Citrus Sinensis ID: 019226


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340----
MASTVILSQTATLSSSSSSTTTTAKFSSLTHNPIFHTNALRFKSNKKPLSLSLTRKALRVSASSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVVAAS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHccccccccccHHHHHccHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEEccHHHHHHHHHcccEEEEEccccccccccccccEEEcccccccHHHHHHHHHHHHHcc
ccHHHHHHHHHHHcccccccccccccccccccccccHHHHHccccccccccccccccccccccccccEEEEEEcccEEEccHHHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHcccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccHHHHHEEEEcccccccHcHHccccccccccEEEEEcccccccccccHHHHHHHHHHccccHcHEEEEEccHHHHHHHHHcccEEEEEcccccccccHHHccEEEcccccccHHHHHHHHHHHHccc
MASTVILSQtatlssssssttttakfsslthnpifhtnalrfksnkkplslsLTRKALRVSASSQSLQALIFDCDGVIIESEHLHRQAYNDAFshfnvrcdpssqqslnwdpeFYDVLQnqigggkpkMRWYfkehgwpsstifdnppvtdddqAKLIDLIQDWKTERYQQIIKsgtveprpgvlRLMDEAKAAGKKVAVCSAATKSSVILCLENLigmerfegldcflADCQSYVLmtngtlmpnrvcvcahqgddvkqkkpdpsiYVTAAKRlgisekdclVVEDSVIGLQAATRAGMACVITYtsstaeqdFKDAIaiypdlsnvrLKDLELLLQNVVAAS
mastvilsqtatlsssssstTTTAKFSSLTHNPIFHtnalrfksnkkPLSLSLTRKALRVSASSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIiksgtveprpgvLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQgddvkqkkpdpSIYVTAAkrlgisekdcLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVVAAS
MASTVIlsqtatlssssssttttakfssltHNPIFHTNALRFKSNKKPLSLSLTRKALRVSASSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVVAAS
********************************PIFHTNALR************************SLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDV*******SIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVV***
*******************************************************************QALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVV***
*************************FSSLTHNPIFHTNALRFKSNKKPLSLSLTRKALRVSASSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEA**********SAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVVAAS
*******************************NPIFH**ALRF**********************QSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVVAAS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASTVILSQTATLSSSSSSTTTTAKFSSLTHNPIFHTNALRFKSNKKPLSLSLTRKALRVSASSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVVAAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query344 2.2.26 [Sep-21-2011]
P40119254 Protein CbbY, chromosomal yes no 0.613 0.830 0.281 6e-25
O33513227 Protein CbbY OS=Rhodobact yes no 0.616 0.933 0.332 9e-25
Q04541254 Protein CbbY, plasmid OS= yes no 0.622 0.842 0.292 2e-24
P95649230 Protein CbbY OS=Rhodobact yes no 0.598 0.895 0.285 2e-21
P54607220 Uncharacterized protein Y yes no 0.558 0.872 0.267 2e-11
P77475188 Fructose-1-phosphate phos N/A no 0.508 0.930 0.240 2e-09
P77366219 Beta-phosphoglucomutase O N/A no 0.558 0.876 0.247 5e-07
O06995226 Beta-phosphoglucomutase O no no 0.531 0.809 0.245 2e-06
Q9X0Y1216 Phosphorylated carbohydra yes no 0.543 0.865 0.238 8e-06
P65070262 Uncharacterized protein M yes no 0.627 0.824 0.229 9e-06
>sp|P40119|CBBYC_CUPNH Protein CbbY, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbYC PE=3 SV=3 Back     alignment and function desciption
 Score =  115 bits (287), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 127/270 (47%), Gaps = 59/270 (21%)

Query: 67  LQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGK 126
           +QALIFD DG + ++E  H QA+N AF+   +           WD   Y  L  ++ GGK
Sbjct: 1   MQALIFDVDGTLADTESAHLQAFNAAFAEVGL--------DWYWDAPLYTRLL-KVAGGK 51

Query: 127 PKMRWYFKEHGWPSSTIFDNPPVTDDDQAK------LIDLIQDWKTERYQQIIKSGTVEP 180
            ++  Y++              + D ++A+       ID +   KT  Y + + +G +  
Sbjct: 52  ERLMHYWR--------------MVDPEEARGCKVKETIDAVHAIKTRHYAERVGAGGLPL 97

Query: 181 RPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGME---RFEGLDCFLADCQSYVL 237
           RPG+ RL+DEA  AG  +A+ +  T +++   L+  +G +   RF      + D  +  +
Sbjct: 98  RPGIARLIDEAGEAGLPLAIATTTTPANLDALLQAPLGADWRRRF----AAIGDAGTTAI 153

Query: 238 MTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATR 297
                                  KKP P +Y+   +RLG+   DCL +EDS  GL+AA  
Sbjct: 154 -----------------------KKPAPDVYLAVLERLGLEGGDCLAIEDSANGLRAARA 190

Query: 298 AGMACVITYTSSTAEQDFKDAIAIYPDLSN 327
           AG+  V+T T+ +A+  F+ A+ + P L +
Sbjct: 191 AGIPTVVTPTAFSAQDSFEGALLVLPHLGD 220





Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (taxid: 381666)
>sp|O33513|CBBY_RHOCA Protein CbbY OS=Rhodobacter capsulatus GN=cbbY PE=3 SV=1 Back     alignment and function description
>sp|Q04541|CBBYP_CUPNH Protein CbbY, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbYP PE=3 SV=1 Back     alignment and function description
>sp|P95649|CBBY_RHOSH Protein CbbY OS=Rhodobacter sphaeroides GN=cbbY PE=3 SV=1 Back     alignment and function description
>sp|P54607|YHCW_BACSU Uncharacterized protein YhcW OS=Bacillus subtilis (strain 168) GN=yhcW PE=3 SV=1 Back     alignment and function description
>sp|P77475|YQAB_ECOLI Fructose-1-phosphate phosphatase YqaB OS=Escherichia coli (strain K12) GN=yqaB PE=1 SV=1 Back     alignment and function description
>sp|P77366|PGMB_ECOLI Beta-phosphoglucomutase OS=Escherichia coli (strain K12) GN=ycjU PE=1 SV=1 Back     alignment and function description
>sp|O06995|PGMB_BACSU Beta-phosphoglucomutase OS=Bacillus subtilis (strain 168) GN=yvdM PE=1 SV=1 Back     alignment and function description
>sp|Q9X0Y1|P1254_THEMA Phosphorylated carbohydrates phosphatase TM_1254 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1254 PE=1 SV=1 Back     alignment and function description
>sp|P65070|Y3433_MYCBO Uncharacterized protein Mb3433 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3433 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
255584279309 2-deoxyglucose-6-phosphate phosphatase, 0.889 0.990 0.691 1e-131
359496682328 PREDICTED: protein CbbY-like [Vitis vini 0.770 0.807 0.773 1e-125
356525461323 PREDICTED: protein CbbY, chromosomal-lik 0.781 0.832 0.747 1e-124
297802106314 hypothetical protein ARALYDRAFT_912489 [ 0.877 0.961 0.675 1e-124
356512689310 PREDICTED: protein CbbY, chromosomal-lik 0.735 0.816 0.769 1e-122
18420570316 haloacid dehalogenase-like hydrolase fam 0.834 0.908 0.694 1e-122
255639539310 unknown [Glycine max] 0.735 0.816 0.766 1e-122
22022552316 AT4g39970/T5J17_140 [Arabidopsis thalian 0.834 0.908 0.690 1e-122
21593238316 unknown [Arabidopsis thaliana] 0.834 0.908 0.687 1e-121
224093744261 predicted protein [Populus trichocarpa] 0.715 0.942 0.775 1e-120
>gi|255584279|ref|XP_002532876.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] gi|223527361|gb|EEF29505.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/344 (69%), Positives = 275/344 (79%), Gaps = 38/344 (11%)

