Citrus Sinensis ID: 019400

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MTPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSNPPDASSKMNRSESEWAFQRFLQEAQQPTSSGDSKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAPKGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDDEAEGETATTENMDPVDAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVMHSSIST
cccHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cccHEEEEEEEEccccccccccccEEEEEHHHHHHHHHHcccHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MTPIRILFILFLthpqtskpknktaRITKVTKIWRKMDRVFsvgeiseqfwsnppdasskmnrsESEWAFQRFLQEaqqptssgdskndsVVEIKSAHIsnnnnnnnnntdnqndnvkagggggnvsKAATsalsfdgtqNLEDYQAVLKSKLNLACAAVALSRascarpqdtadradsgsqssntsqlgsqapkgpvhdlsrsqnkdvnglhgipsisttlkkplvpvrsatsgssrdlseddeaegetattenmdpvDAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVMHSSIST
MTPIRILFILflthpqtskpknktariTKVTKIWRKMDRVFsvgeiseqfwsnppdasSKMNRSESEWAFQRFLQEaqqptssgdskNDSVVEIKSAHisnnnnnnnnntDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTAdradsgsqssntsqlgsqapkgpVHDLSRSQNKDVNGLHGipsisttlkkplvpvrsatsgssrdlseddeaegetattenmdpvdakrvrrmlsnresarrsrrrkqahlteletqvsqlrvenSSLLKRLTDISqkyneaavdnrvlKADVETLRAKVMHSSIST
MTPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSNPPDASSKMNRSESEWAFQRFLQEAQQPTSSGDSKNDSVVEIKSAHISnnnnnnnnntdnqndnVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAPKGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSeddeaegetatteNMDPVDAKRVRRMLsnresarrsrrrKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVMHSSIST
***IRILFILFLTHP********TARITKVTKIWRKMDRVFSVGEISEQFW******************************************************************************************LEDYQAVLKSKLNLACAAVALS*****************************************************************************************************************************************************Y**AAVDNRVLK*****************
*TPIRILFILFLTHPQTS*********TKVTKIWRKMDRVFSVGEISEQF*************************************************************************************************************************************************************************************************************************************RKQAHLTELETQVSQLRVENSSLLKRLTDISQKY*EAAVDNRVL***********M******
MTPIRILFILFLTHPQT********RITKVTKIWRKMDRVFSVGEISEQFWSNP***********SEWAFQRFLQE*************SVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSR****************************************QNKDVNGLHGIPSISTTLKKPLV**************************ENMDPVDAKRVRRML***************HLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAK********
*TPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSN*************EWAFQRFLQEAQQ*********************************************************DGTQNLEDYQAVLKSKLNLACAAVALSRASC****************************************************************************************************************RKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDNRVLKADVETLRAKVMHS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPIRILFILFLTHPQTSKPKNKTARITKVTKIWRKMDRVFSVGEISEQFWSNPPDASSKMNRSESEWAFQRFLQEAQQPTSSGDSKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAPKGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDDEAEGETATTENMDPVDAKRVRRMLSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTDISQKYNEAAVDNRVLKADVETLRAKVMHSSIST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query341 2.2.26 [Sep-21-2011]
Q99090 401 Light-inducible protein C N/A no 0.750 0.638 0.579 2e-66
B9DGI8314 Basic leucine zipper 63 O no no 0.653 0.710 0.436 2e-41
O22763 411 Basic leucine zipper 10 O no no 0.809 0.671 0.376 8e-33
Q9M1G6403 Basic leucine zipper 25 O no no 0.797 0.674 0.373 2e-28
Q9FUD3277 Basic leucine zipper 9 OS no no 0.398 0.490 0.5 6e-25
P12959 453 Regulatory protein opaque N/A no 0.674 0.507 0.344 1e-23
P23922349 Transcription factor HBP- N/A no 0.302 0.295 0.365 2e-08
P24068151 Ocs element-binding facto N/A no 0.187 0.423 0.484 7e-08
P42777270 G-box-binding factor 4 OS no no 0.161 0.203 0.527 4e-07
Q04088 398 Probable transcription fa no no 0.222 0.190 0.368 1e-06
>sp|Q99090|CPRF2_PETCR Light-inducible protein CPRF2 OS=Petroselinum crispum GN=CPRF2 PE=2 SV=2 Back     alignment and function desciption
 Score =  253 bits (646), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 182/314 (57%), Positives = 209/314 (66%), Gaps = 58/314 (18%)

Query: 37  MDRVFSVGEISEQFWSNPP-DASSK--MNRSESEWAFQRFLQEAQ-----QPTSS----- 83
           MDRVFSV +IS+QFWS P  + SSK  MNRS+SEWAFQ FLQ+A      QP  S     
Sbjct: 1   MDRVFSVEDISDQFWSPPAREDSSKLVMNRSDSEWAFQSFLQQASALESSQPLPSDPVPV 60

Query: 84  -GDSKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAATSALSFDGTQNL 142
            GD KN   VEI +          N   D+                              
Sbjct: 61  AGDVKNP--VEIPA----------NVPVDS------------------------------ 78

Query: 143 EDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLGSQAP-KGPVHDL 201
           EDYQA LKS+L+LACAAVAL+RAS  +PQD+A   D+GSQ+SNTSQL SQ P KG  HDL
Sbjct: 79  EDYQAYLKSRLDLACAAVALTRASSLKPQDSAALLDNGSQASNTSQLVSQVPPKGSGHDL 138

Query: 202 SRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDD-EAEGETATTENMDPVD 260
           S+ ++K+       P +    KK  + V+S TSGSSRD S+DD E EGET TT N DP D
Sbjct: 139 SKEEDKEALAATATPLLPALQKKSAIQVKSTTSGSSRDHSDDDDELEGETETTRNGDPSD 198

Query: 261 AKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDN 320
           AKRVRRMLSNRESARRSRRRKQAH+TELETQVSQLRVENSSLLKRLTDISQ+YN+AAVDN
Sbjct: 199 AKRVRRMLSNRESARRSRRRKQAHMTELETQVSQLRVENSSLLKRLTDISQRYNDAAVDN 258

Query: 321 RVLKADVETLRAKV 334
           RVLKAD+ET+RAKV
Sbjct: 259 RVLKADIETMRAKV 272
Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Petroselinum crispum (taxid: 4043)
>sp|B9DGI8|BZP63_ARATH Basic leucine zipper 63 OS=Arabidopsis thaliana GN=BZIP63 PE=1 SV=1 Back     alignment and function description
>sp|O22763|BZP10_ARATH Basic leucine zipper 10 OS=Arabidopsis thaliana GN=BZIP10 PE=1 SV=2 Back     alignment and function description
>sp|Q9M1G6|BZP25_ARATH Basic leucine zipper 25 OS=Arabidopsis thaliana GN=BZIP25 PE=1 SV=1 Back     alignment and function description
>sp|Q9FUD3|BZIP9_ARATH Basic leucine zipper 9 OS=Arabidopsis thaliana GN=BZIP9 PE=1 SV=1 Back     alignment and function description
>sp|P12959|OP2_MAIZE Regulatory protein opaque-2 OS=Zea mays GN=O2 PE=1 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN=OBF1 PE=2 SV=2 Back     alignment and function description
>sp|P42777|GBF4_ARATH G-box-binding factor 4 OS=Arabidopsis thaliana GN=GBF4 PE=1 SV=1 Back     alignment and function description
>sp|Q04088|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
255580955 453 Light-inducible protein CPRF-2, putative 0.865 0.651 0.609 5e-84
225451342423 PREDICTED: light-inducible protein CPRF2 0.815 0.657 0.610 9e-74
298204854383 unnamed protein product [Vitis vinifera] 0.815 0.725 0.610 1e-73
224131278385 predicted protein [Populus trichocarpa] 0.736 0.651 0.614 9e-72
16797791 450 bZIP transcription factor [Nicotiana tab 0.835 0.633 0.545 5e-71
444300790 444 bZIP transcription factor family protein 0.829 0.637 0.553 3e-70
147796457 446 hypothetical protein VITISV_022136 [Viti 0.806 0.616 0.574 4e-70
351720703417 bZIP protein [Glycine max] gi|183014149| 0.809 0.661 0.541 9e-69
449442929434 PREDICTED: light-inducible protein CPRF2 0.832 0.654 0.545 1e-68
224123412371 predicted protein [Populus trichocarpa] 0.680 0.625 0.591 1e-66
>gi|255580955|ref|XP_002531296.1| Light-inducible protein CPRF-2, putative [Ricinus communis] gi|223529129|gb|EEF31109.1| Light-inducible protein CPRF-2, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  317 bits (812), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 198/325 (60%), Positives = 228/325 (70%), Gaps = 30/325 (9%)

Query: 37  MDRVFSVGEISEQFWSN------------PPDASSKMNRSESEWAFQRFLQEAQQPTSSG 84
           MDRVFSV  ISEQFWS               D+S K+NRS SEWAFQRFLQEA    S+ 
Sbjct: 1   MDRVFSVDGISEQFWSPPLPPPPPSSSSSAEDSSKKINRSASEWAFQRFLQEANSVASTT 60

Query: 85  D--------------SKNDSVVEIKSAHISNNNNNNNNNTDNQNDNVKAGGGGGNVSKAA 130
           D              + +D+VVEIK    + NN N  N++   + N +   G        
Sbjct: 61  DSSSSSDVVVRDNHKTSDDAVVEIKD---NKNNTNKYNDSSVSSANAQISNGRCAPPPFN 117

Query: 131 TSALSFDGTQNLEDYQAVLKSKLNLACAAVALSRASCARPQDTADRADSGSQSSNTSQLG 190
            +A   +   + EDYQA LKSKLNLACAAVA SRAS  +P+D++ RADSG Q+SNTSQLG
Sbjct: 118 AAAPPPNIPADSEDYQAFLKSKLNLACAAVAQSRASFLKPEDSSARADSGLQASNTSQLG 177

Query: 191 SQAP-KGPVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSEDDEAEGE 249
           S AP KG  HD+ RSQ  DV+G  GIPS+ +T KK +VP++  TSGSSR+ S+DDE EGE
Sbjct: 178 SHAPSKGAGHDVFRSQEVDVDGSVGIPSLPSTHKKSVVPLKPTTSGSSREQSDDDENEGE 237

Query: 250 TATTENMDPVDAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDI 309
           T  TENMDP DAKRVRRMLSNRESARRSRRRKQAHLTELETQV+QLRVENSSLLKRLTDI
Sbjct: 238 TELTENMDPTDAKRVRRMLSNRESARRSRRRKQAHLTELETQVAQLRVENSSLLKRLTDI 297

Query: 310 SQKYNEAAVDNRVLKADVETLRAKV 334
           S KYNE+AVDNRVLKADVETLRAKV
Sbjct: 298 SHKYNESAVDNRVLKADVETLRAKV 322

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225451342|ref|XP_002279520.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|298204854|emb|CBI34161.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224131278|ref|XP_002328499.1| predicted protein [Populus trichocarpa] gi|222838214|gb|EEE76579.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|16797791|gb|AAL27150.1| bZIP transcription factor [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|444300790|gb|AGD98704.1| bZIP transcription factor family protein 6 [Camellia sinensis] Back     alignment and taxonomy information
>gi|147796457|emb|CAN74806.1| hypothetical protein VITISV_022136 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351720703|ref|NP_001237953.1| bZIP protein [Glycine max] gi|183014149|dbj|BAG24402.1| bZIP protein [Glycine max] Back     alignment and taxonomy information
>gi|449442929|ref|XP_004139233.1| PREDICTED: light-inducible protein CPRF2-like [Cucumis sativus] gi|449482986|ref|XP_004156462.1| PREDICTED: light-inducible protein CPRF2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224123412|ref|XP_002319072.1| predicted protein [Populus trichocarpa] gi|222857448|gb|EEE94995.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
TAIR|locus:2184251314 BZO2H3 "AT5G28770" [Arabidopsi 0.384 0.417 0.456 8.8e-32
TAIR|locus:505006398403 BZIP25 "basic leucine zipper 2 0.469 0.397 0.398 1.1e-27
TAIR|locus:2149403277 BZIP9 "AT5G24800" [Arabidopsis 0.401 0.494 0.370 1.2e-15
TAIR|locus:2827461166 bZIP48 "AT2G04038" [Arabidopsi 0.302 0.620 0.300 3e-06
TAIR|locus:2092595173 bZIP42 "AT3G30530" [Arabidopsi 0.255 0.502 0.287 6.5e-05
TAIR|locus:2009932196 bZIP58 "AT1G13600" [Arabidopsi 0.290 0.505 0.28 0.00011
TAIR|locus:2053124171 bZIP2 "AT2G18160" [Arabidopsis 0.222 0.444 0.328 0.00011
TAIR|locus:2184251 BZO2H3 "AT5G28770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 256 (95.2 bits), Expect = 8.8e-32, Sum P(2) = 8.8e-32
 Identities = 63/138 (45%), Positives = 84/138 (60%)

Query:   197 PVHDLSRSQNKDVNGLHGIPSISTTLKKPLVPVRSATSGSSRDLSXXXXXXXXXXXXXNM 256
             P     RS N   N      S++++   P++   + TSGS  +LS             NM
Sbjct:    95 PQDTSGRSDNGGANESEQA-SLASSKATPMMS-SAITSGS--ELSGDEEEADGET---NM 147

Query:   257 DPVDAKRVRRMLXXXXXXXXXXXXKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEA 316
             +P + KRV+RML            KQAHL+ELETQVSQLRVENS L+K LTD++Q +N+A
Sbjct:   148 NPTNVKRVKRMLSNRESARRSRRRKQAHLSELETQVSQLRVENSKLMKGLTDVTQTFNDA 207

Query:   317 AVDNRVLKADVETLRAKV 334
             +V+NRVLKA++ETLRAKV
Sbjct:   208 SVENRVLKANIETLRAKV 225
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0005515 "protein binding" evidence=IPI
GO:0042802 "identical protein binding" evidence=IPI
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0071333 "cellular response to glucose stimulus" evidence=IEP
GO:0071215 "cellular response to abscisic acid stimulus" evidence=IEP
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:505006398 BZIP25 "basic leucine zipper 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149403 BZIP9 "AT5G24800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827461 bZIP48 "AT2G04038" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092595 bZIP42 "AT3G30530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009932 bZIP58 "AT1G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
smart0033865 smart00338, BRLZ, basic region leucin zipper 2e-15
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 5e-10
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 4e-06
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 1e-05
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 69.5 bits (171), Expect = 2e-15
 Identities = 26/63 (41%), Positives = 36/63 (57%)

Query: 260 DAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVD 319
           D KR RR   NRE+ARRSR RK+A + ELE +V QL  EN  L K +  + ++  +   +
Sbjct: 3   DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62

Query: 320 NRV 322
              
Sbjct: 63  LEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 341
smart0033865 BRLZ basic region leucin zipper. 99.33
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.3
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 99.2
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.17
KOG0709 472 consensus CREB/ATF family transcription factor [Tr 99.16
KOG3584348 consensus cAMP response element binding protein an 99.0
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.0
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.02
KOG0837279 consensus Transcriptional activator of the JUN fam 97.9
KOG4571294 consensus Activating transcription factor 4 [Trans 97.42
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.77
KOG3119269 consensus Basic region leucine zipper transcriptio 96.64
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.14
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 95.36
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 95.11
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 94.73
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 94.62
PRK13169110 DNA replication intiation control protein YabA; Re 94.62
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.61
COG307479 Uncharacterized protein conserved in bacteria [Fun 94.31
PRK13169110 DNA replication intiation control protein YabA; Re 94.21
COG4467114 Regulator of replication initiation timing [Replic 93.82
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 93.66
PRK10884206 SH3 domain-containing protein; Provisional 93.59
PRK10884206 SH3 domain-containing protein; Provisional 93.42
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.37
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 93.3
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.16
PRK1542279 septal ring assembly protein ZapB; Provisional 92.81
TIGR0244965 conserved hypothetical protein TIGR02449. Members 92.36
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 92.29
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 89.91
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 89.27
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 87.61
PRK11637 428 AmiB activator; Provisional 87.51
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 87.42
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 87.32
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 87.19
PF13851201 GAS: Growth-arrest specific micro-tubule binding 87.11
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 87.02
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 86.81
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 86.76
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 86.75
COG4467114 Regulator of replication initiation timing [Replic 86.3
PRK00888105 ftsB cell division protein FtsB; Reviewed 86.08
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 85.43
smart0034044 HALZ homeobox associated leucin zipper. 85.39
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 85.21
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 85.12
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 85.03
PF15294278 Leu_zip: Leucine zipper 84.87
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 84.87
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 84.54
PRK11637 428 AmiB activator; Provisional 84.54
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 84.4
PRK1542279 septal ring assembly protein ZapB; Provisional 84.32
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 84.1
PRK0211973 hypothetical protein; Provisional 83.94
PRK0440675 hypothetical protein; Provisional 83.58
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 83.43
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 83.4
PF1374789 DUF4164: Domain of unknown function (DUF4164) 82.97
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 82.24
COG4026290 Uncharacterized protein containing TOPRIM domain, 81.21
PRK0084677 hypothetical protein; Provisional 80.73
PF14662 193 CCDC155: Coiled-coil region of CCDC155 80.69
PRK13922 276 rod shape-determining protein MreC; Provisional 80.61
PRK0432574 hypothetical protein; Provisional 80.45
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 80.28
KOG1962216 consensus B-cell receptor-associated protein and r 80.1
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 80.1
PHA03162135 hypothetical protein; Provisional 80.01
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.33  E-value=9.5e-12  Score=94.46  Aligned_cols=61  Identities=43%  Similarity=0.578  Sum_probs=53.9

Q ss_pred             HHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHH
Q 019400          260 DAKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNEAAVDN  320 (341)
Q Consensus       260 e~KR~RRklsNRESARRSR~RKka~leeLE~qV~~L~~EN~~L~~rl~~L~qk~~~l~~EN  320 (341)
                      +.|+.||+++||+||++||.||++|+.+||.+|..|+.+|..|..++..|..++..+..+|
T Consensus         3 ~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             cHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6799999999999999999999999999999999999999999999988865555554443

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PHA03162 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 1e-14
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 2e-09
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 9e-09
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 4e-08
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 5e-08
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 7e-08
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 1e-07
2wt7_B90 Transcription factor MAFB; transcription, transcri 3e-07
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 1e-05
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 1e-05
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 1e-04
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 66.7 bits (163), Expect = 1e-14
 Identities = 20/52 (38%), Positives = 34/52 (65%)

Query: 262 KRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKY 313
           KR  R++ NRE+AR SRR+K+ ++  LE +V+ L  +N +L++ L  +   Y
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.51
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.28
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.25
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.18
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.16
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.94
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.8
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.51
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.46
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.38
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.03
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.16
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.78
1deb_A54 APC protein, adenomatous polyposis coli protein; c 94.99
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.97
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.85
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 93.32
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 91.7
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 90.83
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 90.79
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 90.54
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 89.98
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 88.86
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 88.81
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 88.63
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 88.63
3cve_A72 Homer protein homolog 1; coiled coil, alternative 88.31
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 87.85
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 87.53
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 87.39
3m48_A33 General control protein GCN4; leucine zipper, synt 87.26
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 87.21
1p9i_A31 Cortexillin I/GCN4 hybrid peptide; coiled-coil, un 87.14
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 86.96
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 86.79
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 86.15
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 85.91
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 84.97
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 84.29
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 84.18
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 83.74
3m48_A33 General control protein GCN4; leucine zipper, synt 83.43
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 82.51
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 82.45
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 82.06
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 81.92
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 81.65
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 81.56
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 81.11
3bas_A89 Myosin heavy chain, striated muscle/general contro 80.87
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 80.2
3u06_A 412 Protein claret segregational; motor domain, stalk 80.18
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 80.13
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 80.05
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.51  E-value=1.7e-14  Score=107.06  Aligned_cols=52  Identities=38%  Similarity=0.626  Sum_probs=48.5

Q ss_pred             HHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHH
Q 019400          262 KRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKY  313 (341)
Q Consensus       262 KR~RRklsNRESARRSR~RKka~leeLE~qV~~L~~EN~~L~~rl~~L~qk~  313 (341)
                      ||++||++||+||++||.||++|+++||.+|..|+.||..|..++..|.+.|
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5889999999999999999999999999999999999999999998887654
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 91.04
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=91.04  E-value=0.046  Score=41.00  Aligned_cols=28  Identities=25%  Similarity=0.394  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHhhHHHHHHHHHHHHHHHH
Q 019400          260 DAKRVRRMLSNRESARRSRRRKQAHLTE  287 (341)
Q Consensus       260 e~KR~RRklsNRESARRSR~RKka~lee  287 (341)
                      -.+-.||.=+|+.+||++|+||....++
T Consensus        46 lirDIRRRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          46 LIRKIRRRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence            4678899999999999999999887654