Citrus Sinensis ID: 019296


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340---
MISGKKVNGIRHVHEAPNVRTKINSHDDELVVKQSQQPDNSPLRACLLGRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTASVTEDSNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQADKAEIIRARSEWQSKDEH
cccccEEEcEEEEcccccccccccccccccccccccccccccHHHHHccccccccEEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccEEEEEEEEEEEEEccccccEEEEEEEEccccccEEEEEEEEEEccccEEEEEEEEEEEEEEccccccccccHHHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccHHHHHHHHHHHccccccccccEEEEEEEEEcccccccEEEEEEEEccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEEEEEcccc
cccccccccccccccccccccHHcccccHHHHHHcccccccccccccccEEEEccEEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccEEEEEEEEEEEEEccccccEEEEEEEEEccccccEEEEEEEEEcccccEEEEEEEEEEEEcccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHccccccEccccccccccHHHHHHHHHHHccHHHHHcccccEEEEEEEEEcccccEEEEEEEEcccccccEEEcccccccccEEccccccccEEEEEEEEEcccccEEEEcEEEEcccccc
misgkkvngirhvheapnvrtkinshddelvvkqsqqpdnsplracllgrfvedrfvyrqtfsirsyeigpdktATMETLMNLLQETALNhvtssglagngfgatREMSLRKLIWVVTRIHIQVQrysswgdvvEIDTWvdasgknamrrDWIIRDYRTQDIITRATSTWVIMNREtrrlskipeqvRQEVLpfylntfaidkektdvgkidkltdqtagrirsglaprwsdmdanqhvnnVKYIGWILesvpihvledynmtsMTLEYRRECRQSNLLESLTSTTASvtedsnnnnknknshnhnssnnrkadlEYTHLLRMQADKAEIIRARSewqskdeh
misgkkvngirhvheapnvrtkinsHDDELVVkqsqqpdnsplraCLLGrfvedrfvyrqtfsirsyeigpdKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVqrysswgdvveidtwvdasgknamrrdwiirdyrtqdiitratstwvimnretrrlskipeqvrqEVLPFYLNTfaidkektdvgkidkltdqtagrirsglaprwsdmdanQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTasvtedsnnnnknknshnhnssnnrkADLEYTHLLRMQADKAEIIRARsewqskdeh
MISGKKVNGIRHVHEAPNVRTKINSHDDELVVKQSQQPDNSPLRACLLGRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTASVTEDsnnnnknknshnhnssnnRKADLEYTHLLRMQADKAEIIRARSEWQSKDEH
******************************************LRACLLGRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRREC**********************************************************************
**************************************************FVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTASVTEDSNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQADKAEIIRARSEWQ*****
MISGKKVNGIRHVHEAPNVRTKINSHDDELVVKQSQQPDNSPLRACLLGRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTASVTEDSNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQADKAEIIRAR*********
******************VRTKINSHDDELVVKQSQQPDNSPLRACLLGRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTASVTEDSNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQADKAEIIRARSEWQS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISGKKVNGIRHVHEAPNVRTKINSHDDELVVKQSQQPDNSPLRACLLGRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTASVTEDSNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQADKAEIIRARSEWQSKDEH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query343 2.2.26 [Sep-21-2011]
Q9SJE2412 Palmitoyl-acyl carrier pr yes no 0.798 0.665 0.549 5e-91
Q9SQI3413 Palmitoyl-acyl carrier pr N/A no 0.798 0.663 0.535 3e-89
Q39513415 Palmitoyl-acyl carrier pr N/A no 0.915 0.756 0.467 1e-84
Q39473382 Myristoyl-acyl carrier pr N/A no 0.918 0.824 0.424 5e-76
Q41635382 Lauroyl-acyl carrier prot N/A no 0.784 0.704 0.442 8e-75
Q42712369 Oleoyl-acyl carrier prote N/A no 0.848 0.788 0.453 2e-69
Q42561362 Oleoyl-acyl carrier prote no no 0.825 0.781 0.435 1e-67
Q9SV64367 Oleoyl-acyl carrier prote no no 0.845 0.790 0.417 4e-67
>sp|Q9SJE2|FATB_ARATH Palmitoyl-acyl carrier protein thioesterase, chloroplastic OS=Arabidopsis thaliana GN=FATB PE=1 SV=1 Back     alignment and function desciption
 Score =  334 bits (857), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 161/293 (54%), Positives = 212/293 (72%), Gaps = 19/293 (6%)

Query: 48  LGRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATRE 107
           +GR V+D  V+RQ FSIRSYEIG D++A++ET+MN LQETALNHV ++GL G+GFG+T E
Sbjct: 129 IGRIVQDGLVFRQNFSIRSYEIGADRSASIETVMNHLQETALNHVKTAGLLGDGFGSTPE 188

Query: 108 MSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRAT 167
           M  + LIWVVTR+ + V +Y +WGDVVE+DTWV  SGKN MRRDW++RD  T + +TRA+
Sbjct: 189 MFKKNLIWVVTRMQVVVDKYPTWGDVVEVDTWVSQSGKNGMRRDWLVRDCNTGETLTRAS 248

Query: 168 STWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLA 227
           S WV+MN+ TRRLSKIPE+VR E+ P+++N+  +  E  D  K+ K+ D+TA  +RSGL 
Sbjct: 249 SVWVMMNKLTRRLSKIPEEVRGEIEPYFVNSDPVLAE--DSRKLTKIDDKTADYVRSGLT 306

Query: 228 PRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTA 287
           PRWSD+D NQHVNNVKYIGWILES P+ ++E   + SMTLEYRREC + ++L+SLT+ T 
Sbjct: 307 PRWSDLDVNQHVNNVKYIGWILESAPVGIMERQKLKSMTLEYRRECGRDSVLQSLTAVTG 366

Query: 288 SVTEDSNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQADKAEIIRARSEWQSK 340
               D  N                  D+E  HLLR+Q D AE++R R+EW SK
Sbjct: 367 C---DIGNLAT-------------AGDVECQHLLRLQ-DGAEVVRGRTEWSSK 402




Plays an essential role in chain termination during de novo fatty acid synthesis. Possesses high thioesterase activity for palmitoyl-ACP versus other acyl-ACPs. Substrate preference is 16:0 > 18:1 > 18:0 > 16:1. Plays an essential role in the supply of saturated fatty acids necessary for plant growth and seed development. Contributes to 16:0 production particularly in flowers. May be involved in the synthesis of long chain fatty acid.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: -
>sp|Q9SQI3|FATB_GOSHI Palmitoyl-acyl carrier protein thioesterase, chloroplastic OS=Gossypium hirsutum GN=FATB1 PE=1 SV=1 Back     alignment and function description
>sp|Q39513|FATB_CUPHO Palmitoyl-acyl carrier protein thioesterase, chloroplastic OS=Cuphea hookeriana GN=FATB1 PE=2 SV=1 Back     alignment and function description
>sp|Q39473|FATB_CINCA Myristoyl-acyl carrier protein thioesterase, chloroplastic OS=Cinnamomum camphora GN=FATB1 PE=2 SV=1 Back     alignment and function description
>sp|Q41635|FATB_UMBCA Lauroyl-acyl carrier protein thioesterase, chloroplastic OS=Umbellularia californica GN=FATB1 PE=1 SV=1 Back     alignment and function description
>sp|Q42712|FATA_CORSA Oleoyl-acyl carrier protein thioesterase, chloroplastic (Fragment) OS=Coriandrum sativum GN=FATA PE=2 SV=1 Back     alignment and function description
>sp|Q42561|FATA1_ARATH Oleoyl-acyl carrier protein thioesterase 1, chloroplastic OS=Arabidopsis thaliana GN=FATA PE=1 SV=1 Back     alignment and function description
>sp|Q9SV64|FATA2_ARATH Oleoyl-acyl carrier protein thioesterase 2, chloroplastic OS=Arabidopsis thaliana GN=FATA2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
255540167392 palmitoyl-acyl carrier protein thioester 0.941 0.823 0.764 1e-144
224122094345 predicted protein [Populus trichocarpa] 0.938 0.933 0.737 1e-142
224136230323 predicted protein [Populus trichocarpa] 0.938 0.996 0.743 1e-138
297734448374 unnamed protein product [Vitis vinifera] 0.886 0.812 0.718 1e-135
225456375371 PREDICTED: myristoyl-acyl carrier protei 0.886 0.819 0.718 1e-135
147773043374 hypothetical protein VITISV_039528 [Viti 0.886 0.812 0.723 1e-135
449503708386 PREDICTED: palmitoyl-acyl carrier protei 0.924 0.821 0.709 1e-130
449471029386 PREDICTED: palmitoyl-acyl carrier protei 0.924 0.821 0.709 1e-130
356516529383 PREDICTED: myristoyl-acyl carrier protei 0.909 0.814 0.695 1e-130
449454961386 PREDICTED: palmitoyl-acyl carrier protei 0.924 0.821 0.697 1e-128
>gi|255540167|ref|XP_002511148.1| palmitoyl-acyl carrier protein thioesterase [Ricinus communis] gi|223550263|gb|EEF51750.1| palmitoyl-acyl carrier protein thioesterase [Ricinus communis] Back     alignment and taxonomy information
 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/339 (76%), Positives = 282/339 (83%), Gaps = 16/339 (4%)

Query: 2   ISGKKVNGIRHVHEAPNVRTKINSHDDELVVKQSQQPDNSPLRACLLGRFVEDRFVYRQT 61
           I+GKKVNGI HV E+ N     N  +    +      D+ PL   LLGRFV++R VY QT
Sbjct: 64  INGKKVNGI-HVAESSNSYADQNKMNATAGLVLDGNVDHQPLHKWLLGRFVDERLVYSQT 122

Query: 62  FSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIH 121
           F IRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAG+GFGATREMSLRKLIWVVTRIH
Sbjct: 123 FIIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGDGFGATREMSLRKLIWVVTRIH 182

Query: 122 IQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLS 181
           IQVQRYS WGDVVEIDTWVD +GKN MRRDWIIRDY T++IITRATSTWVIMNRETR+LS
Sbjct: 183 IQVQRYSCWGDVVEIDTWVDGAGKNGMRRDWIIRDYNTKEIITRATSTWVIMNRETRKLS 242

Query: 182 KIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNN 241
           K+PEQVRQE++PFY N  AI KE  DV KIDKLTD+TA RIRSGLAPRWSDMDANQHVNN
Sbjct: 243 KMPEQVRQELVPFYTNRIAIAKENNDVEKIDKLTDETAERIRSGLAPRWSDMDANQHVNN 302

Query: 242 VKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTASVTEDSNNNNKNKN 301
           VKYIGWILESVPI+VLEDYN+TSMTLEYRRECRQSNLLESLTSTT               
Sbjct: 303 VKYIGWILESVPINVLEDYNLTSMTLEYRRECRQSNLLESLTSTT--------------- 347

Query: 302 SHNHNSSNNRKADLEYTHLLRMQADKAEIIRARSEWQSK 340
            H++N+S NRKA LEYTHLLRMQADKAEI+RAR+EWQSK
Sbjct: 348 EHSNNNSCNRKAHLEYTHLLRMQADKAEIVRARTEWQSK 386




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224122094|ref|XP_002318751.1| predicted protein [Populus trichocarpa] gi|222859424|gb|EEE96971.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224136230|ref|XP_002322277.1| predicted protein [Populus trichocarpa] gi|222869273|gb|EEF06404.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297734448|emb|CBI15695.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456375|ref|XP_002280321.1| PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147773043|emb|CAN60643.1| hypothetical protein VITISV_039528 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449503708|ref|XP_004162137.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449471029|ref|XP_004153187.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356516529|ref|XP_003526946.1| PREDICTED: myristoyl-acyl carrier protein thioesterase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449454961|ref|XP_004145222.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query343
TAIR|locus:2201786412 FATB "AT1G08510" [Arabidopsis 0.690 0.575 0.598 6.4e-85
TAIR|locus:2123256367 AT4G13050 "AT4G13050" [Arabido 0.862 0.806 0.419 6.9e-63
TAIR|locus:2090285362 FaTA "AT3G25110" [Arabidopsis 0.825 0.781 0.425 3.4e-61
UNIPROTKB|Q3ADW4252 CHY_0816 "Acyl carrier protein 0.612 0.833 0.254 1.5e-16
TIGR_CMR|CHY_0816252 CHY_0816 "acyl carrier protein 0.612 0.833 0.254 1.5e-16
TAIR|locus:2201786 FATB "AT1G08510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 786 (281.7 bits), Expect = 6.4e-85, Sum P(2) = 6.4e-85
 Identities = 143/239 (59%), Positives = 189/239 (79%)

Query:    48 LGRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATRE 107
             +GR V+D  V+RQ FSIRSYEIG D++A++ET+MN LQETALNHV ++GL G+GFG+T E
Sbjct:   129 IGRIVQDGLVFRQNFSIRSYEIGADRSASIETVMNHLQETALNHVKTAGLLGDGFGSTPE 188

Query:   108 MSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRAT 167
             M  + LIWVVTR+ + V +Y +WGDVVE+DTWV  SGKN MRRDW++RD  T + +TRA+
Sbjct:   189 MFKKNLIWVVTRMQVVVDKYPTWGDVVEVDTWVSQSGKNGMRRDWLVRDCNTGETLTRAS 248

Query:   168 STWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLA 227
             S WV+MN+ TRRLSKIPE+VR E+ P+++N+  +  E  D  K+ K+ D+TA  +RSGL 
Sbjct:   249 SVWVMMNKLTRRLSKIPEEVRGEIEPYFVNSDPVLAE--DSRKLTKIDDKTADYVRSGLT 306

Query:   228 PRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTT 286
             PRWSD+D NQHVNNVKYIGWILES P+ ++E   + SMTLEYRREC + ++L+SLT+ T
Sbjct:   307 PRWSDLDVNQHVNNVKYIGWILESAPVGIMERQKLKSMTLEYRRECGRDSVLQSLTAVT 365


GO:0000036 "ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process" evidence=ISS;IDA
GO:0006633 "fatty acid biosynthetic process" evidence=ISS;IMP
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016790 "thiolester hydrolase activity" evidence=IEA
GO:0016297 "acyl-[acyl-carrier-protein
GO:0009536 "plastid" evidence=TAS
TAIR|locus:2123256 AT4G13050 "AT4G13050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090285 FaTA "AT3G25110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ADW4 CHY_0816 "Acyl carrier protein thioesterase, homolog" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0816 CHY_0816 "acyl carrier protein thioesterase, homolog" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SJE2FATB_ARATH3, ., 1, ., 2, ., -0.54940.79880.6650yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XII.1777.1
hypothetical protein (278 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XVIII.628.1
3-oxoacyl-[acyl-carrier-protein] synthase II (EC-2.3.1.41) (435 aa)
       0.899
gw1.V.169.1
acyl- [acyl-carrier protein] desaturase (EC-1.14.19.2); Converts stearoyl-ACP to oleoyl-ACP by [...] (352 aa)
       0.899
gw1.II.519.1
3-oxoacyl-[acyl-carrier-protein] synthase II (EC-2.3.1.179) (415 aa)
       0.899
gw1.I.8529.1
hypothetical protein (444 aa)
       0.899
grail3.0116012802
enoyl-[acyl-carrier-protein] reductase (EC-1.3.1.10) (395 aa)
       0.899
fgenesh4_pm.C_LG_VIII000307
acyl- [acyl-carrier protein] desaturase (EC-1.14.19.2) (396 aa)
       0.899
fgenesh4_pg.C_LG_XIV001425
acyl- [acyl-carrier protein] desaturase (EC-1.14.19.2) (380 aa)
       0.899
fgenesh4_pg.C_LG_X001619
acyl- [acyl-carrier protein] desaturase (EC-1.14.19.2) (332 aa)
       0.899
fgenesh4_pg.C_LG_X001616
acyl- [acyl-carrier protein] desaturase (EC-1.14.19.2) (387 aa)
       0.899
eugene3.01420056
acyl- [acyl-carrier protein] desaturase (EC-1.14.19.2); Converts stearoyl-ACP to oleoyl-ACP by [...] (397 aa)
       0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
PLN02370419 PLN02370, PLN02370, acyl-ACP thioesterase 1e-124
pfam01643249 pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase 2e-99
COG3884250 COG3884, FatA, Acyl-ACP thioesterase [Lipid metabo 2e-21
cd00586110 cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase ( 6e-14
COG0824137 COG0824, FcbC, Predicted thioesterase [General fun 3e-05
cd03440100 cd03440, hot_dog, The hotdog fold was initially id 2e-04
pfam13279120 pfam13279, 4HBT_2, Thioesterase-like superfamily 2e-04
cd00586110 cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase ( 0.002
>gnl|CDD|215210 PLN02370, PLN02370, acyl-ACP thioesterase Back     alignment and domain information
 Score =  362 bits (931), Expect = e-124
 Identities = 168/317 (52%), Positives = 221/317 (69%), Gaps = 25/317 (7%)

Query: 33  KQSQQPDNSPLRACLL------GRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQE 86
           KQ    D  P R+ +L      GR V+D  V+RQ FSIRSYEIG D+TA++ETLMN LQE
Sbjct: 109 KQWMMLDWKPRRSDMLIDPFGIGRIVQDGLVFRQNFSIRSYEIGADRTASIETLMNHLQE 168

Query: 87  TALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKN 146
           TALNHV ++GL G+GFG+T EMS R LIWVVTR+ + V RY +WGDVV++DTWV ASGKN
Sbjct: 169 TALNHVKTAGLLGDGFGSTPEMSKRNLIWVVTRMQVLVDRYPTWGDVVQVDTWVSASGKN 228

Query: 147 AMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKT 206
            MRRDW++RD +T + +TRA+S WV+MN+ TRRLSKIPE+VR E+ P++LN+  +  E  
Sbjct: 229 GMRRDWLVRDCKTGETLTRASSVWVMMNKLTRRLSKIPEEVRGEIEPYFLNSDPVVNE-- 286

Query: 207 DVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMT 266
           D  K+ KL D+TA  IR GL PRWSD+D NQHVNNVKYIGWILES P  ++E + + ++T
Sbjct: 287 DSRKLPKLDDKTADYIRKGLTPRWSDLDVNQHVNNVKYIGWILESAPPPIMESHELAAIT 346

Query: 267 LEYRRECRQSNLLESLTSTTASVTEDSNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQAD 326
           LEYRREC + ++L+SLT+ + +   +                     D+E  HLLR++ D
Sbjct: 347 LEYRRECGRDSVLQSLTAVSGTGIGNLGT----------------AGDVECQHLLRLE-D 389

Query: 327 KAEIIRARSEWQSKDEH 343
            AEI+R R+EW+ K   
Sbjct: 390 GAEIVRGRTEWRPKHAT 406


Length = 419

>gnl|CDD|216622 pfam01643, Acyl-ACP_TE, Acyl-ACP thioesterase Back     alignment and domain information
>gnl|CDD|226401 COG3884, FatA, Acyl-ACP thioesterase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|238329 cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>gnl|CDD|223894 COG0824, FcbC, Predicted thioesterase [General function prediction only] Back     alignment and domain information
>gnl|CDD|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E Back     alignment and domain information
>gnl|CDD|222021 pfam13279, 4HBT_2, Thioesterase-like superfamily Back     alignment and domain information
>gnl|CDD|238329 cd00586, 4HBT, 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 343
PLN02370419 acyl-ACP thioesterase 100.0
PF01643261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 100.0
COG3884250 FatA Acyl-ACP thioesterase [Lipid metabolism] 100.0
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 99.96
COG0824137 FcbC Predicted thioesterase [General function pred 99.94
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 99.94
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 99.93
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 99.89
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.88
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 99.75
COG0824137 FcbC Predicted thioesterase [General function pred 99.73
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 99.69
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 99.62
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 99.61
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 99.6
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 99.44
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.36
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 99.34
cd03440100 hot_dog The hotdog fold was initially identified i 99.01
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 98.94
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 98.77
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 98.74
PF01643261 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR0 98.69
PRK10694133 acyl-CoA esterase; Provisional 98.65
PLN02370 419 acyl-ACP thioesterase 98.63
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 98.57
cd03440100 hot_dog The hotdog fold was initially identified i 98.54
PLN02647437 acyl-CoA thioesterase 98.45
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 98.33
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 98.09
COG3884250 FatA Acyl-ACP thioesterase [Lipid metabolism] 98.04
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 97.89
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 97.8
PRK10293136 acyl-CoA esterase; Provisional 97.44
PRK10254137 thioesterase; Provisional 97.29
COG5496130 Predicted thioesterase [General function predictio 97.24
PRK11688154 hypothetical protein; Provisional 97.14
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 96.87
KOG3328148 consensus HGG motif-containing thioesterase [Gener 96.81
PLN02322154 acyl-CoA thioesterase 96.61
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 96.29
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 96.26
PRK10694133 acyl-CoA esterase; Provisional 96.2
PLN02647437 acyl-CoA thioesterase 96.02
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier 95.46
PLN02864310 enoyl-CoA hydratase 95.32
PF14539132 DUF4442: Domain of unknown function (DUF4442); PDB 95.24
COG4109432 Predicted transcriptional regulator containing CBS 95.2
PRK11688154 hypothetical protein; Provisional 94.96
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 94.9
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 94.61
KOG4366213 consensus Predicted thioesterase [General function 94.52
TIGR02447138 yiiD_Cterm thioesterase domain, putative. This fam 94.41
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought 94.24
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 94.2
cd00493131 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier pr 94.14
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 93.99
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro 93.81
TIGR01750140 fabZ beta-hydroxyacyl-[acyl carrier protein] dehyd 93.7
PRK04424185 fatty acid biosynthesis transcriptional regulator; 93.63
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 93.59
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro 93.18
KOG4366213 consensus Predicted thioesterase [General function 92.94
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 92.75
cd03454140 YdeM YdeM is a Bacillus subtilis protein that belo 92.73
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 92.6
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protei 92.32
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 92.29
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 90.86
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 90.49
PF13452132 MaoC_dehydrat_N: N-terminal half of MaoC dehydrata 90.26
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 90.23
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 88.56
PRK08190 466 bifunctional enoyl-CoA hydratase/phosphate acetylt 88.54
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the M 88.42
PRK10293136 acyl-CoA esterase; Provisional 88.29
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 87.06
PF07977138 FabA: FabA-like domain; InterPro: IPR013114 Fatty 86.71
cd0344594 Thioesterase_II_repeat2 Thioesterase II (TEII) is 86.65
PF13622255 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 86.52
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 86.2
PRK13691166 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Pro 85.86
PRK13188464 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetyl 85.43
KOG3328148 consensus HGG motif-containing thioesterase [Gener 85.41
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 85.28
PRK13692159 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Pro 84.13
cd03451146 FkbR2 FkbR2 is a Streptomyces hygroscopicus protei 83.96
PRK10254137 thioesterase; Provisional 83.67
cd03452142 MaoC_C MaoC_C The C-terminal hot dog fold of the M 82.9
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 82.14
cd01289138 FabA_like Domain of unknown function, appears to b 81.99
>PLN02370 acyl-ACP thioesterase Back     alignment and domain information
Probab=100.00  E-value=2.2e-55  Score=429.88  Aligned_cols=284  Identities=57%  Similarity=0.989  Sum_probs=241.4

Q ss_pred             CCCCcccccccccccCCCeeEEEEEEeeeCCCCCCCCcCHHHHHHHHHHHHHHHHHhcCCCCCCCCchHHHhhCCcEEEE
Q 019296           38 PDNSPLRACLLGRFVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVV  117 (343)
Q Consensus        38 ~~~~~~~~~~~g~~~~~~~~f~~~~~Vr~~d~D~~G~v~~~~yl~~lqeaa~~~~~~lG~~~~g~~~~~~~~~~g~~wVv  117 (343)
                      .+.-++|++++|++++|+++|+++|+||+||||++|+++.+.+++|||+++..|+..+|+..+||+...+|.+.|++|||
T Consensus       120 ~~~~~~~~~~~~~~~~~~~~y~~~f~Ir~yEvD~~g~lsl~~L~n~lQd~A~~Hs~~lGll~~Gfg~~~~m~~~gl~WVL  199 (419)
T PLN02370        120 RSDMLIDPFGIGRIVQDGLVFRQNFSIRSYEIGADRTASIETLMNHLQETALNHVKTAGLLGDGFGSTPEMSKRNLIWVV  199 (419)
T ss_pred             CCcccccccccCceeccCcEEEEEEEEeeEEECCCCCCCHHHHHHHHHHHHHHHHHHhCccccccccHHHHHhCCceEEE
Confidence            45567999999999999999999999999999999999999999999999999999999866677655788999999999


Q ss_pred             EeeEEEEeecCCCCCEEEEEEEEeecCCceEEEEEEEEECCCCcEEEEEEEEEEEEeCCCCceeCCCHHHHHhhcccccc
Q 019296          118 TRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLN  197 (343)
Q Consensus       118 ~r~~ie~~r~p~~gD~V~I~T~v~~~~~~~~~r~f~I~d~~~Ge~ia~a~s~wV~vD~~trRp~riP~ev~e~l~~~~~~  197 (343)
                      ++++|+|.+||+|||+|+|+||+.+++++++.|+|.|+|.++|+++++|.|+||+||+++|||+|||+++++.+.+|..+
T Consensus       200 tr~~I~~~R~P~~gD~V~V~Twv~~~~k~~~~Rdf~I~D~~~Ge~la~A~SvWV~mD~~TRRpvRIP~Evr~~i~~y~~~  279 (419)
T PLN02370        200 TRMQVLVDRYPTWGDVVQVDTWVSASGKNGMRRDWLVRDCKTGETLTRASSVWVMMNKLTRRLSKIPEEVRGEIEPYFLN  279 (419)
T ss_pred             EEEEEEeCcCCCCCCEEEEEEEEeeCCCCEEEEEEEEEECCCCeEEEEEEEEEEEEECCCCcccCCCHHHHHhhhhcccc
Confidence            99999999999999999999999999999999999999965799999999999999999999999999998887777543


Q ss_pred             cc-cccccccccCCccCCCcccccccccccccccccCccccccchhhHHHHHHhhccHhHHhhCcceEEEEEEcccCCCC
Q 019296          198 TF-AIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQS  276 (343)
Q Consensus       198 ~~-~~~~~~~~~~ki~~l~~~~~~~~~~~~~vr~~DiD~ngHVNN~~Y~~w~~e~~~~~~l~~~~~~~~~i~Y~~e~~~g  276 (343)
                      .. .++   ...+|++++.+...+.....++|||+|||.||||||++|++|++|.+|.+++..+.+++++|+|++||++|
T Consensus       280 ~~~~i~---~~~~kl~~l~~~~~~~~~~~~~VRysDLD~NgHVNNvkYi~Wild~lP~e~l~~~~l~~i~I~Y~kE~~~g  356 (419)
T PLN02370        280 SDPVVN---EDSRKLPKLDDKTADYIRKGLTPRWSDLDVNQHVNNVKYIGWILESAPPPIMESHELAAITLEYRRECGRD  356 (419)
T ss_pred             cccccc---cccccCCccccccccceeeeeeecHHHCcccCccccHHHHHHHHhhCchhhhhcceEEEEEEEEcccCCCC
Confidence            22 111   23566766654322233456999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEEEEeeccccccCCCCCCCCCCCCCCCCCCCCCCcEEEEEEEecCCCcEEEEEEEEEEecC
Q 019296          277 NLLESLTSTTASVTEDSNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQADKAEIIRARSEWQSKD  341 (343)
Q Consensus       277 d~i~v~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~l~~~~dg~~i~~~~t~W~~~~  341 (343)
                      |.|.+.+.....    +...            ........+.|.++ ..||+++|+++|+|++|.
T Consensus       357 d~V~s~~~~~~~----~~~~------------~~~~~~~~~~h~~~-~~dG~e~a~a~t~Wr~~~  404 (419)
T PLN02370        357 SVLQSLTAVSGT----GIGN------------LGTAGDVECQHLLR-LEDGAEIVRGRTEWRPKH  404 (419)
T ss_pred             CEEEEEEeeccc----cccc------------ccCCCcceEEEEEE-cCCCeEEEEEEEEEEECC
Confidence            999998875431    1000            00012235777776 458999999999999984



>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information
>COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>PF01643 Acyl-ACP_TE: Acyl-ACP thioesterase; InterPro: IPR002864 This entry represents various acyl-acyl carrier protein (ACP) thioesterases (TE) which terminate fatty acyl group extension via hydrolysing an acyl group on a fatty acid [] Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02370 acyl-ACP thioesterase Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>COG3884 FatA Acyl-ACP thioesterase [Lipid metabolism] Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK10254 thioesterase; Provisional Back     alignment and domain information
>COG5496 Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] Back     alignment and domain information
>PLN02322 acyl-CoA thioesterase Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>PLN02864 enoyl-CoA hydratase Back     alignment and domain information
>PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>KOG4366 consensus Predicted thioesterase [General function prediction only] Back     alignment and domain information
>TIGR02447 yiiD_Cterm thioesterase domain, putative Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>KOG4366 consensus Predicted thioesterase [General function prediction only] Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>cd03454 YdeM YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>PF13452 MaoC_dehydrat_N: N-terminal half of MaoC dehydratase; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1S9C_K 3OML_A 3KHP_A Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information
>PF07977 FabA: FabA-like domain; InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes [] Back     alignment and domain information
>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional Back     alignment and domain information
>PRK13188 bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed Back     alignment and domain information
>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional Back     alignment and domain information
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes Back     alignment and domain information
>PRK10254 thioesterase; Provisional Back     alignment and domain information
>cd03452 MaoC_C MaoC_C The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
4gak_A250 Crystal Structure Of Acyl-Acp Thioesterase From Spi 5e-18
2own_A262 Crystal Structure Of Oleoyl Thioesterase (Putative) 7e-10
2ess_A248 Crystal Structure Of An Acyl-Acp Thioesterase (Np_8 6e-06
>pdb|4GAK|A Chain A, Crystal Structure Of Acyl-Acp Thioesterase From Spirosoma Linguale Length = 250 Back     alignment and structure

Iteration: 1

Score = 88.2 bits (217), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 60/240 (25%), Positives = 113/240 (47%), Gaps = 22/240 (9%) Query: 56 FVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIW 115 F+ TF++R YE ++ L NL QE+A + G+ +++ + + W Sbjct: 6 FIQTDTFTLRGYECDAFGRXSIPALXNLXQESANRNAIDYGIG------IADLAQKGVGW 59 Query: 116 VVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRT----QDIITRATSTWV 171 + R +++ +Y +GD +++ T+ + + +I RD+R ++ A STW+ Sbjct: 60 XLXRFCLRIHQYPRYGDTIQLXTY-----PTTVDKYFIHRDFRVLATDGTLLADARSTWL 114 Query: 172 IMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRWS 231 + + E R +P+ +RQ P ++ K D + + ++ G W Sbjct: 115 VFSXEKRSXVPLPDFIRQLSPPANVDPLPALPLKPDF-QTASFATAASKSVQVG----WL 169 Query: 232 DMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLL--ESLTSTTASV 289 ++D NQHVNNV Y+ W+LE V +++ + + L YR E + L +S+T T SV Sbjct: 170 NIDQNQHVNNVAYVQWLLEGVDSEIVQTREIAEIDLVYRTESHWHDWLSVQSVTETDNSV 229
>pdb|2OWN|A Chain A, Crystal Structure Of Oleoyl Thioesterase (Putative) (Np_784467.1) From Lactobacillus Plantarum At 2.00 A Resolution Length = 262 Back     alignment and structure
>pdb|2ESS|A Chain A, Crystal Structure Of An Acyl-Acp Thioesterase (Np_810988.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 1.90 A Resolution Length = 248 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query343
2ess_A248 Acyl-ACP thioesterase; NP_810988.1, structural gen 1e-61
2own_A262 Putative oleoyl-[acyl-carrier protein] thioestera; 9e-61
1njk_A156 Hypothetical protein YBAW; structural genomics, th 2e-08
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 5e-08
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 2e-05
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 4e-07
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 9e-06
3ck1_A150 Putative thioesterase; structural genomics, joint 6e-07
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 4e-06
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 5e-06
2cye_A133 TTHA1846, putative thioesterase; structural genomi 7e-06
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 1e-05
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 2e-05
2fuj_A137 Conserved hypothetical protein; structural genomic 2e-05
2fuj_A137 Conserved hypothetical protein; structural genomic 3e-05
2ali_A158 Hypothetical protein PA2801; structural genomics, 2e-05
2ali_A158 Hypothetical protein PA2801; structural genomics, 3e-05
2gf6_A135 Conserved hypothetical protein; putative thioester 3e-05
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 9e-05
3r87_A135 Putative uncharacterized protein; unknown function 4e-04
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 8e-04
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Length = 248 Back     alignment and structure
 Score =  196 bits (499), Expect = 1e-61
 Identities = 46/288 (15%), Positives = 101/288 (35%), Gaps = 41/288 (14%)

Query: 51  FVEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSL 110
             E+  +    F    + +  +   TM  L N L   A  H +  G           ++ 
Sbjct: 2   MSEENKIGTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFHASDRGFG------IATLNE 55

Query: 111 RKLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTW 170
               WV++R+ I++       +   + TWV+   +    R++ + D   +  I  A S W
Sbjct: 56  DNYTWVLSRLAIELDEMPYQYEKFSVQTWVENVYRLFTDRNFAVIDKDGK-KIGYARSVW 114

Query: 171 VIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKIDKLTDQTAGRIRSGLAPRW 230
            ++N  TR+ + +       ++ +         ++    +       T+ +  + L  ++
Sbjct: 115 AMINLNTRKPADLLALHGGSIVDY-------ICDEPCPIEKPSRIKVTSNQPVATLTAKY 167

Query: 231 SDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTASVT 290
           SD+D N HVN+++YI  IL+  PI + +   +    + Y  E    + L           
Sbjct: 168 SDIDINGHVNSIRYIEHILDLFPIELYQTKRIRRFEMAYVAESYFGDELSFFCD------ 221

Query: 291 EDSNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQADKAEIIRARSEWQ 338
                                +      H+   +     + R++  ++
Sbjct: 222 ---------------------EVSENEFHVEVKKNGSEVVCRSKVIFE 248


>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Length = 262 Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Length = 156 Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Length = 148 Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Length = 148 Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Length = 136 Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Length = 136 Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Length = 150 Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Length = 152 Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Length = 151 Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Length = 133 Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Length = 163 Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Length = 163 Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Length = 137 Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Length = 137 Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Length = 158 Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Length = 158 Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Length = 135 Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Length = 135 Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Length = 135 Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Length = 141 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
4gak_A250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 100.0
2own_A262 Putative oleoyl-[acyl-carrier protein] thioestera; 100.0
2ess_A248 Acyl-ACP thioesterase; NP_810988.1, structural gen 100.0
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 99.95
3r87_A135 Putative uncharacterized protein; unknown function 99.95
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 99.94
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 99.94
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 99.94
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 99.94
2gf6_A135 Conserved hypothetical protein; putative thioester 99.94
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 99.94
3ck1_A150 Putative thioesterase; structural genomics, joint 99.94
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 99.94
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 99.93
1z54_A132 Probable thioesterase; hypothetical protein, struc 99.93
2hlj_A157 Hypothetical protein; putative thioesterase, struc 99.93
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 99.93
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 99.93
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 99.93
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 99.93
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 99.93
2fuj_A137 Conserved hypothetical protein; structural genomic 99.93
1njk_A156 Hypothetical protein YBAW; structural genomics, th 99.93
2ali_A158 Hypothetical protein PA2801; structural genomics, 99.93
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 99.91
2cye_A133 TTHA1846, putative thioesterase; structural genomi 99.9
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 99.83
3r87_A135 Putative uncharacterized protein; unknown function 99.73
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 99.7
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 99.7
2fuj_A137 Conserved hypothetical protein; structural genomic 99.69
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 99.67
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 99.67
2gf6_A135 Conserved hypothetical protein; putative thioester 99.67
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 99.66
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 99.65
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 99.65
1njk_A156 Hypothetical protein YBAW; structural genomics, th 99.65
2ali_A158 Hypothetical protein PA2801; structural genomics, 99.65
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 99.64
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 99.64
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 99.64
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 99.64
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 99.62
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 99.62
3ck1_A150 Putative thioesterase; structural genomics, joint 99.62
2hlj_A157 Hypothetical protein; putative thioesterase, struc 99.62
1z54_A132 Probable thioesterase; hypothetical protein, struc 99.61
2cye_A133 TTHA1846, putative thioesterase; structural genomi 99.6
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 99.6
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 99.6
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 99.6
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 99.59
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 99.59
2own_A262 Putative oleoyl-[acyl-carrier protein] thioestera; 99.57
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural gen 99.54
4gak_A 250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 99.44
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 99.44
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 99.44
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 99.43
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 99.42
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 99.3
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 99.3
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 99.19
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 99.14
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 99.09
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 99.06
1zki_A133 Hypothetical protein PA5202; structural genomics, 98.97
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 98.95
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 98.89
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 98.8
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 98.79
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 98.77
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 98.72
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 98.69
2h4u_A145 Thioesterase superfamily member 2; structural geno 98.6
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 98.59
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 98.56
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 98.55
2pim_A141 Phenylacetic acid degradation-related protein; thi 98.55
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 98.44
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 98.44
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 98.43
2cwz_A141 Thioesterase family protein; structural genomics, 98.36
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 98.35
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 98.35
1o0i_A138 Hypothetical protein HI1161; structural genomics, 98.34
1zki_A133 Hypothetical protein PA5202; structural genomics, 98.33
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 98.32
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 98.29
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 98.28
3e1e_A141 Thioesterase family protein; structural genomics, 98.27
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 98.23
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 98.21
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 98.21
1sh8_A154 Hypothetical protein PA5026; structural genomics, 98.11
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 98.09
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 98.05
2qwz_A159 Phenylacetic acid degradation-related protein; put 98.04
2h4u_A145 Thioesterase superfamily member 2; structural geno 98.04
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 98.03
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 97.95
1sc0_A138 Hypothetical protein HI1161; structural genomics, 97.95
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 97.9
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 97.79
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 97.78
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 97.69
2pim_A141 Phenylacetic acid degradation-related protein; thi 97.69
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 97.58
3hdu_A157 Putative thioesterase; structural genomics, joint 97.54
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 97.39
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 97.24
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 97.23
2qwz_A159 Phenylacetic acid degradation-related protein; put 97.23
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 97.22
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 97.19
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 97.09
1yoc_A147 Hypothetical protein PA1835; structural genomics, 97.06
2q78_A153 Uncharacterized protein; structural genomics, join 96.92
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 96.9
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 96.87
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 96.87
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 96.81
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 96.77
1sh8_A154 Hypothetical protein PA5026; structural genomics, 96.62
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 96.61
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 96.47
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 96.46
3e1e_A141 Thioesterase family protein; structural genomics, 96.39
1o0i_A138 Hypothetical protein HI1161; structural genomics, 96.28
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 96.25
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 96.25
1t82_A155 Hypothetical acetyltransferase; structural genomic 96.22
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 96.01
3khp_A311 MAOC family protein; dehydrogenase, oxidoreductase 95.95
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 95.89
3kh8_A332 MAOC-like dehydratase; hot DOG domain, lyase; 2.00 95.83
2cwz_A141 Thioesterase family protein; structural genomics, 95.82
1s9c_A298 Peroxisomal multifunctional enzyme type 2; hot-DOG 95.79
1pn2_A280 Peroxisomal hydratase-dehydrogenase-epimerase; hot 95.68
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 95.62
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 95.52
3hdu_A157 Putative thioesterase; structural genomics, joint 95.51
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 95.5
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 95.46
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 95.11
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 94.9
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 94.63
2b3n_A159 Hypothetical protein AF1124; structural genomics, 94.63
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 94.4
4h4g_A160 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 94.4
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 94.32
4ffu_A176 Oxidase; structural genomics, protein structure in 93.88
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 93.62
4a0z_A190 Transcription factor FAPR; lipid homeostasis; HET: 93.61
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 93.56
3k67_A159 Putative dehydratase AF1124; hypothetical protein 93.54
2gll_A171 FABZ, (3R)-hydroxymyristoyl-acyl carrier protein d 93.48
3lmb_A165 Uncharacterized protein; protein OLEI01261, unknow 93.33
1sc0_A138 Hypothetical protein HI1161; structural genomics, 93.11
4i83_A152 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; 93.1
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 92.86
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd 92.55
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 91.51
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 90.93
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 90.75
1yoc_A147 Hypothetical protein PA1835; structural genomics, 90.47
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, bet 88.82
2cf2_C342 Fatty acid synthase, DH domain; transferase, fatty 88.71
4e3e_A352 MAOC domain protein dehydratase; structural genomi 88.26
3bbj_A272 Putative thioesterase II; structural genomics, joi 88.0
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 87.73
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 87.28
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 86.36
2b3n_A159 Hypothetical protein AF1124; structural genomics, 85.89
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 85.35
3cjy_A259 Putative thioesterase; YP_496845.1, structural gen 85.24
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 84.85
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 82.61
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 82.1
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 81.48
2bi0_A337 Hypothetical protein RV0216; conserved hypothetica 81.14
4ffu_A176 Oxidase; structural genomics, protein structure in 80.04
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
Probab=100.00  E-value=1.7e-55  Score=407.55  Aligned_cols=248  Identities=24%  Similarity=0.459  Sum_probs=215.9

Q ss_pred             CCCeeEEEEEEeeeCCCCCCCCcCHHHHHHHHHHHHHHHHHhcCCCCCCCCchHHHhhCCcEEEEEeeEEEEeecCCCCC
Q 019296           53 EDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGD  132 (343)
Q Consensus        53 ~~~~~f~~~~~Vr~~d~D~~G~v~~~~yl~~lqeaa~~~~~~lG~~~~g~~~~~~~~~~g~~wVv~r~~ie~~r~p~~gD  132 (343)
                      .+.++|+++|+||++|||++|||++++|++|||+||.+|+..+|++.      .+|.+.|++|||++++|+|.+||++||
T Consensus         3 ~M~~i~t~~f~Vr~~e~D~~g~v~~~~~l~~~q~a~~~~~~~~G~~~------~~l~~~g~~wVv~~~~i~~~r~~~~~d   76 (250)
T 4gak_A            3 AMAFIQTDTFTLRGYECDAFGRMSIPALMNLMQESANRNAIDYGIGI------ADLAQKGVGWMLMRFCLRIHQYPRYGD   76 (250)
T ss_dssp             CSCCCEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHHHTCSH------HHHHTTTEEEEEEEEEEEESSCCBTTC
T ss_pred             CCCceEEEEEEECHHHcCCCCcCCHHHHHHHHHHHHHHHHHHcCCCH------HHHHhcCceEEEEEEEEEEecCCCCCC
Confidence            46788999999999999999999999999999999999999999873      678899999999999999999999999


Q ss_pred             EEEEEEEEeecCCceEEEEEEEEECCCCcEEEEEEEEEEEEeCCCCceeCCCHHHHHhhcccccccccccccccccCCcc
Q 019296          133 VVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLNTFAIDKEKTDVGKID  212 (343)
Q Consensus       133 ~V~I~T~v~~~~~~~~~r~f~I~d~~~Ge~ia~a~s~wV~vD~~trRp~riP~ev~e~l~~~~~~~~~~~~~~~~~~ki~  212 (343)
                      .|+|+||+.+++++++.|+|.|++. +|+++++|.|+||+||++||||+|+|+++++.+.++..++.+..  +..+.+. 
T Consensus        77 ~v~V~T~~~~~~~~~~~r~~~i~d~-~g~~l~~a~s~wv~iD~~trrp~~ip~~~~~~~~~~~~~~~~~~--~~~~~~~-  152 (250)
T 4gak_A           77 TIQLMTYPTTVDKYFIHRDFRVLAT-DGTLLADARSTWLVFSMEKRSMVPLPDFIRQLSPPANVDPLPAL--PLKPDFQ-  152 (250)
T ss_dssp             EEEEEEEEEEECSSEEEEEEEEEET-TCCEEEEEEEEEEEEETTTTEEECCCHHHHTCCCCTTCCCCCCC--CSSCGGG-
T ss_pred             EEEEEEEEEEcCCCEEEEEEEEEeC-CCCEEEEEEEEEEeeccccCCCcCCCHHHHhhcccccccccccc--cccchhc-
Confidence            9999999999999999999999996 89999999999999999999999999999988776554332111  1111111 


Q ss_pred             CCCcccccccccccccccccCccccccchhhHHHHHHhhccHhHHhhCcceEEEEEEcccCCCCCEEEEEEEeecccccc
Q 019296          213 KLTDQTAGRIRSGLAPRWSDMDANQHVNNVKYIGWILESVPIHVLEDYNMTSMTLEYRRECRQSNLLESLTSTTASVTED  292 (343)
Q Consensus       213 ~l~~~~~~~~~~~~~vr~~DiD~ngHVNN~~Y~~w~~e~~~~~~l~~~~~~~~~i~Y~~e~~~gd~i~v~t~~~~~~~~~  292 (343)
                      ..+.  ......+++|||+|||.||||||++|++|++|+++.++++.+.+++++|+|++|+++||.|.+.+++..     
T Consensus       153 ~~~~--~~~~~~~~~vr~~d~D~~gHvNN~~Y~~~~~e~~~~~~~~~~~~~~~~i~y~~e~~~gd~l~~~~~~~~-----  225 (250)
T 4gak_A          153 TASF--ATAASKSVQVGWLNIDQNQHVNNVAYVQWLLEGVDSEIVQTREIAEIDLVYRTESHWHDWLSVQSVTET-----  225 (250)
T ss_dssp             GCCC--TTSCCEEEECCGGGBCTTSSBCHHHHHHHHHHTSCHHHHHHCCEEEEEEEECSCCCTTCEEEEEEEEEE-----
T ss_pred             cccc--ccceeEEEEeCHHHcCccCcccHHHHHHHHHHHhhHHHHHhcCeeEEEEEEcccCCCCCEEEEEEEEec-----
Confidence            1111  122345799999999999999999999999999999999999999999999999999999999998875     


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCcEEEEEEEecCCCcEEEEEEEEEE
Q 019296          293 SNNNNKNKNSHNHNSSNNRKADLEYTHLLRMQADKAEIIRARSEWQ  338 (343)
Q Consensus       293 ~~~~~~~~~~~~~~~~~~~~~~~~~~h~l~~~~dg~~i~~~~t~W~  338 (343)
                      +                     ..+.|.|.+.+||+++|+|+|+|+
T Consensus       226 ~---------------------~~~~~~i~~~~dg~~~~~a~t~Wr  250 (250)
T 4gak_A          226 D---------------------NSVLHRISQTESGKDVLLARSRWR  250 (250)
T ss_dssp             T---------------------TEEEEEEEETTTCCEEEEEEEEEC
T ss_pred             C---------------------CeEEEEEEECCCCcEEEEEEEEEC
Confidence            1                     136788888789999999999996



>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>3khp_A MAOC family protein; dehydrogenase, oxidoreductase, structural genomics; HET: TLA; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>3kh8_A MAOC-like dehydratase; hot DOG domain, lyase; 2.00A {Phytophthora capsici} Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>1s9c_A Peroxisomal multifunctional enzyme type 2; hot-DOG fold, hydratase 2 motif, lyase; 3.00A {Homo sapiens} SCOP: d.38.1.4 d.38.1.4 PDB: 2cdh_S Back     alignment and structure
>1pn2_A Peroxisomal hydratase-dehydrogenase-epimerase; hot-DOG fold, hydratase 2 motif, lyase; 1.95A {Candida tropicalis} SCOP: d.38.1.4 d.38.1.4 PDB: 1pn4_A* Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>4h4g_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A Back     alignment and structure
>2gll_A FABZ, (3R)-hydroxymyristoyl-acyl carrier protein dehydratase; lyase; 2.20A {Helicobacter pylori} PDB: 2glm_A* 2glp_A* 2glv_A 3dp1_A* 3cf8_A* 3cf9_A* 3d04_A* 3doy_A* 3doz_A* 3dp0_A* 3b7j_A* 3dp2_A* 3dp3_A* 3ed0_A* Back     alignment and structure
>3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0 Back     alignment and structure
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
>4i83_A 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; FABZ, hot DOG fold, thioesterase, lyase; 2.60A {Neisseria meningitidis} Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>2cf2_C Fatty acid synthase, DH domain; transferase, fatty acid metabolism, fatty acid biosynthesis, multienzyme; 4.30A {Sus scrofa} SCOP: d.38.1.2 Back     alignment and structure
>4e3e_A MAOC domain protein dehydratase; structural genomics, protein structure initiative, nysgrc, PSI-biology; 1.90A {Chloroflexus aurantiacus} Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>2bi0_A Hypothetical protein RV0216; conserved hypothetical, hotdog-fold, structural proteomics in europe, spine, structural genomics; 1.9A {Mycobacterium tuberculosis} SCOP: d.38.1.4 d.38.1.4 Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 343
d2essa1149 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroi 3e-19
d2owna1147 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesteras 5e-16
d2essa298 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacter 3e-12
d2owna2109 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioester 1e-10
d2hx5a1144 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {P 5e-08
d2o5ua1139 d.38.1.1 (A:5-143) Hypothetical thioesterase PA518 6e-08
d2oiwa1131 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus ste 7e-08
d2oiwa1131 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus ste 0.001
d2oafa1143 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 { 4e-07
d1s5ua_129 d.38.1.1 (A:) Hypothetical protein YbgC {Escherich 2e-06
d1njka_133 d.38.1.1 (A:) Hypothetical protein YbaW {Escherich 3e-06
d2nuja1159 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 6e-06
d2nuja1159 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 6e-04
d2cyea1132 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 2e-05
d2cyea1132 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 0.001
d2alia1130 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Ps 4e-05
d2alia1130 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Ps 0.001
d1lo7a_140 d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {P 7e-05
d2gf6a1134 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {A 3e-04
d2hlja1156 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Ps 4e-04
d1z54a1132 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 9e-04
d2fuja1118 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {X 9e-04
d2fuja1118 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {X 0.002
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 149 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: Acyl-ACP thioesterase-like
domain: Acyl-ACP thioesterase
species: Bacteroides thetaiotaomicron [TaxId: 818]
 Score = 81.0 bits (199), Expect = 3e-19
 Identities = 26/145 (17%), Positives = 54/145 (37%), Gaps = 7/145 (4%)

Query: 52  VEDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLR 111
            E+  +    F    + +  +   TM  L N L   A  H +  G           ++  
Sbjct: 2   SEENKIGTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFHASDRG------FGIATLNED 55

Query: 112 KLIWVVTRIHIQVQRYSSWGDVVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWV 171
              WV++R+ I++       +   + TWV+   +    R++ + D      I  A S W 
Sbjct: 56  NYTWVLSRLAIELDEMPYQYEKFSVQTWVENVYRLFTDRNFAVIDKD-GKKIGYARSVWA 114

Query: 172 IMNRETRRLSKIPEQVRQEVLPFYL 196
           ++N  TR+ + +       ++ +  
Sbjct: 115 MINLNTRKPADLLALHGGSIVDYIC 139


>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Length = 147 Back     information, alignment and structure
>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 98 Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Length = 109 Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Length = 144 Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Length = 139 Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 131 Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 131 Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Length = 143 Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Length = 129 Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Length = 159 Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Length = 159 Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Length = 140 Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 134 Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Length = 156 Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Length = 118 Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query343
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 99.97
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 99.97
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 99.96
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 99.94
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 99.94
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 99.94
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 99.94
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 99.93
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 99.93
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 99.93
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 99.93
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 99.93
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 99.92
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 99.92
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 99.92
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 99.89
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 99.88
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 99.87
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 99.75
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 99.74
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 99.73
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 99.71
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 99.71
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 99.69
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 99.69
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 99.68
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 99.68
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 99.66
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 99.65
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 99.65
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 99.65
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 99.64
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 99.62
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 99.6
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 99.5
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 99.49
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 98.8
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 98.63
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 98.48
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 98.46
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 98.42
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 98.26
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 98.24
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 98.07
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 98.01
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 98.0
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 98.0
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 98.0
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 97.97
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 97.91
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 97.87
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 97.77
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 97.65
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 97.38
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 97.06
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 96.94
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 96.88
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 96.52
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 96.14
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 96.01
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 95.92
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 95.84
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 95.58
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensi 95.48
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginos 95.36
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 95.35
d1u1za_145 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomo 95.09
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 94.88
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 94.64
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 94.56
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 94.51
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginos 94.5
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 94.15
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 93.9
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 93.9
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 93.87
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 93.69
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 93.42
d2b3na1154 Hypothetical protein AF1124 {Archaeon Archaeoglobu 92.64
d1pn2a1148 2-enoyl-coa hydratase domain of multifunctional pe 92.24
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional pe 92.17
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium 92.14
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Arc 91.15
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 91.0
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 90.86
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium 88.86
d1s9ca2154 2-enoyl-coa hydratase domain of multifunctional pe 88.25
d1q6wa_151 Monoamine oxidase regulatory protein {Archaeon Arc 87.6
d1z6ba1146 (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria 86.01
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginos 85.72
d1tbua1104 Peroxisomal long-chain acyl-CoA thioesterase 1, TE 83.95
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tubercu 82.62
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: Acyl-ACP thioesterase-like
domain: Acyl-ACP thioesterase
species: Bacteroides thetaiotaomicron [TaxId: 818]
Probab=99.97  E-value=1.1e-30  Score=220.85  Aligned_cols=138  Identities=19%  Similarity=0.312  Sum_probs=126.3

Q ss_pred             CCCeeEEEEEEeeeCCCCCCCCcCHHHHHHHHHHHHHHHHHhcCCCCCCCCchHHHhhCCcEEEEEeeEEEEeecCCCCC
Q 019296           53 EDRFVYRQTFSIRSYEIGPDKTATMETLMNLLQETALNHVTSSGLAGNGFGATREMSLRKLIWVVTRIHIQVQRYSSWGD  132 (343)
Q Consensus        53 ~~~~~f~~~~~Vr~~d~D~~G~v~~~~yl~~lqeaa~~~~~~lG~~~~g~~~~~~~~~~g~~wVv~r~~ie~~r~p~~gD  132 (343)
                      .+.++|++++.|+++|||.+||++++.|++|||+|+..|+..+|++.      .++.+.|++|||++++|+|++|+++||
T Consensus         3 ~~~~i~t~~~~v~~~~~D~~G~~~~~~y~~~~~d~~~~~~~~~G~~~------~~l~~~g~~~vv~~~~i~y~~~~~~gd   76 (149)
T d2essa1           3 EENKIGTYQFVAEPFHVDFNGRLTMGVLGNHLLNCAGFHASDRGFGI------ATLNEDNYTWVLSRLAIELDEMPYQYE   76 (149)
T ss_dssp             TGGGCEEEEEECCGGGBCTTSBBCHHHHHHHHHHHHHHHHHHTTCSH------HHHHHTTEEEEEEEEEEEESCCCBTTC
T ss_pred             ccCcEEEEEEEeCHHHCCCCCCcCHHHHHHHHHHHHHHHHHHcCcch------hhHhccCceEEEEEEEEEEeeccccCc
Confidence            35679999999999999999999999999999999999999999874      678899999999999999999999999


Q ss_pred             EEEEEEEEeecCCceEEEEEEEEECCCCcEEEEEEEEEEEEeCCCCceeCCCHHHHHhhcccccc
Q 019296          133 VVEIDTWVDASGKNAMRRDWIIRDYRTQDIITRATSTWVIMNRETRRLSKIPEQVRQEVLPFYLN  197 (343)
Q Consensus       133 ~V~I~T~v~~~~~~~~~r~f~I~d~~~Ge~ia~a~s~wV~vD~~trRp~riP~ev~e~l~~~~~~  197 (343)
                      +|+|+||+...++.++.++|.|++. +|+++|+|.++||++|+++|||+++|+++++.+.++..+
T Consensus        77 ~v~V~t~~~~~~~~~~~~~~~i~~~-~g~~ia~a~~~~v~id~~t~kp~~ip~~~~~~~~~~~~~  140 (149)
T d2essa1          77 KFSVQTWVENVYRLFTDRNFAVIDK-DGKKIGYARSVWAMINLNTRKPADLLALHGGSIVDYICD  140 (149)
T ss_dssp             EEEEEEEEEEECSSEEEEEEEEECT-TSCEEEEEEEEEEEEETTTCCBC----CTTSSGGGGBCC
T ss_pred             eeeEEEEEeeeccceEEEEEEEEec-CCcEEEEEEEEEEEEECCCCCcCCCCHHHHHHHHhhhcc
Confidence            9999999999999999999999996 799999999999999999999999999999988877654



>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1u1za_ d.38.1.6 (A:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b3na1 d.38.1.4 (A:6-159) Hypothetical protein AF1124 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s9ca2 d.38.1.4 (A:10-163) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6wa_ d.38.1.4 (A:) Monoamine oxidase regulatory protein {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z6ba1 d.38.1.6 (A:84-229) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure