04_A Bacteriophytochrome (light-regulated signal trans histidine kinase), PHYB1; bacteriophytochrome chromophore binding domain; HET: LBV; 1.79A {Rhodopseudomonas palustris} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 346
d1jnua_104 d.110.3.6 (A:) Photoreceptor phy3 flavin-binding d 3e-18
d1jnua_104 d.110.3.6 (A:) Photoreceptor phy3 flavin-binding d 1e-15
d1n9la_109 d.110.3.6 (A:) Putative blue light receptor, phot- 4e-18
d1n9la_109 d.110.3.6 (A:) Putative blue light receptor, phot- 8e-18
d1bywa_110 d.110.3.6 (A:) Erg potassium channel, N-terminal d 1e-10
d1bywa_110 d.110.3.6 (A:) Erg potassium channel, N-terminal d 9e-10
d1mzua_110 d.110.3.1 (A:) PYP domain of sensor histidine kina 3e-04
d1xj3a1106 d.110.3.2 (A:154-259) Histidine kinase FixL heme d 0.001
d1p97a_114 d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-t 0.003
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: Flavin-binding PAS domain
domain: Photoreceptor phy3 flavin-binding domain, lov2
species: Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]

 Score = 76.9 bits (188), Expect = 3e-18
 Identities = 44/94 (46%), Positives = 66/94 (70%)

Query: 252 QSFVLIDPHLPDMPMVYASDAFLKLTGYDRNEVVGQNCRFLNGVDTDTTVLYQIKESIQT 311
           +SFV+ DP LPD P+++ASD FL+LT Y R EV+G NCRFL G  TD   +  I+++++ 
Sbjct: 1   KSFVITDPRLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDAVKE 60

Query: 312 EQACTVRILNYRKDKSSFWNLLHISPIRNASGKV 345
           ++  TV++LNY K   +FWNL H+  +R+ +G V
Sbjct: 61  QRDVTVQVLNYTKGGRAFWNLFHLQVMRDENGDV 94
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Length = 104 Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 109 Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 109 Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Length = 110 Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Length = 106 Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 99.89
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 99.88
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 99.85
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 99.84
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 99.84
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 99.81
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 99.78
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 99.77
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 99.72
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 99.7
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 99.68
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 99.66
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 99.65
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 99.63
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 99.62
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 99.6
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 99.6
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 99.55
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 99.53
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 99.48
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 99.47
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 99.34
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 98.09
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 97.72
d2veaa3127 Phytochrome-like protein Cph1 {Synechocystis sp. p 96.61
d2veaa3127 Phytochrome-like protein Cph1 {Synechocystis sp. p 96.31
d2o9ca2127 Bacteriophytochrome BphP {Deinococcus radiodurans 96.29
d2o9ca2127 Bacteriophytochrome BphP {Deinococcus radiodurans 95.33
d3c2wa3113 Bacteriophytochrome BphP {Pseudomonas aeruginosa [ 91.56
d3c2wa3113 Bacteriophytochrome BphP {Pseudomonas aeruginosa [ 83.5
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: Flavin-binding PAS domain
domain: Putative blue light receptor, phot-lov1 domain
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]

Probab=99.89  E-value=7.1e-23  Score=143.15  Aligned_cols=108  Identities=41%  Similarity=0.805  Sum_probs=100.8

Q ss_pred             CCCcEEEecCCCCCCCEEEEehhHHhhhCCCchhhcCCCCCcccCCCCChhhHHHHHHHHhcCCceEEEEEeeeCCCCeE
Q 019110           27 LPDSFTITDPSISGHPIVFASRGFLKMSGFSRAEIIGRNGRMFQGPRTNRRTIMEIREAIREERPIEVNLLNYKKDGTPF  106 (346)
Q Consensus        27 ~~~~i~~~d~~~~d~~i~~~N~~~~~l~G~~~~e~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~dg~~~  106 (346)
                      +.++++++|+..|||+|+|+|++|++++||+++|++|+++..+.+++..+.....+.+.+..+..+..++..+++||+.+
T Consensus         2 i~~~~vi~Da~~pdg~Ii~vN~a~~~~~Gy~~~El~G~~~~~l~~~~~~~~~~~~~~~~l~~~~~~~~e~~~~~kdG~~~   81 (109)
T d1n9la_           2 LRHTFVVADATLPDCPLVYASEGFYAMTGYGPDEVLGHNCRFLQGEGTDPKEVQKIRDAIKKGEACSVRLLNYRKDGTPF   81 (109)
T ss_dssp             CSCEEEEEETTSTTCCEEEECHHHHHHHCCCHHHHTTSCGGGGCCTTCCHHHHHHHHHHHHHTCCEEEEEEEECTTSCEE
T ss_pred             ccceEEEEeCCCCCCeEEEEcHHHHHHHCcCHHHHcCCcceeeecccCCHHHhhhhhhHhhcCCceeeeEEEEecCCeEE
Confidence            57889999987678999999999999999999999999988888888778888889999999999999999999999999


Q ss_pred             EEEeeecccccCCCCceeEEEEEeecccc
Q 019110          107 WMLFKMSLVFGKEDGRATHFVAVQVPIVS  135 (346)
Q Consensus       107 ~~~~~~~~~~~~~~g~~~~~~~~~~DIT~  135 (346)
                      |+.++++|++| ++|.+.+++++++|||.
T Consensus        82 w~~~~~~pi~d-~~G~v~~~v~~~~DITa  109 (109)
T d1n9la_          82 WNLLTVTPIKT-PDGRVSKFVGVQVDVTS  109 (109)
T ss_dssp             EEEEEEEEEEC-TTSCEEEEEEEEEECCC
T ss_pred             EEEEEEEEEEC-CCCCEEEEEEEEEECCC
Confidence            99999999999 99999999999999994
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d3c2wa3 d.110.3.9 (A:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c2wa3 d.110.3.9 (A:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure