Citrus Sinensis ID: 019194
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 344 | ||||||
| 225436896 | 343 | PREDICTED: mitochondrial ubiquitin ligas | 0.997 | 1.0 | 0.822 | 1e-169 | |
| 449436571 | 342 | PREDICTED: mitochondrial ubiquitin ligas | 0.994 | 1.0 | 0.808 | 1e-165 | |
| 449515051 | 337 | PREDICTED: mitochondrial ubiquitin ligas | 0.979 | 1.0 | 0.805 | 1e-164 | |
| 356500224 | 339 | PREDICTED: mitochondrial ubiquitin ligas | 0.985 | 1.0 | 0.811 | 1e-157 | |
| 356535760 | 339 | PREDICTED: mitochondrial ubiquitin ligas | 0.985 | 1.0 | 0.808 | 1e-157 | |
| 255567656 | 363 | zinc ion binding protein, putative [Rici | 0.912 | 0.865 | 0.838 | 1e-155 | |
| 297840101 | 343 | zinc finger family protein [Arabidopsis | 0.997 | 1.0 | 0.767 | 1e-155 | |
| 312283085 | 344 | unnamed protein product [Thellungiella h | 0.997 | 0.997 | 0.779 | 1e-155 | |
| 30696917 | 343 | E3 ubiquitin ligase-like protein [Arabid | 0.997 | 1.0 | 0.758 | 1e-153 | |
| 334183615 | 347 | E3 ubiquitin ligase-like protein [Arabid | 0.997 | 0.988 | 0.75 | 1e-151 |
| >gi|225436896|ref|XP_002274008.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|296086688|emb|CBI32323.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 600 bits (1547), Expect = e-169, Method: Compositional matrix adjust.
Identities = 283/344 (82%), Positives = 312/344 (90%), Gaps = 1/344 (0%)
Query: 1 MIPWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLKELAHLLDSGSKVLPFIVTVC 60
MIPWGGISCCLS AALYLLGRSSGRDAE LK+VTRV QLK+L LLD+ KVLP +VTV
Sbjct: 1 MIPWGGISCCLSAAALYLLGRSSGRDAEALKSVTRVQQLKDLVQLLDTACKVLPLVVTVS 60
Query: 61 GRVGSETPISCEYSGLRGVIVEETAEQHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGT 120
GRVGS+TPI CEYSGLRGVIVEETAEQHFLKHNDAGSWIQDSALMLSMSKEVPWYLDD T
Sbjct: 61 GRVGSDTPIKCEYSGLRGVIVEETAEQHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDDT 120
Query: 121 GRAFVVGARGATGFVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLT 180
GRA++VGARGATG VLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIER+LPTGT LT
Sbjct: 121 GRAYIVGARGATGLVLTVGSEVFEESGRSLVRGTLDYLQGLKMLGVKRIERVLPTGTPLT 180
Query: 181 VVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLIA 240
VVGEA+KDD+GT+RIQRPHKGPFYVSPK+ID L+ NLGKWARWY+YAS G T+FG +LIA
Sbjct: 181 VVGEAIKDDVGTIRIQRPHKGPFYVSPKSIDHLVANLGKWARWYRYASLGFTVFGVYLIA 240
Query: 241 KRAIHYILQRKRRWELHRRVLAAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMPDLCVIC 300
K AI Y+++RKR WEL +RVLAAA+ K+S QD+E + + ENGSD T+RDR+MPDLCVIC
Sbjct: 241 KSAIQYVMERKRCWELRKRVLAAAS-KKSGQDSEDPDEKDENGSDNTKRDRLMPDLCVIC 299
Query: 301 LEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH 344
LEQEYNAVFVPCGHMCCC +CS LTNCPLCRRRI+QVVRTFRH
Sbjct: 300 LEQEYNAVFVPCGHMCCCTMCSSQLTNCPLCRRRIEQVVRTFRH 343
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449436571|ref|XP_004136066.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449515051|ref|XP_004164563.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356500224|ref|XP_003518933.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356535760|ref|XP_003536411.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255567656|ref|XP_002524807.1| zinc ion binding protein, putative [Ricinus communis] gi|223535991|gb|EEF37650.1| zinc ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297840101|ref|XP_002887932.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297333773|gb|EFH64191.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|312283085|dbj|BAJ34408.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|30696917|ref|NP_176574.2| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] gi|22135946|gb|AAM91555.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|23197600|gb|AAN15327.1| putative RING zinc finger protein [Arabidopsis thaliana] gi|51970568|dbj|BAD43976.1| unknown protein [Arabidopsis thaliana] gi|51971707|dbj|BAD44518.1| unknown protein [Arabidopsis thaliana] gi|332196043|gb|AEE34164.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334183615|ref|NP_001185305.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] gi|332196044|gb|AEE34165.1| E3 ubiquitin ligase-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 344 | ||||||
| TAIR|locus:2202882 | 338 | ZCF61 [Arabidopsis thaliana (t | 0.976 | 0.994 | 0.534 | 5.7e-91 | |
| UNIPROTKB|E1BGD5 | 350 | MUL1 "Uncharacterized protein" | 0.904 | 0.888 | 0.308 | 5.3e-24 | |
| UNIPROTKB|E2RBI8 | 352 | MUL1 "Uncharacterized protein" | 0.898 | 0.877 | 0.295 | 5.3e-24 | |
| RGD|1309944 | 352 | Mul1 "mitochondrial E3 ubiquit | 0.906 | 0.886 | 0.280 | 7.8e-23 | |
| MGI|MGI:1915600 | 352 | Mul1 "mitochondrial ubiquitin | 0.906 | 0.886 | 0.274 | 1e-22 | |
| UNIPROTKB|Q969V5 | 352 | MUL1 "Mitochondrial ubiquitin | 0.909 | 0.889 | 0.278 | 1.3e-22 | |
| UNIPROTKB|I3LH19 | 352 | MUL1 "Uncharacterized protein" | 0.909 | 0.889 | 0.278 | 1.3e-22 | |
| UNIPROTKB|Q4R7G8 | 352 | MUL1 "Mitochondrial ubiquitin | 0.909 | 0.889 | 0.275 | 9e-22 | |
| ZFIN|ZDB-GENE-050102-5 | 341 | mul1a "mitochondrial E3 ubiqui | 0.927 | 0.935 | 0.276 | 3e-21 | |
| UNIPROTKB|Q6NTT6 | 353 | mul1 "Mitochondrial ubiquitin | 0.906 | 0.883 | 0.270 | 1.3e-20 |
| TAIR|locus:2202882 ZCF61 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 907 (324.3 bits), Expect = 5.7e-91, P = 5.7e-91
Identities = 185/346 (53%), Positives = 237/346 (68%)
Query: 1 MIPWGGISCCLSGAALYLLGRSSGRDAELLKTVTRVNQLKELAHLLDSGSKVLPFIVTVC 60
MI G +CCL G ALYLL RS+GRD +K++TRV QLK+L L++ SKV+P I+ V
Sbjct: 1 MIHLAGFTCCLGGVALYLLTRSTGRD---IKSITRVYQLKDLEQLVEVESKVVPLIIAVS 57
Query: 61 GRVGSETPISCEYSGLRGVIVEETAEQHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGT 120
G VGSETPI CE+S + GV ++ TAEQ L+ N SW+++S LM M+KEVPWYLDDGT
Sbjct: 58 GDVGSETPIKCEHSYVLGVFLKRTAEQQVLRRNWRFSWVRNSTLMQPMTKEVPWYLDDGT 117
Query: 121 GRAFVVGARGATGFVLTVGSEVFEESGR-SLVRGTLDYLQGLKMLGVKRIERLLPTGTSL 179
GR V ++G G LTVGS+VFE++ SLV+G L YL+G K+LGV+ +ER++P GT L
Sbjct: 118 GRVNVDVSQGELGLALTVGSDVFEKAEPVSLVQGALGYLKGFKILGVRHVERVVPIGTPL 177
Query: 180 TVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASFGLTIFGTFLI 239
TVVGEAV+D +G VRIQ+P +GPFYV+ +D+LI LG +R +KYAS GLT+ G LI
Sbjct: 178 TVVGEAVRDGMGNVRIQKPEQGPFYVTYIPLDQLISKLGDLSRRFKYASMGLTVLGVILI 237
Query: 240 AKRAIHYILQR-KRRWELHRRVLAAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMPDLCV 298
+K I YIL+R + E RR A +KR D + G GT RD PDLCV
Sbjct: 238 SKPVIEYILKRIEDTLERRRRQFA---LKRVV-DAAARRAKPVTGG-GTSRDGDTPDLCV 292
Query: 299 ICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH 344
+CL+Q+YN FV CGHMCCC CS L CPLCR RI QV++ +RH
Sbjct: 293 VCLDQKYNTAFVECGHMCCCTPCSLQLRTCPLCRERIQQVLKIYRH 338
|
|
| UNIPROTKB|E1BGD5 MUL1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RBI8 MUL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1309944 Mul1 "mitochondrial E3 ubiquitin protein ligase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915600 Mul1 "mitochondrial ubiquitin ligase activator of NFKB 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q969V5 MUL1 "Mitochondrial ubiquitin ligase activator of NFKB 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LH19 MUL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R7G8 MUL1 "Mitochondrial ubiquitin ligase activator of NFKB 1" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050102-5 mul1a "mitochondrial E3 ubiquitin ligase 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6NTT6 mul1 "Mitochondrial ubiquitin ligase activator of nfkb 1" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 344 | |||
| pfam12483 | 154 | pfam12483, GIDE, E3 Ubiquitin ligase | 6e-59 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 5e-15 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-07 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 7e-06 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 9e-06 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 1e-04 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 0.001 |
| >gnl|CDD|221597 pfam12483, GIDE, E3 Ubiquitin ligase | Back alignment and domain information |
|---|
Score = 186 bits (475), Expect = 6e-59
Identities = 68/151 (45%), Positives = 89/151 (58%), Gaps = 1/151 (0%)
Query: 86 EQHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGRAFVVGARGATGFVLTVGSEVFEE 145
E + + +GSW + S L+ S +EVP+YL DGTGR VV L + FE
Sbjct: 2 EVVTTRDSGSGSWRRRSELVASNEREVPFYLRDGTGRVLVVMDPSGAEIELVTVLDRFEP 61
Query: 146 SGRSLVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHKG-PFY 204
S SL + G LG + IER+LP GT LTVVGEAV+D+ GT+RIQ+P KG PF+
Sbjct: 62 SEGSLFSLLFGFFSGDVTLGYRYIERVLPVGTRLTVVGEAVRDEDGTLRIQKPSKGGPFF 121
Query: 205 VSPKTIDELIENLGKWARWYKYASFGLTIFG 235
+S K+ +ELIE+L AR Y S GL + G
Sbjct: 122 ISTKSEEELIESLASSARTLFYGSIGLGVVG 152
|
This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length. There is a single completely conserved residue E that may be functionally important. GIDE is an E3 ubiquitin ligase which is involved in inducing apoptosis. Length = 154 |
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 344 | |||
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| PF12483 | 160 | GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 Thi | 99.97 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.39 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.31 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.24 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.23 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.96 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.89 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.76 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.7 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.55 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.47 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.45 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.43 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.39 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.31 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.22 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.21 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.09 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.09 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.0 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.0 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.98 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.94 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.93 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.91 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.84 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 97.81 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.76 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.59 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.57 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 97.57 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.5 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.35 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 97.28 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.21 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.15 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.96 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 96.95 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.86 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 96.81 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.62 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.51 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.27 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.22 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.21 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.04 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 95.86 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.75 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 95.36 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.27 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.06 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 94.04 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 93.63 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 93.57 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 93.37 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.06 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 92.53 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 91.59 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 91.33 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 91.01 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 90.79 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 89.82 | |
| PF04710 | 416 | Pellino: Pellino; InterPro: IPR006800 Pellino is i | 89.67 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 88.72 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 88.42 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 87.6 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 87.26 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 86.77 | |
| KOG3842 | 429 | consensus Adaptor protein Pellino [Signal transduc | 85.89 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 84.74 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 84.66 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 83.94 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 83.34 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 82.65 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 82.06 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 82.03 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 81.52 |
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.8e-46 Score=339.72 Aligned_cols=342 Identities=34% Similarity=0.549 Sum_probs=298.9
Q ss_pred CccchhHHHHHHHHHHHHHHhccchhh---HhhcccccccchhHHHHHhhcC-CCccccEEEEEEEeec-CCCccccC-C
Q 019194 1 MIPWGGISCCLSGAALYLLGRSSGRDA---ELLKTVTRVNQLKELAHLLDSG-SKVLPFIVTVCGRVGS-ETPISCEY-S 74 (344)
Q Consensus 1 ~~~~g~~~~~~~~~~~~~~~~~~~~~~---~~l~~~~~~~~~~~L~~~l~~~-~~~~~~~V~v~G~v~~-~~pl~s~~-s 74 (344)
|.+-+.|++++..+++++.++.+.+.. +.++.++......++...++.. .+.++|+ .+.|.+.+ ..|+.+-. +
T Consensus 1 ~~l~~~~~~~~~~v~l~l~~~~~g~~~~~s~~~~~a~k~~~~~d~~~~~~~~~~~~I~~l-~~~~~~~~~~~~~~~~~v~ 79 (355)
T KOG1571|consen 1 MSLEGRFLLGLTNVALRLLFRQYGRLPRVSKVGKEAEKVLVLVDLKSSWDIAPEKKIPYL-VIRGCAIARKETLRSLCVS 79 (355)
T ss_pred CchhHHHHHhhhHHHHHhhhhhcccchhhHHHhhhccceecchhhhhhhhhccccchHHH-HHhhcccccccchHHhhcc
Confidence 566788888888888877777655544 4556777877888888877664 8999999 49999999 66766555 8
Q ss_pred CceEEEEEeeeeeeeeeecCCCceeeceeeeeeeccEeeEEEECCcee----EEEecCCCCccceeeeeeeeeecCc-cc
Q 019194 75 GLRGVIVEETAEQHFLKHNDAGSWIQDSALMLSMSKEVPWYLDDGTGR----AFVVGARGATGFVLTVGSEVFEESG-RS 149 (344)
Q Consensus 75 ~~~cV~~~~~i~e~~~~~~~~~~w~~~~~~i~~~~~~~pF~L~D~tg~----v~V~~~~~a~~~~~~~~~~~~~~~~-~~ 149 (344)
+.++|.+..+.+++....+..+.|.+.++.++.+.+++||+|.+.++. +++..+.+.-.++++.+++.|++.. .+
T Consensus 80 ~v~gvv~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~l~~q~~~~~~~~~~s~~~~~~~l~l~~~~d~f~~s~p~s 159 (355)
T KOG1571|consen 80 NVPGVVQALTLEEPKGRRDGGGHWNANSKIFHEGGNEVPFFLRSQTTGFACEVRVSKTLGRLFLPLNVVYDLFEPSDPCS 159 (355)
T ss_pred cCCceEEEeeeccceeeeccceeeccceeeccCCCcccceeeccCCcceeeeeeeecceeeeeecceeeeccccccCcce
Confidence 999999999999998887878899999999999999999999999888 9999999999999999999999998 56
Q ss_pred ccccccccccceEEeeeeeeecccCCCceeeEeeeEEecCCCceEEeCCCCCCeeeecCCHHHHHHHhhhhhHHHHHHHh
Q 019194 150 LVRGTLDYLQGLKMLGVKRIERLLPTGTSLTVVGEAVKDDIGTVRIQRPHKGPFYVSPKTIDELIENLGKWARWYKYASF 229 (344)
Q Consensus 150 ~~~~~~~~~~g~~~~g~r~~E~~L~~g~~l~vvGe~~~d~~G~l~i~~P~~~~f~lS~~~~~~L~~~l~~~a~~~~~~~i 229 (344)
+.+...++++|.+..|.+.+|++||+|+.+|++||++.|+++...+++|.+|++|+.....+.|+.++..+++..++.++
T Consensus 160 ~~~~~~~~~sg~~~~~~~~~~~~l~~~~~~t~l~e~v~d~~~~~r~~~~~~g~~~v~~s~~d~LIsr~g~~s~~~kv~~~ 239 (355)
T KOG1571|consen 160 LVDVGGGYHSGVRRGGFRETERVLPLGTRLTALGELVRDGYCGVRVQPPMQGPLYVTKSAADRLISREGDLSFFVKVNGM 239 (355)
T ss_pred eeecccccccceeeecccceEEeeccccceeeeehheecCCCceEecCCccCcceeeccchhhHHHhhccceeeeeecce
Confidence 88888999999999999999999999999999999999988999999999996555555599999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHhhhcccCCCCCCCCCCCCCCccCcccccccceecccccce
Q 019194 230 GLTIFGTFLIAKRAIHYILQ--RKRRWELHRRVLAAAAVKRSEQDNEGTNGQAENGSDGTQRDRVMPDLCVICLEQEYNA 307 (344)
Q Consensus 230 ~~~~~g~~ll~~~~~r~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~C~iC~~~~~~~ 307 (344)
++++.+++++..+..++|.+ +++++++.+....+.. .+......+.+..-+.+++........++.|+||++++.++
T Consensus 240 ~~~~~~~ills~~~~d~~led~r~~r~~l~k~~~~~~~-~rae~~s~g~~gtr~~~~~~~~~~~~~p~lcVVcl~e~~~~ 318 (355)
T KOG1571|consen 240 VFGTLGVILLSFIVKDNYLEDDRRQRRELVKRVEDLAT-VRAELLSRGVRGTRIQNENGTFRELPQPDLCVVCLDEPKSA 318 (355)
T ss_pred eeeeeeEEeehHHHHHHHHHHHHHHHHHHHHhhhhhhh-heeeeecccccccccccccCcccccCCCCceEEecCCccce
Confidence 99999999999999999987 7888888887777776 55555555555555666667777777888999999999999
Q ss_pred EEecCCCccccccchhccCCCccCcccccceeecccC
Q 019194 308 VFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH 344 (344)
Q Consensus 308 ~~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~~y~~ 344 (344)
+|+||||+|||..|+..++.||+||+.|..++++|+|
T Consensus 319 ~fvpcGh~ccct~cs~~l~~CPvCR~rI~~~~k~y~~ 355 (355)
T KOG1571|consen 319 VFVPCGHVCCCTLCSKHLPQCPVCRQRIRLVRKRYRS 355 (355)
T ss_pred eeecCCcEEEchHHHhhCCCCchhHHHHHHHHHHhcC
Confidence 9999999999999999999999999999999999987
|
|
| >PF12483 GIDE: E3 Ubiquitin ligase; InterPro: IPR022170 This domain family is found in bacteria, archaea and eukaryotes, and is typically between 150 and 163 amino acids in length | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 344 | ||||
| 2yhn_A | 79 | The Idol-Ube2d Complex Mediates Sterol-Dependent De | 2e-08 | ||
| 3t6p_A | 345 | Iap Antagonist-Induced Conformational Change In Cia | 1e-07 | ||
| 3eb5_A | 74 | Structure Of The Ciap2 Ring Domain Length = 74 | 5e-07 | ||
| 4ic2_A | 74 | Crystal Structure Of The Xiap Ring Domain Length = | 3e-05 | ||
| 4ic3_A | 74 | Crystal Structure Of The F495l Mutant Xiap Ring Dom | 4e-05 | ||
| 2ecg_A | 75 | Solution Structure Of The Ring Domain Of The Baculo | 4e-05 | ||
| 4auq_B | 62 | Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 | 3e-04 |
| >pdb|2YHN|A Chain A, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 79 | Back alignment and structure |
|
| >pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 | Back alignment and structure |
| >pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 | Back alignment and structure |
| >pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 | Back alignment and structure |
| >pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 | Back alignment and structure |
| >pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 | Back alignment and structure |
| >pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 344 | |||
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 1e-21 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 2e-21 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 4e-21 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 5e-19 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 2e-17 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 2e-17 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 9e-09 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 3e-08 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-07 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 1e-07 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 1e-07 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 2e-07 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 7e-07 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 7e-07 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 9e-07 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 2e-06 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 4e-06 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 5e-06 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 2e-05 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-05 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 3e-05 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 3e-05 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 3e-05 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 4e-05 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 5e-05 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 6e-05 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 7e-05 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 9e-05 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 2e-04 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 2e-04 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 2e-04 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 2e-04 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 2e-04 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 2e-04 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 2e-04 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 8e-04 |
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Score = 86.4 bits (214), Expect = 1e-21
Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 2/70 (2%)
Query: 275 GTNGQAENGSDGTQRDRVMPD--LCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCR 332
G++G + ++ R + + LC IC+++ VFVPCGH+ C C+ + CP+C
Sbjct: 4 GSSGSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCY 63
Query: 333 RRIDQVVRTF 342
I + F
Sbjct: 64 TVITFKQKIF 73
|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 344 | |||
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.54 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.45 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.41 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.35 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.34 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.3 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 99.04 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.95 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.92 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.89 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.89 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.88 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.82 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.8 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.8 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.8 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.79 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.77 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.76 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.75 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.75 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.74 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.74 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.7 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.67 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.67 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.67 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.65 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.64 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.62 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.61 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.61 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.61 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.6 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.57 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.57 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.54 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.54 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.53 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.52 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.51 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.47 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.47 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.46 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.44 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.41 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.41 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.39 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.35 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.35 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.33 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.33 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.3 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.28 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.26 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.18 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.15 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.13 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.09 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.0 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.98 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.94 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 97.85 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.76 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.73 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.62 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.29 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 97.21 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 96.66 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 96.03 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 95.97 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 87.94 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 80.37 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 80.23 |
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.54 E-value=3.2e-15 Score=107.81 Aligned_cols=55 Identities=27% Similarity=0.645 Sum_probs=50.0
Q ss_pred CcccccccceecccccceEEecCCCccccccchhccCCCccCcccccceeecccC
Q 019194 290 DRVMPDLCVICLEQEYNAVFVPCGHMCCCIICSWHLTNCPLCRRRIDQVVRTFRH 344 (344)
Q Consensus 290 ~~~~~~~C~iC~~~~~~~~~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~~y~~ 344 (344)
...+...|+||++++++++++||||+++|..|+..+..||+||++|..++++|.+
T Consensus 11 ~~~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~~ 65 (68)
T 2ea5_A 11 SEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSGP 65 (68)
T ss_dssp SCCCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCSS
T ss_pred cCCCCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeecC
Confidence 3444568999999999999999999988999999999999999999999999964
|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 344 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-11 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-10 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 4e-09 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 2e-06 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 3e-06 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 5e-06 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 0.001 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 0.002 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 0.003 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 56.9 bits (137), Expect = 2e-11
Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 4/48 (8%)
Query: 295 DLCVICLEQEYNAVFVPCGHMCCCIICSWHLTN----CPLCRRRIDQV 338
LC IC E + + PCGH+ C + + CP CR I
Sbjct: 24 QLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGT 71
|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 344 | |||
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.06 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.96 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.94 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.79 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.7 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.68 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.54 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.51 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.5 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.44 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.44 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.35 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.28 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.18 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.02 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.96 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.11 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.06 E-value=1.7e-11 Score=89.04 Aligned_cols=47 Identities=34% Similarity=0.832 Sum_probs=41.8
Q ss_pred cccceecccccceEEecCCCccccccchhcc-----CCCccCcccccceeecc
Q 019194 295 DLCVICLEQEYNAVFVPCGHMCCCIICSWHL-----TNCPLCRRRIDQVVRTF 342 (344)
Q Consensus 295 ~~C~iC~~~~~~~~~~pCgH~~~C~~C~~~~-----~~CP~CR~~i~~~~~~y 342 (344)
..|.||++...+++++||||.| |..|+..| +.||+||..|.....+.
T Consensus 24 ~~C~IC~~~~~~~~~~~CgH~f-C~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i~ 75 (79)
T d1fbva4 24 QLCKICAENDKDVKIEPCGHLM-CTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75 (79)
T ss_dssp TBCTTTSSSBCCEECSSSCCEE-CHHHHHHHHHTTCCSCTTTCCCCCCCCCSS
T ss_pred CCCccCCCcCCCeEEeCCCCee-eHHHHHHHHHHCcCcCCCCCcCccCCceee
Confidence 3799999999999999999998 99999877 47999999998876654
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|