Query: 3   STVILSQTATLSSSSSSTTTTAKFSSLTHNPIFHTNALR--FKSNKKPLSLSLTRKALRV 60
           ++++LSQ     S+ S    +  FS L+ +   H  ++R  F S +   SL  +     V
Sbjct: 2   ASMLLSQ-----SNLSPNPLSRSFSFLSKSQTLHFRSIRRSFPSRRSHQSLCFS-----V 51

Query: 61  SASSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQN 120
           SASS SL+ALIFDCDGVI+ESEHLHRQAYNDAF+HFNVRC  +S Q+L W P+FYDVLQN
Sbjct: 52  SASSASLEALIFDCDGVILESEHLHRQAYNDAFAHFNVRC--TSDQTLIWAPDFYDVLQN 109

Query: 121 QIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEP 180
           +IGGGKPKMRWYFKEHGWPSSTIF+ PP  D+ +A LID +QDWKTERY++IIKSGTV+P
Sbjct: 110 RIGGGKPKMRWYFKEHGWPSSTIFETPPEDDESRANLIDTLQDWKTERYKEIIKSGTVQP 169

Query: 181 RPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTN 240
           RPGVL+LMDEAKAAGKK+AVCSAATKSSVILCLENLIGMERF+GLDCFLA          
Sbjct: 170 RPGVLQLMDEAKAAGKKLAVCSAATKSSVILCLENLIGMERFQGLDCFLA---------- 219

Query: 241 GTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGM 300
                         GDDVK+KKPDPSIYVTA+K+LG+SEKDCLVVEDSVIGLQAAT+AGM
Sbjct: 220 --------------GDDVKEKKPDPSIYVTASKKLGVSEKDCLVVEDSVIGLQAATKAGM 265

Query: 301 ACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVVAAS 344
           +CVITYTSSTA+QDFKDAIA+YPDLSNVRLKDLELLLQNVVAAS
Sbjct: 266 SCVITYTSSTADQDFKDAIAMYPDLSNVRLKDLELLLQNVVAAS 309




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359496682|ref|XP_003635299.1| PREDICTED: protein CbbY-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356525461|ref|XP_003531343.1| PREDICTED: protein CbbY, chromosomal-like [Glycine max] Back     alignment and taxonomy information
>gi|297802106|ref|XP_002868937.1| hypothetical protein ARALYDRAFT_912489 [Arabidopsis lyrata subsp. lyrata] gi|297314773|gb|EFH45196.1| hypothetical protein ARALYDRAFT_912489 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356512689|ref|XP_003525049.1| PREDICTED: protein CbbY, chromosomal-like [Glycine max] Back     alignment and taxonomy information
>gi|18420570|ref|NP_568077.1| haloacid dehalogenase-like hydrolase family protein [Arabidopsis thaliana] gi|51969804|dbj|BAD43594.1| unnamed protein product [Arabidopsis thaliana] gi|51969872|dbj|BAD43628.1| unnamed protein product [Arabidopsis thaliana] gi|51970306|dbj|BAD43845.1| unnamed protein product [Arabidopsis thaliana] gi|332661747|gb|AEE87147.1| haloacid dehalogenase-like hydrolase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255639539|gb|ACU20064.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|22022552|gb|AAM83233.1| AT4g39970/T5J17_140 [Arabidopsis thaliana] gi|23505871|gb|AAN28795.1| At4g39970/T5J17_140 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21593238|gb|AAM65187.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224093744|ref|XP_002309972.1| predicted protein [Populus trichocarpa] gi|222852875|gb|EEE90422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query344
TAIR|locus:2140050316 AT4G39970 [Arabidopsis thalian 0.561 0.610 0.743 2.9e-114
TAIR|locus:2101165319 AT3G48420 [Arabidopsis thalian 0.517 0.557 0.34 7.4e-40
TIGR_CMR|BA_4427221 BA_4427 "hydrolase, haloacid d 0.238 0.371 0.329 3.1e-14
TIGR_CMR|GSU_1839228 GSU_1839 "hydrolase, haloacid 0.232 0.350 0.329 1.1e-12
TAIR|locus:2153348372 AT5G45170 "AT5G45170" [Arabido 0.453 0.419 0.271 8.5e-12
TAIR|locus:2010728 1055 AT1G56500 [Arabidopsis thalian 0.223 0.072 0.375 2.3e-11
UNIPROTKB|Q9KN63219 VC_A0102 "CbbY family protein" 0.133 0.210 0.5 1.5e-10
TIGR_CMR|VC_A0102219 VC_A0102 "haloacid dehalogenas 0.133 0.210 0.5 1.5e-10
TIGR_CMR|SO_0431217 SO_0431 "HAD-superfamily hydro 0.122 0.193 0.428 2.7e-10
UNIPROTKB|P77475188 yqaB [Escherichia coli K-12 (t 0.139 0.255 0.437 3.1e-10
TAIR|locus:2140050 AT4G39970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 764 (274.0 bits), Expect = 2.9e-114, Sum P(2) = 2.9e-114
 Identities = 148/199 (74%), Positives = 170/199 (85%)

Query:    33 PIFHTNALRFKSNKKPLSLSLTRKALRVSASS-QSLQALIFDCDGVIIESEHLHRQAYND 91
             P F T  LRFKS       S +R +  VSA   +SL+ALIFDCDGVI+ESE+LHRQAYND
Sbjct:    33 PRFQT--LRFKSRSV---YSKSRVSSPVSALPLRSLEALIFDCDGVILESENLHRQAYND 87

Query:    92 AFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTD 151
             AFSHF+VRC PSS +SL+W  EFYD  QN +GGGKPKMRWYFKE+GWP+STIFD+PP  D
Sbjct:    88 AFSHFDVRCPPSSSESLDWSLEFYDKFQNLVGGGKPKMRWYFKENGWPTSTIFDSPPQND 147

Query:   152 DDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVIL 211
             DD+AKLID +QDWKTERY++IIKSG+VEPRPGV+RLMDEAKAAGKK+AVCSAATKSSVIL
Sbjct:   148 DDRAKLIDTLQDWKTERYKEIIKSGSVEPRPGVIRLMDEAKAAGKKLAVCSAATKSSVIL 207

Query:   212 CLENLIGMERFEGLDCFLA 230
             CLENLI +ERF+GLDCFLA
Sbjct:   208 CLENLIDIERFQGLDCFLA 226


GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=IEA;ISS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
TAIR|locus:2101165 AT3G48420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4427 BA_4427 "hydrolase, haloacid dehalogenase-like family" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1839 GSU_1839 "hydrolase, haloacid dehalogenase-like family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2153348 AT5G45170 "AT5G45170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010728 AT1G56500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KN63 VC_A0102 "CbbY family protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0102 VC_A0102 "haloacid dehalogenase/epoxide hydrolase family protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0431 SO_0431 "HAD-superfamily hydrolase, subfamily IA, variant 3 protein family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|P77475 yqaB [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
PLN02779286 PLN02779, PLN02779, haloacid dehalogenase-like hyd 1e-147
COG0637221 COG0637, COG0637, Predicted phosphatase/phosphohex 6e-37
TIGR02009185 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase f 8e-26
TIGR01990185 TIGR01990, bPGM, beta-phosphoglucomutase 1e-19
COG0546220 COG0546, Gph, Predicted phosphatases [General func 6e-19
TIGR01509177 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase sup 9e-19
pfam00702187 pfam00702, Hydrolase, haloacid dehalogenase-like h 4e-17
pfam13419176 pfam13419, HAD_2, Haloacid dehalogenase-like hydro 1e-15
PLN02919 1057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 6e-15
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 4e-12
PRK10826222 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; 5e-12
PLN02940 382 PLN02940, PLN02940, riboflavin kinase 1e-10
COG1011229 COG1011, COG1011, Predicted hydrolase (HAD superfa 2e-10
PRK10725188 PRK10725, PRK10725, fructose-1-P/6-phosphogluconat 3e-10
TIGR01449213 TIGR01449, PGP_bact, 2-phosphoglycolate phosphatas 9e-10
pfam1324274 pfam13242, Hydrolase_like, HAD-hyrolase-like 2e-09
PRK13222226 PRK13222, PRK13222, phosphoglycolate phosphatase; 2e-07
PLN02811220 PLN02811, PLN02811, hydrolase 2e-06
PRK11587218 PRK11587, PRK11587, putative phosphatase; Provisio 2e-06
PRK10563221 PRK10563, PRK10563, 6-phosphogluconate phosphatase 6e-06
PRK13226229 PRK13226, PRK13226, phosphoglycolate phosphatase; 2e-05
PRK10725188 PRK10725, PRK10725, fructose-1-P/6-phosphogluconat 5e-05
PLN03243260 PLN03243, PLN03243, haloacid dehalogenase-like hyd 5e-05
PRK13223272 PRK13223, PRK13223, phosphoglycolate phosphatase; 6e-05
TIGR02253221 TIGR02253, CTE7, HAD superfamily (subfamily IA) hy 1e-04
TIGR01549162 TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase sup 2e-04
PLN02770248 PLN02770, PLN02770, haloacid dehalogenase-like hyd 3e-04
TIGR01454205 TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic 8e-04
COG0647269 COG0647, NagD, Predicted sugar phosphatases of the 0.001
PRK10563221 PRK10563, PRK10563, 6-phosphogluconate phosphatase 0.003
TIGR01656147 TIGR01656, Histidinol-ppas, histidinol-phosphate p 0.003
PLN02575381 PLN02575, PLN02575, haloacid dehalogenase-like hyd 0.004
>gnl|CDD|215416 PLN02779, PLN02779, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
 Score =  416 bits (1071), Expect = e-147
 Identities = 131/315 (41%), Positives = 182/315 (57%), Gaps = 39/315 (12%)

Query: 35  FHTNALRFKSNKKPLSLSLTRKALRV----SASSQSLQALIFDCDGVIIESE-HLHRQAY 89
             +  L   S  +       R         +++S   +AL+FDCDGV++E+E   HR A+
Sbjct: 4   SSSARLASASRTRAGRRRRRRSRSTARVASASASALPEALLFDCDGVLVETERDGHRVAF 63

Query: 90  NDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSSTIFDNPPV 149
           NDAF  F +R        + WD E YD L N IGGGK +M WYF E+GWP+STI +  P 
Sbjct: 64  NDAFKEFGLR-------PVEWDVELYDELLN-IGGGKERMTWYFNENGWPTSTI-EKAPK 114

Query: 150 TDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSV 209
            ++++ +L+D + D KTE ++++I+SG +  RPGVLRLMDEA AAG KVAVCS + + +V
Sbjct: 115 DEEERKELVDSLHDRKTELFKELIESGALPLRPGVLRLMDEALAAGIKVAVCSTSNEKAV 174

Query: 210 ILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYV 269
              +  L+G ER +GLD F                          GDDV +KKPDP IY 
Sbjct: 175 SKIVNTLLGPERAQGLDVFA-------------------------GDDVPKKKPDPDIYN 209

Query: 270 TAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTSSTAEQDFKDAIAIYPDLSNVR 329
            AA+ LG+    C+VVEDSVIGLQAA  AGM C++T +S TA++DF  A A++  L +V 
Sbjct: 210 LAAETLGVDPSRCVVVEDSVIGLQAAKAAGMRCIVTKSSYTADEDFSGADAVFDCLGDVP 269

Query: 330 LKDLELLLQNVVAAS 344
           L+D +LL    +   
Sbjct: 270 LEDFDLLFCESLLTK 284


Length = 286

>gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213673 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>gnl|CDD|213672 TIGR01990, bPGM, beta-phosphoglucomutase Back     alignment and domain information
>gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|233443 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|236770 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|178528 PLN02940, PLN02940, riboflavin kinase Back     alignment and domain information
>gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|182679 PRK10725, PRK10725, fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|130516 TIGR01449, PGP_bact, 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like Back     alignment and domain information
>gnl|CDD|237310 PRK13222, PRK13222, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|178407 PLN02811, PLN02811, hydrolase Back     alignment and domain information
>gnl|CDD|183215 PRK11587, PRK11587, putative phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|182552 PRK10563, PRK10563, 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|237311 PRK13226, PRK13226, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|182679 PRK10725, PRK10725, fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215644 PLN03243, PLN03243, haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|171912 PRK13223, PRK13223, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>gnl|CDD|233463 TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>gnl|CDD|215413 PLN02770, PLN02770, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|130521 TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|182552 PRK10563, PRK10563, 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233512 TIGR01656, Histidinol-ppas, histidinol-phosphate phosphatase family domain Back     alignment and domain information
>gnl|CDD|215313 PLN02575, PLN02575, haloacid dehalogenase-like hydrolase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 344
PLN02779286 haloacid dehalogenase-like hydrolase family protei 100.0
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.97
PLN02575381 haloacid dehalogenase-like hydrolase 99.97
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.97
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.96
PRK13288214 pyrophosphatase PpaX; Provisional 99.96
PRK13226229 phosphoglycolate phosphatase; Provisional 99.96
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.96
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.96
COG0546220 Gph Predicted phosphatases [General function predi 99.96
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.96
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.96
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.96
PRK11587218 putative phosphatase; Provisional 99.96
PLN02940 382 riboflavin kinase 99.95
PRK13223272 phosphoglycolate phosphatase; Provisional 99.95
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.95
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.95
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.95
PRK13222226 phosphoglycolate phosphatase; Provisional 99.95
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.94
PRK13225273 phosphoglycolate phosphatase; Provisional 99.94
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.94
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.94
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.94
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.94
PRK09449224 dUMP phosphatase; Provisional 99.94
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.94
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.93
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.93
PRK14988224 GMP/IMP nucleotidase; Provisional 99.93
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.93
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.92
PLN02811220 hydrolase 99.92
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.91
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.91
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.9
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.89
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.89
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.89
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.88
PHA02597197 30.2 hypothetical protein; Provisional 99.88
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 99.88
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.88
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.84
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 99.84
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.82
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.82
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.82
PLN02954224 phosphoserine phosphatase 99.82
PRK06769173 hypothetical protein; Validated 99.82
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.81
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.81
PRK11133322 serB phosphoserine phosphatase; Provisional 99.8
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.77
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.77
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 99.77
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.76
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 99.76
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 99.74
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 99.73
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.72
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.71
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 99.69
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.68
PRK10444248 UMP phosphatase; Provisional 99.68
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.68
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 99.67
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 99.66
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.65
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.65
COG0647269 NagD Predicted sugar phosphatases of the HAD super 99.64
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.62
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.61
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 99.6
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.58
PLN02645311 phosphoglycolate phosphatase 99.57
PHA02530300 pseT polynucleotide kinase; Provisional 99.57
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 99.56
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 99.56
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.56
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 99.55
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 99.54
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.54
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 99.52
PRK11590211 hypothetical protein; Provisional 99.5
COG0241181 HisB Histidinol phosphatase and related phosphatas 99.49
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.49
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 99.46
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 99.46
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 99.42
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 99.42
PRK01158230 phosphoglycolate phosphatase; Provisional 99.4
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 99.39
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 99.38
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 99.38
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 99.37
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 99.37
PRK08238 479 hypothetical protein; Validated 99.35
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.33
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.33
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.32
PRK10513270 sugar phosphate phosphatase; Provisional 99.27
COG4229229 Predicted enolase-phosphatase [Energy production a 99.27
PTZ00445219 p36-lilke protein; Provisional 99.26
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 99.24
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 99.22
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 99.22
PLN02887580 hydrolase family protein 99.21
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 99.21
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 99.19
PRK10976266 putative hydrolase; Provisional 99.18
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 99.16
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 99.15
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 99.14
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.12
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 99.05
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 99.04
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 99.03
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 99.0
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 98.96
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 98.96
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 98.95
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 98.95
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 98.93
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 98.93
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 98.89
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.87
COG4359220 Uncharacterized conserved protein [Function unknow 98.85
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 98.78
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 98.73
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 98.67
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 98.63
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 98.61
PHA03398303 viral phosphatase superfamily protein; Provisional 98.56
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 98.55
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 98.53
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.53
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 98.46
PLN02382 413 probable sucrose-phosphatase 98.41
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 98.36
KOG2630254 consensus Enolase-phosphatase E-1 [Amino acid tran 98.36
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 98.33
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 98.32
PRK10671834 copA copper exporting ATPase; Provisional 98.31
COG4087152 Soluble P-type ATPase [General function prediction 98.3
TIGR01675229 plant-AP plant acid phosphatase. This model explic 98.29
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 98.27
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 98.27
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.26
COG4996164 Predicted phosphatase [General function prediction 98.25
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 98.2
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 98.19
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 98.17
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 98.13
PTZ00174247 phosphomannomutase; Provisional 98.13
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 98.12
PLN02423245 phosphomannomutase 98.04
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 98.02
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 97.86
PF05761448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 97.75
TIGR01497 675 kdpB K+-transporting ATPase, B subunit. One sequen 97.69
PLN02177 497 glycerol-3-phosphate acyltransferase 97.68
COG3700237 AphA Acid phosphatase (class B) [General function 97.65
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 97.63
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 97.6
PRK01122 679 potassium-transporting ATPase subunit B; Provision 97.57
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 97.53
PRK14010 673 potassium-transporting ATPase subunit B; Provision 97.49
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 97.42
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 97.41
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 97.39
PLN02645 311 phosphoglycolate phosphatase 97.36
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 97.35
PRK15122 903 magnesium-transporting ATPase; Provisional 97.3
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 97.3
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 97.27
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 97.26
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 97.2
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 97.18
COG5663194 Uncharacterized conserved protein [Function unknow 97.18
COG2503274 Predicted secreted acid phosphatase [General funct 97.16
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 97.1
PF06437408 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 97.1
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 97.08
COG5610 635 Predicted hydrolase (HAD superfamily) [General fun 97.06
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 96.79
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 96.75
TIGR01658274 EYA-cons_domain eyes absent protein conserved doma 96.57
KOG2470510 consensus Similar to IMP-GMP specific 5'-nucleotid 96.57
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 96.54
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 96.28
KOG3107468 consensus Predicted haloacid dehalogenase-like hyd 96.27
COG0647269 NagD Predicted sugar phosphatases of the HAD super 96.2
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 96.16
COG4030315 Uncharacterized protein conserved in archaea [Func 96.13
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 96.12
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 96.05
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 96.01
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 95.92
PLN02151354 trehalose-phosphatase 95.84
PLN03190 1178 aminophospholipid translocase; Provisional 95.78
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 95.77
PF05822246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 95.68
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 95.39
KOG2134 422 consensus Polynucleotide kinase 3' phosphatase [Re 94.64
COG2216 681 KdpB High-affinity K+ transport system, ATPase cha 94.14
PLN03017366 trehalose-phosphatase 94.05
KOG0206 1151 consensus P-type ATPase [General function predicti 93.71
KOG1618 389 consensus Predicted phosphatase [General function 93.68
PRK10444248 UMP phosphatase; Provisional 93.63
PLN02499 498 glycerol-3-phosphate acyltransferase 93.53
PLN02580384 trehalose-phosphatase 93.5
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 92.19
KOG2469424 consensus IMP-GMP specific 5'-nucleotidase [Nucleo 91.24
COG4502180 5'(3')-deoxyribonucleotidase [Nucleotide transport 90.9
KOG3128298 consensus Uncharacterized conserved protein [Funct 90.18
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 90.15
KOG2882 306 consensus p-Nitrophenyl phosphatase [Inorganic ion 89.07
PLN02580384 trehalose-phosphatase 88.89
KOG0210 1051 consensus P-type ATPase [Inorganic ion transport a 88.72
KOG0204 1034 consensus Calcium transporting ATPase [Inorganic i 88.39
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 88.25
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 87.37
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 86.92
KOG2116738 consensus Protein involved in plasmid maintenance/ 86.04
PF06189264 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 85.7
CHL00162267 thiG thiamin biosynthesis protein G; Validated 85.59
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 85.42
PRK10513270 sugar phosphate phosphatase; Provisional 84.36
PF02358235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 83.57
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 83.4
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 82.91
KOG0209 1160 consensus P-type ATPase [Inorganic ion transport a 81.25
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 81.06
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 80.43
PRK10976266 putative hydrolase; Provisional 80.39
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
Probab=100.00  E-value=5.9e-33  Score=254.89  Aligned_cols=242  Identities=53%  Similarity=0.923  Sum_probs=186.5

Q ss_pred             CCCCccEEEEecCccccccc-hhHHHHHHHHHHhcCCCCCCCccCCCCCChHHHHHHHHhhCCChhhHHHHHHHcCCCCc
Q 019226           63 SSQSLQALIFDCDGVIIESE-HLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRWYFKEHGWPSS  141 (344)
Q Consensus        63 ~~~~~k~viFD~DGTL~d~~-~~~~~a~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~  141 (344)
                      ....+++|||||||||+|+. ..+.++|.+++.++|++..       .|..+.+..+.. +|.+...+.+++...+++..
T Consensus        36 ~~~~~k~VIFDlDGTLvDS~~~~~~~a~~~~l~~~G~~~~-------~~~~~~~~~~~~-~g~~~~~~~~~~~~~~~~~~  107 (286)
T PLN02779         36 ASALPEALLFDCDGVLVETERDGHRVAFNDAFKEFGLRPV-------EWDVELYDELLN-IGGGKERMTWYFNENGWPTS  107 (286)
T ss_pred             cccCCcEEEEeCceeEEccccHHHHHHHHHHHHHcCCCCC-------CCCHHHHHHHHc-cCCChHHHHHHHHHcCCCcc
Confidence            34568999999999999999 9999999999999998421       133444444444 67666666666666666533


Q ss_pred             cccCCCCCCchhHHHHHHHHHHHHHHHHHHHHHhCCCccCccHHHHHHHHHHcCCeEEEEeCCChhhHHHHHHHhhccch
Q 019226          142 TIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMER  221 (344)
Q Consensus       142 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~pgv~~~l~~Lk~~g~~v~ivTn~~~~~~~~~l~~l~~~~~  221 (344)
                      +. ...+..++..++..+.+.+.+.+.|...+....+.++||+.++|+.|+++|++++|+||+....+...++.+.+...
T Consensus       108 ~~-~~~~~~~e~~~~~~~~~~~~~~~~y~~~~~~~~~~l~pGv~elL~~L~~~g~~l~IvTn~~~~~~~~~l~~~~~~~~  186 (286)
T PLN02779        108 TI-EKAPKDEEERKELVDSLHDRKTELFKELIESGALPLRPGVLRLMDEALAAGIKVAVCSTSNEKAVSKIVNTLLGPER  186 (286)
T ss_pred             cc-ccCCccchhhHHHHHHHHHHHHHHHHHHHHhcCCCchhhHHHHHHHHHHCCCeEEEEeCCCHHHHHHHHHHhccccc
Confidence            22 11222233334445556666666777665544568999999999999999999999999999888888877532233


Q ss_pred             hcccceeecccchhhhhccCCcCCccccccccCCCCCCCCCCCHHHHHHHHHHcCCCCCcEEEEecCHhhHHHHHHcCCe
Q 019226          222 FEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMA  301 (344)
Q Consensus       222 ~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KP~~~~~~~~~~~lgv~~~~~i~vGDs~~Di~~a~~aG~~  301 (344)
                      +..++.+ .                        +++++..||+|++|..+++++|++|++|+||||+.+|+++|+++||.
T Consensus       187 ~~~~~~v-~------------------------~~~~~~~KP~p~~~~~a~~~~~~~p~~~l~IGDs~~Di~aA~~aG~~  241 (286)
T PLN02779        187 AQGLDVF-A------------------------GDDVPKKKPDPDIYNLAAETLGVDPSRCVVVEDSVIGLQAAKAAGMR  241 (286)
T ss_pred             cCceEEE-e------------------------ccccCCCCCCHHHHHHHHHHhCcChHHEEEEeCCHHhHHHHHHcCCE
Confidence            3223444 5                        78888899999999999999999999999999999999999999999


Q ss_pred             EEEEeCCCchhhhccccccccCCccccCHHHHHHHHH
Q 019226          302 CVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQ  338 (344)
Q Consensus       302 ~v~v~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~ll~  338 (344)
                      +|++.++....+.+..++++++++.++...++..++-
T Consensus       242 ~i~v~~g~~~~~~l~~ad~vi~~~~~l~~~~~~~~~~  278 (286)
T PLN02779        242 CIVTKSSYTADEDFSGADAVFDCLGDVPLEDFDLLFC  278 (286)
T ss_pred             EEEEccCCccccccCCCcEEECChhhcchhhhHHHHH
Confidence            9999888776666777899999999999999987754



>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR01658 EYA-cons_domain eyes absent protein conserved domain Back     alignment and domain information
>KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG3107 consensus Predicted haloacid dehalogenase-like hydrolase (eyes absent) [General function prediction only] Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>KOG0206 consensus P-type ATPase [General function prediction only] Back     alignment and domain information
>KOG1618 consensus Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2469 consensus IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3128 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] Back     alignment and domain information
>PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
3e58_A214 Crystal Structure Of Putative Beta-Phosphoglucomuta 5e-09
4g9b_A243 Crystal Structure Of Beta-Phosphoglucomutase Homolo 4e-08
3nas_A233 The Crystal Structure Of Beta-Phosphoglucomutase Fr 3e-07
3dv9_A247 Putative Beta-Phosphoglucomutase From Bacteroides V 5e-07
3kbb_A216 Crystal Structure Of Putative Beta-Phosphoglucomuta 9e-07
4gib_A250 2.27 Angstrom Crystal Structure Of Beta-Phosphogluc 6e-06
3quq_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 7e-06
3r9k_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 9e-06
3qyp_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 1e-05
3qub_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 2e-05
3qu5_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 2e-05
3qut_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 2e-05
1o03_A221 Structure Of Pentavalent Phosphorous Intermediate O 3e-05
3fm9_A221 Analysis Of The Structural Determinants Underlying 3e-05
1lvh_A221 The Structure Of Phosphorylated Beta-phosphoglucomu 3e-05
3qu4_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 5e-05
3l5k_A250 The Crystal Structure Of Human Haloacid Dehalogenas 2e-04
3s6j_A233 The Crystal Structure Of A Hydrolase From Pseudomon 5e-04
>pdb|3E58|A Chain A, Crystal Structure Of Putative Beta-Phosphoglucomutase From Streptococcus Thermophilus Length = 214 Back     alignment and structure

Iteration: 1

Score = 58.5 bits (140), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 56/246 (22%), Positives = 105/246 (42%), Gaps = 75/246 (30%) Query: 63 SSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWD---PEFYDVLQ 119 S+ ++A+IFD DGV+ ++E + ++ R Q+ ++ D P F+ Sbjct: 1 SNAXVEAIIFDXDGVLFDTEKYY----------YDRRASFLGQKGISIDHLPPSFFI--- 47 Query: 120 NQIGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTER------YQQII 173 GG K W +N + D+ + L +++ T + Y+++I Sbjct: 48 ----GGNTKQVW-------------ENILRDEYDKWDVSTLQEEYNTYKQNNPLPYKELI 90 Query: 174 KSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGL-DCFLADC 232 P VL++++E K+ G ++ + S++ K+ + LE R +G D L+ Sbjct: 91 -------FPDVLKVLNEVKSQGLEIGLASSSVKADIFRALEE----NRLQGFFDIVLS-- 137 Query: 233 QSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGL 292 G++ K+ KP+P IY+TA K+L + L++EDS G+ Sbjct: 138 ----------------------GEEFKESKPNPEIYLTALKQLNVQASRALIIEDSEKGI 175 Query: 293 QAATRA 298 A A Sbjct: 176 AAGVAA 181
>pdb|4G9B|A Chain A, Crystal Structure Of Beta-Phosphoglucomutase Homolog From Escherichia Coli, Target Efi-501172, With Bound Mg, Open Lid Length = 243 Back     alignment and structure
>pdb|3NAS|A Chain A, The Crystal Structure Of Beta-Phosphoglucomutase From Bacillus Subtilis Length = 233 Back     alignment and structure
>pdb|3DV9|A Chain A, Putative Beta-Phosphoglucomutase From Bacteroides Vulgatus Length = 247 Back     alignment and structure
>pdb|3KBB|A Chain A, Crystal Structure Of Putative Beta-Phosphoglucomutase From Thermotoga Maritima Length = 216 Back     alignment and structure
>pdb|4GIB|A Chain A, 2.27 Angstrom Crystal Structure Of Beta-Phosphoglucomutase (Pgmb) From Clostridium Difficile Length = 250 Back     alignment and structure
>pdb|3QUQ|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, An Open Cap Conformation Length = 243 Back     alignment and structure
>pdb|3R9K|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47asp Mutant Complexed With Sulfate, A Closed Cap Conformation Length = 243 Back     alignment and structure
>pdb|3QYP|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47asn Mutant Complexed With Calcium And Phosphate Length = 243 Back     alignment and structure
>pdb|3QUB|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47ala Mutant Complexed With Sulfate Length = 243 Back     alignment and structure
>pdb|3QU5|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp11asn Mutant Length = 243 Back     alignment and structure
>pdb|3QUT|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp13asn Mutant, An Open Cap Conformation Length = 243 Back     alignment and structure
>pdb|1O03|A Chain A, Structure Of Pentavalent Phosphorous Intermediate Of An Enzyme Catalyzed Phosphoryl Transfer Reaction Observed On Cocrystallization With Glucose 6-Phosphate Length = 221 Back     alignment and structure
>pdb|3FM9|A Chain A, Analysis Of The Structural Determinants Underlying Discrimination Between Substrate And Solvent In Beta- Phosphoglucomutase Catalysis Length = 221 Back     alignment and structure
>pdb|1LVH|A Chain A, The Structure Of Phosphorylated Beta-phosphoglucomutase From Lactoccocus Lactis To 2.3 Angstrom Resolution Length = 221 Back     alignment and structure
>pdb|3QU4|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp13ala Mutant Length = 243 Back     alignment and structure
>pdb|3L5K|A Chain A, The Crystal Structure Of Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 1a (Hdhd1a) Length = 250 Back     alignment and structure
>pdb|3S6J|A Chain A, The Crystal Structure Of A Hydrolase From Pseudomonas Syringae Length = 233 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query344
1te2_A226 Putative phosphatase; structural genomics, phospha 2e-52
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 3e-49
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 1e-48
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 1e-48
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 2e-48
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 8e-48
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 1e-47
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 3e-47
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 3e-46
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 2e-45
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 1e-40
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 1e-37
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 9e-36
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 2e-31
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 8e-26
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 3e-20
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 1e-18
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 5e-18
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 7e-18
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 3e-17
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 1e-16
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 1e-16
2hsz_A243 Novel predicted phosphatase; structural genomics, 5e-15
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 8e-15
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 9e-15
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 1e-13
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 3e-13
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 3e-13
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 4e-13
3sd7_A240 Putative phosphatase; structural genomics, haloaci 7e-13
2zg6_A220 Putative uncharacterized protein ST2620, probable 2e-12
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 3e-12
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 5e-12
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 8e-12
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 1e-11
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 2e-11
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 4e-11
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 8e-11
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 9e-11
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 1e-09
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 2e-09
3ib6_A189 Uncharacterized protein; structural genomics, unkn 2e-07
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 4e-07
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 8e-07
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 2e-06
2p11_A231 Hypothetical protein; putative haloacid dehalogena 5e-06
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 9e-06
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 1e-05
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 2e-05
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 2e-05
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 5e-05
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 6e-05
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 1e-04
2o2x_A218 Hypothetical protein; structural genomics, joint c 2e-04
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 4e-04
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 4e-04
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 5e-04
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 6e-04
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 7e-04
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 8e-04
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 8e-04
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 9e-04
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 Back     alignment and structure
 Score =  171 bits (436), Expect = 2e-52
 Identities = 49/273 (17%), Positives = 94/273 (34%), Gaps = 55/273 (20%)

Query: 62  ASSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQ 121
           ++ + + A IFD DG++I+SE L  +A  D  +   V          +      + L + 
Sbjct: 4   STPRQILAAIFDMDGLLIDSEPLWDRAELDVMASLGV----------DISRR--NELPDT 51

Query: 122 IGGGKPKMRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPR 181
           +G     +   +              P     + ++++        R   +++       
Sbjct: 52  LGLRIDMVVDLWYAR----------QPWNGPSRQEVVE----RVIARAISLVEET-RPLL 96

Query: 182 PGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNG 241
           PGV   +   K  G  V + SA+    +   L      + F+                  
Sbjct: 97  PGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSFD------------------ 138

Query: 242 TLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMA 301
                         + +   KP P +Y+  A +LG+    C+ +EDSV G+ A+  A M 
Sbjct: 139 ------ALAS---AEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMR 189

Query: 302 CV-ITYTSSTAEQDFKDAIAIYPDLSNVRLKDL 333
            + +    +  +  F  A      L+ +  KDL
Sbjct: 190 SIVVPAPEAQNDPRFVLANVKLSSLTELTAKDL 222


>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Length = 250 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Length = 275 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Length = 229 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} Length = 277 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Length = 267 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Length = 234 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Length = 209 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Length = 196 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Length = 243 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Length = 240 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Length = 222 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Length = 240 Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Length = 200 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Length = 261 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Length = 229 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 210 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Length = 206 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Length = 282 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Length = 211 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Length = 240 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Length = 260 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Length = 232 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Length = 231 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Length = 253 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} Length = 240 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Length = 253 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Length = 179 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Length = 218 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Length = 211 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Length = 251 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.98
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.98
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.97
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.96
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.96
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.96
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.96
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.96
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.96
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.96
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.96
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.96
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.95
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.95
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.95
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.95
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.95
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.95
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.95
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.95
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.95
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.95
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.95
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.95
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.95
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.94
1te2_A226 Putative phosphatase; structural genomics, phospha 99.94
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.94
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.94
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.94
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.93
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.93
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.93
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.93
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.93
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.93
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.93
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.93
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.93
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.93
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.92
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.92
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.92
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.92
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.92
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.92
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.92
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.92
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.91
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.91
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.91
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.91
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.91
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.91
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.9
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.9
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.9
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.9
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.89
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.89
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.88
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.88
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.87
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.87
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.87
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.87
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.86
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.85
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.85
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.85
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.83
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.83
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.82
3fvv_A232 Uncharacterized protein; unknown function, structu 99.82
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.81
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.81
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.81
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.8
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.8
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.79
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.79
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.79
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.79
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.78
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 99.78
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.78
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 99.77
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.76
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.76
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 99.76
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.76
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.76
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.72
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.72
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.71
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.71
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.71
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.7
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.7
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.7
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.7
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.69
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.69
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.68
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.68
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 99.67
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.67
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 99.65
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.65
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.63
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.63
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.62
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 99.62
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.62
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 99.61
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 99.39
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.58
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 99.56
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 99.56
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.55
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.54
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.52
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.5
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.48
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.41
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 99.38
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 99.38
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.37
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 99.35
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 99.32
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 99.2
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 99.19
1y8a_A332 Hypothetical protein AF1437; structural genomics, 99.15
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 99.1
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 99.08
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 98.99
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 98.94
4gxt_A385 A conserved functionally unknown protein; structur 98.93
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 98.87
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 98.85
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 98.8
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 98.74
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 98.7
2jc9_A 555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 98.61
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 98.42
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 98.24
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 98.13
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 98.07
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 98.04
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 98.0
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 97.93
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 97.92
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 97.79
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 97.78
4g63_A 470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 97.72
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 97.59
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 97.56
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 97.5
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 97.41
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 97.4
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 97.26
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 96.92
3geb_A274 EYES absent homolog 2; hydrolase, activator, alter 91.79
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 91.17
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 91.08
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 89.56
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 88.64
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 87.08
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 86.5
2q5c_A196 NTRC family transcriptional regulator; structural 82.41
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
Probab=99.98  E-value=3.6e-31  Score=236.44  Aligned_cols=220  Identities=24%  Similarity=0.378  Sum_probs=168.4

Q ss_pred             CCCCccEEEEecCccccccchhHHHHHHHHHHhcCCCCCCCccCCCCCChHHHHHHHHhhCCChhhH-HHHHHHcCCCCc
Q 019226           63 SSQSLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKM-RWYFKEHGWPSS  141 (344)
Q Consensus        63 ~~~~~k~viFD~DGTL~d~~~~~~~a~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~g~~~~  141 (344)
                      |+|.+|+|+||+||||+|+...+.++|++++.++|++.+.+.             .....|.+.... ..++...+....
T Consensus         1 M~MkiKaViFDlDGTL~Ds~~~~~~a~~~~~~~~g~~~~~~~-------------~~~~~g~~~~~~~~~~~~~~~~~~~   67 (243)
T 4g9b_A            1 MVMKLQGVIFDLDGVITDTAHLHFQAWQQIAAEIGISIDAQF-------------NESLKGISRDESLRRILQHGGKEGD   67 (243)
T ss_dssp             -CCCCCEEEECSBTTTBCCHHHHHHHHHHHHHHTTCCCCTTG-------------GGGGTTCCHHHHHHHHHHHTTCGGG
T ss_pred             CCccCcEEEEcCCCcccCCHHHHHHHHHHHHHHcCCCCCHHH-------------HHHHcCCCHHHHHHHHHHHhhcccc
Confidence            457899999999999999999999999999999998765421             233345554443 344444443211


Q ss_pred             cccCCCCCCchhHHHHHHHHHHHHHHHHHHHHHh-CCCccCccHHHHHHHHHHcCCeEEEEeCCChhhHHHHHHHhhccc
Q 019226          142 TIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKS-GTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGME  220 (344)
Q Consensus       142 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~-~~~~~~pgv~~~l~~Lk~~g~~v~ivTn~~~~~~~~~l~~l~~~~  220 (344)
                             .....    ...+.......+...+.. ....++||+.++++.|+++|++++++||+..  ....++.+ ++.
T Consensus        68 -------~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~pg~~~ll~~L~~~g~~i~i~t~~~~--~~~~l~~~-gl~  133 (243)
T 4g9b_A           68 -------FNSQE----RAQLAYRKNLLYVHSLRELTVNAVLPGIRSLLADLRAQQISVGLASVSLN--APTILAAL-ELR  133 (243)
T ss_dssp             -------CCHHH----HHHHHHHHHHHHHHHHHTCCGGGBCTTHHHHHHHHHHTTCEEEECCCCTT--HHHHHHHT-TCG
T ss_pred             -------hhHHH----HHHHHHHHHHHHHHHHHhcccccccccHHHHHHhhhcccccceecccccc--hhhhhhhh-hhc
Confidence                   11111    122223333333333332 2346899999999999999999999999765  56678886 777


Q ss_pred             hhcccceeecccchhhhhccCCcCCccccccccCCCCCCCCCCCHHHHHHHHHHcCCCCCcEEEEecCHhhHHHHHHcCC
Q 019226          221 RFEGLDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGM  300 (344)
Q Consensus       221 ~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KP~~~~~~~~~~~lgv~~~~~i~vGDs~~Di~~a~~aG~  300 (344)
                      .+  |+.+++                        +++++.+||+|++|..+++++|++|++|+||||+.+|+++|+++||
T Consensus       134 ~~--fd~i~~------------------------~~~~~~~KP~p~~~~~a~~~lg~~p~e~l~VgDs~~di~aA~~aG~  187 (243)
T 4g9b_A          134 EF--FTFCAD------------------------ASQLKNSKPDPEIFLAACAGLGVPPQACIGIEDAQAGIDAINASGM  187 (243)
T ss_dssp             GG--CSEECC------------------------GGGCSSCTTSTHHHHHHHHHHTSCGGGEEEEESSHHHHHHHHHHTC
T ss_pred             cc--cccccc------------------------cccccCCCCcHHHHHHHHHHcCCChHHEEEEcCCHHHHHHHHHcCC
Confidence            77  788888                        8999999999999999999999999999999999999999999999


Q ss_pred             eEEEEeCCCchhhhccccccccCCccccCHHHHHHHHHHhh
Q 019226          301 ACVITYTSSTAEQDFKDAIAIYPDLSNVRLKDLELLLQNVV  341 (344)
Q Consensus       301 ~~v~v~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~ll~~~~  341 (344)
                      .+|+|.++..      .++..++++.++.+.+|.++++++.
T Consensus       188 ~~I~V~~g~~------~ad~~~~~~~~l~~~~l~~~~~~l~  222 (243)
T 4g9b_A          188 RSVGIGAGLT------GAQLLLPSTESLTWPRLSAFWQNVA  222 (243)
T ss_dssp             EEEEESTTCC------SCSEEESSGGGCCHHHHHHHHHHHS
T ss_pred             EEEEECCCCC------cHHHhcCChhhcCHHHHHHHHHHHH
Confidence            9999988754      3567889999999999999998764



>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 344
d1cr6a1222 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal 2e-21
d1o08a_221 c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcu 3e-19
d1te2a_218 c.108.1.6 (A:) Phosphatase YniC {Escherichia coli 4e-17
d1zs9a1253 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien 1e-15
d1zd3a1225 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal 2e-15
d1swva_257 c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Ba 2e-15
d2fdra1222 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 { 1e-12
d2b0ca1197 c.108.1.2 (A:8-204) Putative phosphatase YihX {Esc 8e-12
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 1e-11
d2hcfa1228 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {C 2e-11
d2gfha1247 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatas 2e-11
d2g80a1225 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast 4e-11
d2go7a1204 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S 4e-11
d2hdoa1207 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase { 2e-10
d1qq5a_245 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan 5e-10
d2hsza1224 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase G 1e-08
d1zrna_220 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pse 1e-08
d2fi1a1187 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str 3e-08
d2feaa1226 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio 8e-08
d1u7pa_164 c.108.1.17 (A:) Magnesium-dependent phosphatase-1, 6e-07
d2ah5a1210 c.108.1.6 (A:1-210) predicted phosphatase SP0104 { 1e-06
d1x42a1230 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {A 3e-06
d2o2xa1209 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 5e-06
d1vjra_261 c.108.1.14 (A:) Hypothetical protein TM1742 {Therm 4e-05
d2fpwa1161 c.108.1.19 (A:3-163) Histidine biosynthesis bifunc 5e-05
d1yv9a1253 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En 1e-04
d1wvia_253 c.108.1.14 (A:) Putative phosphatase SMU.1415c {St 1e-04
d2c4na1250 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId 0.002
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: YihX-like
domain: Epoxide hydrolase, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 89.0 bits (219), Expect = 2e-21
 Identities = 28/253 (11%), Positives = 64/253 (25%), Gaps = 38/253 (15%)

Query: 69  ALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPK 128
              FD DGV+         A+  +     +              +F            P 
Sbjct: 2   VAAFDLDGVLALPSIAG--AFRRSEEALAL------------PRDFLLGAYQTEFPEGPT 47

Query: 129 MRWYFKEHGWPSSTIFDNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLM 188
            +    +  +       +       +A   +L +++   +      +        +L+  
Sbjct: 48  EQLMKGKITFSQWVPLMDESYRKSSKACGANLPENFSISQIFSQAMAAR-SINRPMLQAA 106

Query: 189 DEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEGLDCFLADCQSYVLMTNGTLMPNRV 248
              K  G    + +                    E    F                    
Sbjct: 107 IALKKKGFTTCIVTNNWLDDGDKRDSLA--QMMCELSQHF-------------------- 144

Query: 249 CVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVITYTS 308
                +   V   KP+P IY      L     + + ++D    L+ A   GM  ++ + +
Sbjct: 145 -DFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNT 203

Query: 309 STAEQDFKDAIAI 321
           ++A ++ +     
Sbjct: 204 ASALRELEKVTGT 216


>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Length = 221 Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Length = 257 Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Length = 222 Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Length = 197 Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Length = 228 Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Length = 247 Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 225 Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Length = 207 Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Length = 224 Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Length = 220 Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Length = 210 Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 230 Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Length = 209 Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Length = 261 Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query344
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.98
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.97
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.97
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.96
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.96
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.95
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.95
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.95
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.94
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.94
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.94
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.94
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.92
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.92
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.92
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.89
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.89
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.87
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.85
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.84
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.8
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.8
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.79
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.78
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 99.76
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.76
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 99.76
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.72
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.72
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.67
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.6
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.56
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 99.54
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.39
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.29
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 99.29
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.23
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.18
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 99.18
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 99.07
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 99.04
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 98.96
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.92
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 98.91
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 98.83
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.75
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 98.69
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 98.57
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 98.44
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 98.4
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 98.39
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 98.37
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.16
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 98.11
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 97.77
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.29
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.1
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 92.38
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 91.5
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 89.0
d1qyia_ 380 Hypothetical protein MW1667 (SA1546) {Staphylococc 85.83
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 82.67
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 82.16
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 80.79
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Phosphatase YniC
species: Escherichia coli [TaxId: 562]
Probab=99.98  E-value=2.9e-31  Score=230.24  Aligned_cols=214  Identities=23%  Similarity=0.366  Sum_probs=165.1

Q ss_pred             CccEEEEecCccccccchhHHHHHHHHHHhcCCCCCCCccCCCCCChHHHHHHHHhhCCChhhHHH-HHHHcCCCCcccc
Q 019226           66 SLQALIFDCDGVIIESEHLHRQAYNDAFSHFNVRCDPSSQQSLNWDPEFYDVLQNQIGGGKPKMRW-YFKEHGWPSSTIF  144 (344)
Q Consensus        66 ~~k~viFD~DGTL~d~~~~~~~a~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~g~~~~~~~  144 (344)
                      .+|+||||+||||+|+...+.+++.+++.++|++.+..            .++....+........ .....++.     
T Consensus         2 ~i~a~iFD~DGTL~dt~~~~~~a~~~~~~~~g~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~~~-----   64 (218)
T d1te2a_           2 QILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRR------------NELPDTLGLRIDMVVDLWYARQPWN-----   64 (218)
T ss_dssp             CCCEEEECCBTTTBCCHHHHHHHHHHHHHHTTCCGGGG------------GGSCCCTTCCHHHHHHHHHHHSCCS-----
T ss_pred             cceEEEECCCCcccCCHHHHHHHHHHHHHHcCCCCCHH------------HHHHHHhCCCccchhhhhhhccccc-----
Confidence            58999999999999999999999999999999875431            1223333333333222 22233332     


Q ss_pred             CCCCCCchhHHHHHHHHHHHHHHHHHHHHHhCCCccCccHHHHHHHHHHcCCeEEEEeCCChhhHHHHHHHhhccchhcc
Q 019226          145 DNPPVTDDDQAKLIDLIQDWKTERYQQIIKSGTVEPRPGVLRLMDEAKAAGKKVAVCSAATKSSVILCLENLIGMERFEG  224 (344)
Q Consensus       145 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~pgv~~~l~~Lk~~g~~v~ivTn~~~~~~~~~l~~l~~~~~~~~  224 (344)
                            ........+.+...+.+.+..     ...++||+.++|+.|+++|++++|+||+....++..++.+ ++..+  
T Consensus        65 ------~~~~~~~~~~~~~~~~~~~~~-----~~~~~pg~~~~l~~L~~~g~~~~i~T~~~~~~~~~~l~~~-~l~~~--  130 (218)
T d1te2a_          65 ------GPSRQEVVERVIARAISLVEE-----TRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMF-DLRDS--  130 (218)
T ss_dssp             ------SSCHHHHHHHHHHHHHHHHHH-----HCCBCTTHHHHHHHHHHTTCEEEEEESSCHHHHHHHHHHT-TCGGG--
T ss_pred             ------chhHHHHHHHHHHHHHHhhhc-----cccccchHHHHHHHhhhccccccccccccccccccccccc-ccccc--
Confidence                  122223333333333333322     2568999999999999999999999999999999999997 88777  


Q ss_pred             cceeecccchhhhhccCCcCCccccccccCCCCCCCCCCCHHHHHHHHHHcCCCCCcEEEEecCHhhHHHHHHcCCeEEE
Q 019226          225 LDCFLADCQSYVLMTNGTLMPNRVCVCAHQGDDVKQKKPDPSIYVTAAKRLGISEKDCLVVEDSVIGLQAATRAGMACVI  304 (344)
Q Consensus       225 ~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KP~~~~~~~~~~~lgv~~~~~i~vGDs~~Di~~a~~aG~~~v~  304 (344)
                      |+.+++                        +++++.+||+|++|..+++++|++|++|+||||+.+|+.+|+++|+.+|+
T Consensus       131 F~~i~~------------------------~~~~~~~Kp~~~~~~~~~~~l~~~~~~~l~igD~~~di~aA~~~G~~~i~  186 (218)
T d1te2a_         131 FDALAS------------------------AEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIV  186 (218)
T ss_dssp             CSEEEE------------------------CTTSSCCTTSTHHHHHHHHHHTSCGGGEEEEESSHHHHHHHHHTTCEEEE
T ss_pred             cccccc------------------------ccccccchhhHHHHHHHHHHcCCCchhcEEEeeCHHHHHHHHHcCCEEEE
Confidence            789988                        99999999999999999999999999999999999999999999999999


Q ss_pred             EeCCCchhh-hccccccccCCccccCHHHHH
Q 019226          305 TYTSSTAEQ-DFKDAIAIYPDLSNVRLKDLE  334 (344)
Q Consensus       305 v~~~~~~~~-~l~~~~~~~~~~~~~~~~~l~  334 (344)
                      |+.+....+ ....++++++++.++.+++|.
T Consensus       187 v~~~~~~~~~~~~~a~~~i~~l~el~~~~l~  217 (218)
T d1te2a_         187 VPAPEAQNDPRFVLANVKLSSLTELTAKDLL  217 (218)
T ss_dssp             CCCTTTTTCGGGGGSSEECSCGGGCCHHHHH
T ss_pred             ECCCCCccchhhcCCCEEECChhhCCHhhcC
Confidence            977655443 346689999999999887764



>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure