Citrus Sinensis ID: 019162
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 345 | ||||||
| 356505618 | 343 | PREDICTED: dnaJ homolog subfamily B memb | 0.994 | 1.0 | 0.852 | 1e-175 | |
| 356572775 | 343 | PREDICTED: dnaJ homolog subfamily B memb | 0.994 | 1.0 | 0.849 | 1e-173 | |
| 225437515 | 345 | PREDICTED: dnaJ homolog subfamily B memb | 0.997 | 0.997 | 0.867 | 1e-173 | |
| 224064488 | 345 | predicted protein [Populus trichocarpa] | 0.982 | 0.982 | 0.877 | 1e-172 | |
| 224131018 | 349 | predicted protein [Populus trichocarpa] | 0.994 | 0.982 | 0.878 | 1e-171 | |
| 255548499 | 345 | Chaperone protein dnaJ, putative [Ricinu | 1.0 | 1.0 | 0.886 | 1e-169 | |
| 449436439 | 344 | PREDICTED: dnaJ homolog subfamily B memb | 0.994 | 0.997 | 0.829 | 1e-167 | |
| 357511325 | 344 | DnaJ homolog subfamily B member [Medicag | 0.994 | 0.997 | 0.843 | 1e-160 | |
| 297821166 | 346 | DNAJ heat shock family protein [Arabidop | 1.0 | 0.997 | 0.797 | 1e-160 | |
| 15228802 | 346 | DNAJ heat shock family protein [Arabidop | 1.0 | 0.997 | 0.791 | 1e-159 |
| >gi|356505618|ref|XP_003521587.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 620 bits (1599), Expect = e-175, Method: Compositional matrix adjust.
Identities = 294/345 (85%), Positives = 322/345 (93%), Gaps = 2/345 (0%)
Query: 1 MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQG 60
MA R A LLFLLCALCY+L IAGKSYY++LQ+ +GASDEQIKRAYRKLALKYHPDKN G
Sbjct: 1 MAPRGATLLFLLCALCYSLIAIAGKSYYDILQLSKGASDEQIKRAYRKLALKYHPDKNPG 60
Query: 61 NEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFF 120
NEEANK+FAEI+NAYEVLSDSE RNIYD YGEEGLKQHAA GGRGGGM N QDIFS+FF
Sbjct: 61 NEEANKKFAEISNAYEVLSDSEKRNIYDRYGEEGLKQHAASGGRGGGM--NFQDIFSTFF 118
Query: 121 GGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYH 180
GGGPMEE+EKIVKGDD++V+LDATLEDLYMGG+LKVWREKNV+KPAPGKRRCNCRNEVYH
Sbjct: 119 GGGPMEEEEKIVKGDDLVVDLDATLEDLYMGGTLKVWREKNVLKPAPGKRRCNCRNEVYH 178
Query: 181 KQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKIDGEPG 240
KQIGPGMFQQMTEQVC+QC NVKY REGYF+TVDIEKGMQDGQEV+FYEDGEP IDGE G
Sbjct: 179 KQIGPGMFQQMTEQVCEQCPNVKYVREGYFITVDIEKGMQDGQEVLFYEDGEPIIDGESG 238
Query: 241 DLKFRIRTAPHDRFRREGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKGITKPKE 300
DL+FRIRTAPHD FRREGN+LH+TVT+TLVQALVGFEKTI+HLDEHLVDISTK ITKPK+
Sbjct: 239 DLRFRIRTAPHDVFRREGNDLHSTVTITLVQALVGFEKTIKHLDEHLVDISTKEITKPKQ 298
Query: 301 VRKFGGEGMPLHFSNKKGDLYITFEVLFPTTLTEDQKTRIKEVLG 345
VRKF GEGMPLH SNKKGDLY+TFEVLFPT+L E+QKT+IK +LG
Sbjct: 299 VRKFKGEGMPLHMSNKKGDLYVTFEVLFPTSLREEQKTKIKAILG 343
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356572775|ref|XP_003554541.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225437515|ref|XP_002275221.1| PREDICTED: dnaJ homolog subfamily B member 11 [Vitis vinifera] gi|147769615|emb|CAN72389.1| hypothetical protein VITISV_040417 [Vitis vinifera] gi|297743958|emb|CBI36928.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224064488|ref|XP_002301501.1| predicted protein [Populus trichocarpa] gi|222843227|gb|EEE80774.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224131018|ref|XP_002320981.1| predicted protein [Populus trichocarpa] gi|118486904|gb|ABK95286.1| unknown [Populus trichocarpa] gi|222861754|gb|EEE99296.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255548499|ref|XP_002515306.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223545786|gb|EEF47290.1| Chaperone protein dnaJ, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449436439|ref|XP_004136000.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cucumis sativus] gi|449507850|ref|XP_004163147.1| PREDICTED: dnaJ homolog subfamily B member 11-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357511325|ref|XP_003625951.1| DnaJ homolog subfamily B member [Medicago truncatula] gi|355500966|gb|AES82169.1| DnaJ homolog subfamily B member [Medicago truncatula] gi|388502852|gb|AFK39492.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297821166|ref|XP_002878466.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata] gi|297324304|gb|EFH54725.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15228802|ref|NP_191819.1| DNAJ heat shock family protein [Arabidopsis thaliana] gi|7362740|emb|CAB83110.1| putative protein [Arabidopsis thaliana] gi|20453120|gb|AAM19802.1| AT3g62600/F26K9_30 [Arabidopsis thaliana] gi|21593230|gb|AAM65179.1| unknown [Arabidopsis thaliana] gi|21928031|gb|AAM78044.1| At3g62600/F26K9_30 [Arabidopsis thaliana] gi|332646847|gb|AEE80368.1| DNAJ heat shock family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 345 | ||||||
| TAIR|locus:2081725 | 346 | ATERDJ3B [Arabidopsis thaliana | 0.936 | 0.933 | 0.768 | 2.2e-137 | |
| RGD|1307373 | 358 | Dnajb11 "DnaJ (Hsp40) homolog, | 0.927 | 0.893 | 0.472 | 3.6e-73 | |
| MGI|MGI:1915088 | 358 | Dnajb11 "DnaJ (Hsp40) homolog, | 0.927 | 0.893 | 0.472 | 5.9e-73 | |
| UNIPROTKB|Q9UBS4 | 358 | DNAJB11 "DnaJ homolog subfamil | 0.927 | 0.893 | 0.469 | 9.6e-73 | |
| UNIPROTKB|F1SFJ8 | 358 | DNAJB11 "Uncharacterized prote | 0.927 | 0.893 | 0.466 | 3.2e-72 | |
| UNIPROTKB|Q3ZBA6 | 358 | DNAJB11 "DnaJ homolog subfamil | 0.927 | 0.893 | 0.463 | 6.7e-72 | |
| UNIPROTKB|P81999 | 358 | DNAJB11 "DnaJ homolog subfamil | 0.924 | 0.891 | 0.464 | 8.6e-72 | |
| UNIPROTKB|F1NVY5 | 364 | DNAJB11 "Uncharacterized prote | 0.921 | 0.873 | 0.453 | 1.3e-70 | |
| UNIPROTKB|F1PXX5 | 358 | DNAJB11 "DnaJ homolog subfamil | 0.915 | 0.882 | 0.459 | 2.6e-70 | |
| ZFIN|ZDB-GENE-031113-9 | 360 | dnajb11 "DnaJ (Hsp40) homolog, | 0.927 | 0.888 | 0.448 | 2.4e-67 |
| TAIR|locus:2081725 ATERDJ3B [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1345 (478.5 bits), Expect = 2.2e-137, P = 2.2e-137
Identities = 249/324 (76%), Positives = 284/324 (87%)
Query: 21 VIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSD 80
V+AGKSYY+VLQVP+GASDEQIKRAYRKLALKYHPDKNQGNEEA ++FAEINNAYEVLSD
Sbjct: 21 VLAGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSD 80
Query: 81 SETRNIYDTYGEEGLKQHAAXXXXXXXXX-VNIQDIFSSFFGGGPMEEDEKIVKGDDVIV 139
E R IY+ YGEEGLKQ +A +N+QDIFSSFFGGG MEE+EK+VKGDDVIV
Sbjct: 81 EEKREIYNKYGEEGLKQFSANGGRGGGGGGMNMQDIFSSFFGGGSMEEEEKVVKGDDVIV 140
Query: 140 ELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQC 199
EL+ATLEDLYMGGS+KVWREKNVIKPAPGKR+CNCRNEVYH+QIGPGMFQQMTEQVCD+C
Sbjct: 141 ELEATLEDLYMGGSMKVWREKNVIKPAPGKRKCNCRNEVYHRQIGPGMFQQMTEQVCDKC 200
Query: 200 QNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHDRFRREGN 259
NVKYEREGYFVTVDIEKGM+DG+EV FYEDGEP +DG+PGDLKFRIRTAPH RFRR+GN
Sbjct: 201 PNVKYEREGYFVTVDIEKGMKDGEEVSFYEDGEPILDGDPGDLKFRIRTAPHARFRRDGN 260
Query: 260 NXXXXXXXXXXXXXXGFEKTIEHLDEHLVDISTKGITKPKEVRKFGGEGMPLHFSNKKGD 319
+ GFEK+ +HLD+H VDIS+KGITKPKEV+KF GEGMPLH+S KKG+
Sbjct: 261 DLHMNVNITLVEALVGFEKSFKHLDDHEVDISSKGITKPKEVKKFKGEGMPLHYSTKKGN 320
Query: 320 LYITFEVLFPTTLTEDQKTRIKEV 343
L++TFEVLFP++LT+DQK +IKEV
Sbjct: 321 LFVTFEVLFPSSLTDDQKKKIKEV 344
|
|
| RGD|1307373 Dnajb11 "DnaJ (Hsp40) homolog, subfamily B, member 11" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915088 Dnajb11 "DnaJ (Hsp40) homolog, subfamily B, member 11" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UBS4 DNAJB11 "DnaJ homolog subfamily B member 11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SFJ8 DNAJB11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBA6 DNAJB11 "DnaJ homolog subfamily B member 11" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P81999 DNAJB11 "DnaJ homolog subfamily B member 11" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NVY5 DNAJB11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PXX5 DNAJB11 "DnaJ homolog subfamily B member 11" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031113-9 dnajb11 "DnaJ (Hsp40) homolog, subfamily B, member 11" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00028084001 | SubName- Full=Putative uncharacterized protein (Chromosome chr7 scaffold_42, whole genome shotgun sequence); (345 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00006855001 | • | • | 0.871 | ||||||||
| GSVIVG00032542001 | • | • | 0.869 | ||||||||
| GSVIVG00006252001 | • | 0.800 | |||||||||
| GSVIVG00017185001 | • | 0.483 | |||||||||
| GSVIVG00005738001 | • | 0.481 | |||||||||
| GSVIVG00004141001 | • | 0.480 | |||||||||
| GSVIVG00012517001 | • | 0.478 | |||||||||
| GSVIVG00017724001 | • | 0.476 | |||||||||
| GSVIVG00037232001 | • | 0.475 | |||||||||
| GSVIVG00006687001 | • | 0.475 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 345 | |||
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 3e-86 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 4e-71 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 4e-65 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 1e-58 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 4e-58 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 1e-56 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 5e-52 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 6e-51 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 7e-51 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 1e-50 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 6e-50 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 1e-46 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 5e-45 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 7e-45 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 2e-43 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 6e-43 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 2e-42 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 8e-42 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 4e-41 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 6e-41 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 3e-40 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 9e-40 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 6e-39 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 4e-36 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 6e-36 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 1e-35 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 4e-34 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 5e-33 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 2e-32 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 3e-32 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 5e-32 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 2e-30 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 2e-28 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 3e-26 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 9e-23 | |
| pfam01556 | 81 | pfam01556, DnaJ_C, DnaJ C terminal domain | 1e-22 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 1e-21 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 4e-20 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 6e-14 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-07 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 5e-07 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 1e-05 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 1e-05 | |
| PRK01356 | 166 | PRK01356, hscB, co-chaperone HscB; Provisional | 4e-05 | |
| PHA03102 | 153 | PHA03102, PHA03102, Small T antigen; Reviewed | 1e-04 | |
| PHA02624 | 647 | PHA02624, PHA02624, large T antigen; Provisional | 0.001 | |
| PTZ00100 | 116 | PTZ00100, PTZ00100, DnaJ chaperone protein; Provis | 0.002 | |
| PRK03578 | 176 | PRK03578, hscB, co-chaperone HscB; Provisional | 0.004 |
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 264 bits (677), Expect = 3e-86
Identities = 114/341 (33%), Positives = 169/341 (49%), Gaps = 27/341 (7%)
Query: 23 AGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSE 82
A + YYE+L V + AS+E+IK+AYRKLA KYHPD+N G++EA ++F EIN AYEVLSD E
Sbjct: 2 AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPE 61
Query: 83 TRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPMEEDEK--IVKGDDVIVE 140
R YD +G G K GG GG G + DIF FFGGG +G D+
Sbjct: 62 KRAAYDQFGHAGFKAGGFGGFGFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYN 121
Query: 141 LDATLEDLYMGGSLKVWREKNVI---------KPAPGKRRC-NCR-NEVYHKQIGPGMFQ 189
L+ TLE+ G ++ ++V KP + C C + G F
Sbjct: 122 LEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPKTCPTCNGSGQVRTVQRTGFFS 181
Query: 190 QMT------------EQVCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKIDG 237
+ C +C+ ++ ++V+I G+ DG + +GE +G
Sbjct: 182 FQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAGPNG 241
Query: 238 -EPGDLKFRIRTAPHDRFRREGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKGIT 296
GDL + PH F R+G++L+ V ++ +A +G E + LD V + T
Sbjct: 242 GPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIEVPTLDGR-VKLKIPAGT 300
Query: 297 KPKEVRKFGGEGMPLHFSNKKGDLYITFEVLFPTTLTEDQK 337
+ EV + G+GMP S +GDLY+ +V P L+++QK
Sbjct: 301 QTGEVFRLRGKGMPKLRSGGRGDLYVRVKVETPKNLSDEQK 341
|
Length = 371 |
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222912 PHA02624, PHA02624, large T antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240265 PTZ00100, PTZ00100, DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235133 PRK03578, hscB, co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 345 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 100.0 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 100.0 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 100.0 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 100.0 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 100.0 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 100.0 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 100.0 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.92 | |
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 99.87 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.81 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.81 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.79 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.78 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.76 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.76 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.73 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.72 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.71 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.7 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.66 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.65 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.63 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.58 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.51 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.48 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.46 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.43 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.43 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.35 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.35 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.28 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.23 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.23 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.03 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 98.97 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.94 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 98.93 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 98.88 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.84 | |
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 98.84 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.83 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 98.82 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 98.81 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 98.8 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 98.76 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 98.73 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 98.73 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 98.7 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 98.68 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 98.68 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 98.67 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 98.66 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 98.65 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 98.61 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 98.61 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 98.59 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 98.58 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 98.53 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 98.5 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 98.48 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 98.48 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 98.47 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 98.46 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 98.43 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 98.42 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 98.37 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 98.36 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 98.33 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.33 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.29 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 98.27 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.26 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 98.2 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 97.31 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 97.1 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 96.63 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.19 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 96.09 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 95.84 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 94.59 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 94.4 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 94.39 | |
| PF11833 | 194 | DUF3353: Protein of unknown function (DUF3353); In | 86.4 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 85.99 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 81.79 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 80.17 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.4e-89 Score=646.42 Aligned_cols=321 Identities=36% Similarity=0.625 Sum_probs=288.3
Q ss_pred cCCcccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCcHHHHHHHHHHHHHHHHhccccccccccccCccccccCcCC
Q 019162 22 IAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAG 101 (345)
Q Consensus 22 ~~~~~~y~iLgv~~~as~~eIk~ayr~la~~~hPd~~~~~~~a~~~f~~i~~Ay~~L~d~~~r~~yd~~g~~~~~~~~~~ 101 (345)
++.+|||+||||+++||.+|||+|||+||++||||+|+++++|+++|++|+|||||||||+||++||+||..+++++.++
T Consensus 1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g 80 (371)
T COG0484 1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG 80 (371)
T ss_pred CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence 35789999999999999999999999999999999999899999999999999999999999999999999988633322
Q ss_pred CCCCCCcccChhhhhhhhcCCCCC--CCccccccCCceeeeeehhheeeeccceEEEEEEeeeeeC-CCCC---------
Q 019162 102 GGRGGGMGVNIQDIFSSFFGGGPM--EEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKP-APGK--------- 169 (345)
Q Consensus 102 ~~~~~~~~~~~~d~F~~~fg~~~~--~~~~~~~kg~di~~~l~itlee~~~G~~~~v~~~r~~~c~-c~g~--------- 169 (345)
+...++|+.++.|||++|||++.. ++++++++|.|+.+.|+|||+|||+|+++++.+++.+.|+ |+|+
T Consensus 81 g~g~~~fgg~~~DIF~~~FgGg~~~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~ 160 (371)
T COG0484 81 GFGFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPK 160 (371)
T ss_pred CCCcCCCCCCHHHHHHHhhcCCCcccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCC
Confidence 211123333789999999976542 3344577999999999999999999999999999999999 9876
Q ss_pred --cCCCccceEEEEEecCceEEEEe------------ecccccccCceEEEecEEEEEEecCCCCCCcEEEEeecCCCCC
Q 019162 170 --RRCNCRNEVYHKQIGPGMFQQMT------------EQVCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKI 235 (345)
Q Consensus 170 --~~C~G~G~~~~~~~~~g~~~~~~------------~~~C~~C~G~g~~~~~~~~~V~Ip~G~~~G~~i~~~g~G~~~~ 235 (345)
++|+|+|++...+.. |++++.+ +++|++|+|.|++.+.++++|+||+|+.+|++|+++|+|++.+
T Consensus 161 tC~tC~G~G~v~~~~~~-g~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~g~G~~g~ 239 (371)
T COG0484 161 TCPTCNGSGQVRTVQRT-GFFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAGP 239 (371)
T ss_pred cCCCCCCcCeEEEEEee-eEEEEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEecCcccCC
Confidence 579999996655433 5555433 8899999999999999999999999999999999999999965
Q ss_pred -CCCCceEEEEEEEcCCCCcccccCCeeEEEEecHHHHhcCcEEEEEcCCCcEEEEEeCCcCCCCcEEEECCCCcCCCCC
Q 019162 236 -DGEPGDLKFRIRTAPHDRFRREGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKGITKPKEVRKFGGEGMPLHFS 314 (345)
Q Consensus 236 -~~~~GDL~v~i~~~~h~~f~r~g~DL~~~~~Isl~eAl~G~~~~i~~ldg~~i~v~i~~~~~~g~~~ri~g~G~p~~~~ 314 (345)
++++|||||+|+|++|+.|.|+|+||+++++||+.+|++|+++.|+||||+ ++|+||+++++|+++||+|+|||...+
T Consensus 240 ~Ggp~GDLyv~i~v~~h~~F~R~g~dL~~~~~Is~~~AalG~~i~vptl~g~-~~l~ip~Gtq~G~~~rl~gkG~p~~~~ 318 (371)
T COG0484 240 NGGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIEVPTLDGR-VKLKIPAGTQTGEVFRLRGKGMPKLRS 318 (371)
T ss_pred CCCCCccEEEEEEeecCCCeEECCCceEeccccCHHHHhcCCEEEEEecCCC-EEEecCCCCccCcEEEEcCCCccccCC
Confidence 677899999999999999999999999999999999999999999999998 999999999999999999999998777
Q ss_pred CCCCcEEEEEEEECCCCCCHHHHHHHHHHh
Q 019162 315 NKKGDLYITFEVLFPTTLTEDQKTRIKEVL 344 (345)
Q Consensus 315 ~~~GDL~v~~~v~~P~~l~~~q~~~l~~~l 344 (345)
..+|||||+|+|.+|++||.+|+++|+++.
T Consensus 319 ~~~GDl~v~v~v~~P~~ls~~q~~lL~~~~ 348 (371)
T COG0484 319 GGRGDLYVRVKVETPKNLSDEQKELLEEFA 348 (371)
T ss_pred CCcCCEEEEEEEEcCCCCCHHHHHHHHHHH
Confidence 767999999999999999999999999985
|
|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 345 | ||||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 2e-18 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 2e-18 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-18 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 2e-18 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 1e-17 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-17 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 2e-17 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 4e-15 | ||
| 3agz_A | 190 | Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi | 7e-15 | ||
| 2qld_A | 183 | Human Hsp40 Hdj1 Length = 183 | 7e-15 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 7e-15 | ||
| 3agx_A | 181 | Crystal Structure Of Human Hsp40 Hdj1 Peptide-Bindi | 8e-15 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 2e-14 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 2e-14 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 3e-14 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 7e-14 | ||
| 1nlt_A | 248 | The Crystal Structure Of Hsp40 Ydj1 Length = 248 | 1e-13 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 1e-13 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 1e-13 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 2e-13 | ||
| 2q2g_A | 180 | Crystal Structure Of Dimerization Domain Of Hsp40 F | 5e-13 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 2e-11 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 4e-11 | ||
| 2yua_A | 99 | Solution Structure Of The Dnaj Domain From Human Wi | 1e-09 | ||
| 2b26_A | 173 | The Crystal Structure Of The Protein Complex Of Yea | 8e-08 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 2e-07 | ||
| 1c3g_A | 170 | S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 1 | 2e-07 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 2e-07 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 3e-07 | ||
| 2qsa_A | 109 | Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 | 7e-07 | ||
| 1wjz_A | 94 | Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P | 2e-06 | ||
| 2l6l_A | 155 | Solution Structure Of Human J-Protein Co-Chaperone, | 2e-06 | ||
| 2ctq_A | 112 | Solution Structure Of J-Domain From Human Dnaj Subf | 2e-04 |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
|
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|3AGZ|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Complexed With A C-Terminal Peptide Of Hsp70 Length = 190 | Back alignment and structure |
| >pdb|2QLD|A Chain A, Human Hsp40 Hdj1 Length = 183 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|3AGX|A Chain A, Crystal Structure Of Human Hsp40 Hdj1 Peptide-Binding Domain Length = 181 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2Q2G|A Chain A, Crystal Structure Of Dimerization Domain Of Hsp40 From Cryptosporidium Parvum, Cgd2_1800 Length = 180 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 | Back alignment and structure |
| >pdb|2B26|A Chain A, The Crystal Structure Of The Protein Complex Of Yeast Hsp40 Sis1 And Hsp70 Ssa1 Length = 173 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|1C3G|A Chain A, S. Cerevisiae Heat Shock Protein 40 Sis1 Length = 170 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 | Back alignment and structure |
| >pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 | Back alignment and structure |
| >pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 | Back alignment and structure |
| >pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 345 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 3e-65 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 1e-63 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 1e-59 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 1e-54 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 5e-53 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 1e-42 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 2e-40 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 1e-39 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 3e-39 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 7e-39 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 5e-37 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 9e-37 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 4e-36 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 6e-36 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 6e-35 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 4e-34 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 1e-33 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 2e-33 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 3e-33 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 3e-33 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 8e-33 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 1e-32 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 3e-32 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 1e-31 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 3e-31 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 2e-28 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 8e-28 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 4e-27 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 5e-26 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-20 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 7e-19 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 3e-17 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 3e-16 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 2e-15 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 2e-15 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 4e-15 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 5e-13 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 8e-12 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 1e-10 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 1e-10 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
Score = 208 bits (531), Expect = 3e-65
Identities = 73/323 (22%), Positives = 123/323 (38%), Gaps = 43/323 (13%)
Query: 25 KSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETR 84
K YY +L V + IK AYR+LA KYHPD ++ N +A +F ++ A+EVL D + R
Sbjct: 28 KDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKEN-DAEAKFKDLAEAWEVLKDEQRR 86
Query: 85 NIYDTYGEEGLKQHAAGGGR---GGGMGVNIQDIFSSFFG-GGPMEEDEKIVKGDDVIVE 140
YD + + + DIFSS FG + +G D+ +E
Sbjct: 87 AEYDQLWQHRNDPGFGRQRQTHEQSYSQQDFDDIFSSMFGQQAHQRRRQHAARGHDLEIE 146
Query: 141 LDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQ 200
+ LE+ + +
Sbjct: 147 VAVFLEETLAEQTRTI----------------------------------SYNLPVYNVF 172
Query: 201 NVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKID-GEPGDLKFRIRTAPHDRFRREGN 259
+ + V I G+ DGQ + G P + G GDL I APH F G+
Sbjct: 173 GMIESETPKTLNVKIPAGVVDGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGH 232
Query: 260 NLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKGITKPKEVRKFGGEGMPLHFSNKKGD 319
NL + + +A +G + T+ L E + ++ ++ + + G+G+ GD
Sbjct: 233 NLEIVLPLAPWEAALGAKVTVPTLKES-ILLTVPPGSQAGQRLRIKGKGLVS--KTHTGD 289
Query: 320 LYITFEVLFPTTLTEDQKTRIKE 342
L+ +++ PT E + ++
Sbjct: 290 LFAVIKIVMPTKPDEKARELWQQ 312
|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} Length = 121 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} Length = 109 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 345 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 100.0 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 100.0 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 100.0 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 100.0 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 100.0 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 99.94 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 99.92 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.9 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.87 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.87 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.86 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.85 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.85 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.85 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.85 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.84 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.83 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.83 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.83 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.83 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.83 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.8 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.8 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.78 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.75 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.73 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.72 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.71 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.71 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.71 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.69 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.69 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.68 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.68 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.66 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.63 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.63 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.62 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.6 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 99.31 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 99.09 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.04 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 98.98 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.86 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 98.8 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 98.79 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 98.72 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 98.68 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 98.56 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 97.68 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 92.92 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 92.72 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 87.09 | |
| 3pmq_A | 669 | Decaheme cytochrome C MTRF; greek KEY, C type cyto | 81.14 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
Probab=100.00 E-value=7.2e-69 Score=510.67 Aligned_cols=286 Identities=26% Similarity=0.407 Sum_probs=159.5
Q ss_pred ccCCcccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCcHHHHHHHHHHHHHHHHhccccccccccccCccccccCcC
Q 019162 21 VIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAA 100 (345)
Q Consensus 21 ~~~~~~~y~iLgv~~~as~~eIk~ayr~la~~~hPd~~~~~~~a~~~f~~i~~Ay~~L~d~~~r~~yd~~g~~~~~~~~~ 100 (345)
.+..+|||++|||+++||.+|||+|||+||++||||+|+ +++|+++|++|++||++|+||.+|+.||+|+......+..
T Consensus 24 ~m~~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~-~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~ 102 (329)
T 3lz8_A 24 AMELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSK-ENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFG 102 (329)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred cccccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCC-ChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCcc
Confidence 344589999999999999999999999999999999998 4578899999999999999999999999985432111111
Q ss_pred CC-C-CCCCc-ccChhhhhhhhcCCCCC-CCccccccCCceeeeeehhheeeeccceEEEEEEeeeeeCCCCCcCCCccc
Q 019162 101 GG-G-RGGGM-GVNIQDIFSSFFGGGPM-EEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRN 176 (345)
Q Consensus 101 ~~-~-~~~~~-~~~~~d~F~~~fg~~~~-~~~~~~~kg~di~~~l~itlee~~~G~~~~v~~~r~~~c~c~g~~~C~G~G 176 (345)
++ + .+++| +.++.|+|++|||++.. +..+..+++.|+.++|+|||+|+|+|+++++.+++.++|. .
T Consensus 103 ~~~~~~~~~f~~~~f~diF~~~Fg~~g~~~~~~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~g---------~- 172 (329)
T 3lz8_A 103 RQRQTHEQSYSQQDFDDIFSSMFGQQAHQRRRQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYNV---------F- 172 (329)
T ss_dssp ----------------------------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECCS---------C-
T ss_pred cccccccCCcCCCchhhhhHhhhcCcCCCCCCCCcCCCCCEEEEEecchhhhhhccceEEEEEEEeecC---------C-
Confidence 00 0 01122 12678999999986321 1123356899999999999999999999999998876432 1
Q ss_pred eEEEEEecCceEEEEeecccccccCceEEEecEEEEEEecCCCCCCcEEEEeecCCCC-CCCCCceEEEEEEEcCCCCcc
Q 019162 177 EVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPK-IDGEPGDLKFRIRTAPHDRFR 255 (345)
Q Consensus 177 ~~~~~~~~~g~~~~~~~~~C~~C~G~g~~~~~~~~~V~Ip~G~~~G~~i~~~g~G~~~-~~~~~GDL~v~i~~~~h~~f~ 255 (345)
|...+...++++|+||||+++|++|+|+|+|++. .++.+|||+|+|+++||+.|+
T Consensus 173 ------------------------G~v~~~~~~~l~V~IP~Gv~~G~~Irl~G~G~~g~~gg~~GDL~v~I~v~~h~~F~ 228 (329)
T 3lz8_A 173 ------------------------GMIESETPKTLNVKIPAGVVDGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFD 228 (329)
T ss_dssp ------------------------C-CCEEEEEEEEEEECTTCCTTCEEEESSCSCCC---CCCCCEEEEECCCCCSSCE
T ss_pred ------------------------eEEEEecceEEEEeCCCCCCCCCEEEEcccccCCCCCCCCCcEEEEEEEecCCccE
Confidence 2222334678999999999999999999999996 467899999999999999999
Q ss_pred cccCCeeEEEEecHHHHhcCcEEEEEcCCCcEEEEEeCCcCCCCcEEEECCCCcCCCCCCCCCcEEEEEEEECCCCCCHH
Q 019162 256 REGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKGITKPKEVRKFGGEGMPLHFSNKKGDLYITFEVLFPTTLTED 335 (345)
Q Consensus 256 r~g~DL~~~~~Isl~eAl~G~~~~i~~ldg~~i~v~i~~~~~~g~~~ri~g~G~p~~~~~~~GDL~v~~~v~~P~~l~~~ 335 (345)
|+|+||+++++||++||++|++++|+||||+ +.|+||+++++|+++||+|+|||.. ..+|||||+|+|.||++||++
T Consensus 229 R~G~DL~~~~~Isl~eAllG~~v~VptLdG~-v~l~ip~gt~~g~~~rl~G~GmP~~--~~rGDL~v~~~V~~P~~l~~~ 305 (329)
T 3lz8_A 229 IVGHNLEIVLPLAPWEAALGAKVTVPTLKES-ILLTVPPGSQAGQRLRIKGKGLVSK--THTGDLFAVIKIVMPTKPDEK 305 (329)
T ss_dssp EETTEEEEEEEECHHHHHHCEEEEECCSSSC-EEEEECTTCCTTCEEEETTCSCBCS--SCBCCEEEEEEECCCSSCCHH
T ss_pred EcCCcEEEEEECCHHHHcCCCeEEEECCCCC-EEEEECCCCCCCCEEEEcCCCCCCC--CCCCCEEEEEEEECCCCCCHH
Confidence 9999999999999999999999999999997 7999999999999999999999976 347999999999999999999
Q ss_pred HHHHHHHHh
Q 019162 336 QKTRIKEVL 344 (345)
Q Consensus 336 q~~~l~~~l 344 (345)
|+++|+++.
T Consensus 306 q~~~l~~~~ 314 (329)
T 3lz8_A 306 ARELWQQLA 314 (329)
T ss_dssp HHHHHHHHH
T ss_pred HHHHHHHHH
Confidence 999999874
|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 345 | ||||
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 6e-24 | |
| d1c3ga2 | 90 | b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Ba | 5e-21 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 2e-20 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 3e-20 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 5e-20 | |
| d1nlta2 | 80 | b.4.1.1 (A:258-337) Mitochondrial protein import p | 2e-18 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 5e-17 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 3e-16 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 9e-16 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 1e-15 | |
| d1nlta1 | 74 | b.4.1.1 (A:110-138,A:213-257) Mitochondrial protei | 1e-08 | |
| d1nlta1 | 74 | b.4.1.1 (A:110-138,A:213-257) Mitochondrial protei | 0.003 | |
| d1c3ga1 | 80 | b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba | 6e-08 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Score = 91.2 bits (226), Expect = 6e-24
Identities = 38/75 (50%), Positives = 55/75 (73%)
Query: 23 AGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSE 82
A + YYE+L V + A + +I++AY++LA+KYHPD+NQG++EA +F EI AYEVL+DS+
Sbjct: 1 AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQ 60
Query: 83 TRNIYDTYGEEGLKQ 97
R YD YG +Q
Sbjct: 61 KRAAYDQYGHAAFEQ 75
|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 345 | |||
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.91 | |
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.91 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 99.86 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.82 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.81 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.77 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.76 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.71 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.69 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.67 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.65 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.4 | |
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 98.98 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 98.97 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 98.92 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 97.86 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 97.84 |
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: HSP40/DnaJ peptide-binding domain superfamily: HSP40/DnaJ peptide-binding domain family: HSP40/DnaJ peptide-binding domain domain: Heat shock protein 40 Sis1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.91 E-value=1.8e-25 Score=171.59 Aligned_cols=89 Identities=29% Similarity=0.633 Sum_probs=83.7
Q ss_pred CcccccCCeeEEEEecHHHHhcCcEEEEEcCCCcEEEEEeCCcCCCCcEEEECCCCcCCCCC-CCCCcEEEEEEEECCCC
Q 019162 253 RFRREGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKGITKPKEVRKFGGEGMPLHFS-NKKGDLYITFEVLFPTT 331 (345)
Q Consensus 253 ~f~r~g~DL~~~~~Isl~eAl~G~~~~i~~ldg~~i~v~i~~~~~~g~~~ri~g~G~p~~~~-~~~GDL~v~~~v~~P~~ 331 (345)
.|+|+|+||+++++||+.||++|++++|+|+||+.+.+++|+++++|++++|+|+|||.... +.+|||||+|+|.+|++
T Consensus 1 ~F~R~G~DL~~~~~I~~~eal~G~~~~i~~~dG~~i~i~ip~~~~~g~~~~i~g~G~p~~~~~~~rGdL~V~~~v~~P~~ 80 (90)
T d1c3ga2 1 NFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPIS 80 (90)
T ss_dssp SEEEETTEEEEEECCBHHHHHHCEEEEEECSSSCEEEEEESSCCCTTCEEECTTCSCBCSSCTTSBCCEEEEECCBCCSS
T ss_pred CCeEeCCeEEEEEEeCHHHHhcCCeEEEecccccceecccccccccccccccCCCCCCcCCCCCCcCCEEEEEEEEcCCC
Confidence 49999999999999999999999999999999999999999999999999999999998654 44699999999999999
Q ss_pred CCHHHHHHHH
Q 019162 332 LTEDQKTRIK 341 (345)
Q Consensus 332 l~~~q~~~l~ 341 (345)
||++|+++|+
T Consensus 81 ls~~qk~~lE 90 (90)
T d1c3ga2 81 LNDAQKRAID 90 (90)
T ss_dssp CCTTHHHHTC
T ss_pred CCHHHHHhhC
Confidence 9999999874
|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|