Citrus Sinensis ID: 019432

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
cHHHHHHHHHHccccEEEEccccccccccccccccccccccccEEEEEccccccccccccccccccccHHHHHHHHHHccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHccccccEEEEccEEEEEccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEEEcccccEEEEccccccEEEcccccccccccccccEEEEcccEEEEEEEccccccEEccccccccccEEEEEccccEEEEEcccccEEEEEccccccEEEEEcEEccccccccccccEEEEEEcccccccccccccccccccccccccccEEcccc
ccHHHHHHHHccccEEEEEEccccccccccccccccEEccccEEEEEEEEEcccccccccccccccHHHHHHHHHHHHccHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEEcccEEEEcccccccccEEEEcccccccccHHHHHHHHHHHccccccccccccccEEEEccccccEEEEEcccccEEEcccccccccEEccccEEEEEcccEEEEEcccccccEEccccccccccEEEEEcccEEEEEEcccccEEEEEccccccEEEcccEEccccccccccccEEEEEEccccccccccHHccccHcccccHHHHHHHHccc
MQLGAEAVHAANPEVLVILSglnfdkdlSFVRNQAVNLTFTGKLVFEAHwygftdgqawvdgnpnqvcgrvVDNVMRLSGFlleqgwplfvsefgadlrgnnvndnrylnCFFGVAAELDWDWALWTLVGSYYLREGVIGLNeyyglfdwnwcdirnSSFLERISslqspfrgpgvfetglhkviyhpatglcvqrksfldpltlgpcteseawsytphktislkGAYFCLqakhvgkpaklgiictdcgstweIISDskmhlsskadngttvcldvdssntivtntckclsrdktcdpasqwfklvdstrsstttksffqfnpildlpgkdFIWKFFGLF
mqlgaeavhaanPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNtckclsrdktcdpasQWFKLVDstrsstttksffqfnpildlpgkDFIWKFFGLF
MQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDstrsstttksFFQFNPILDLPGKDFIWKFFGLF
*********AANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGL*
**LGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQ**********TGLHKVIYHPATGLCVQRK***************AWSYTPHKTISLKGAYFCLQAKHVGKPA************WEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDS***************ILDLPGKDFIWKFFGLF
********HAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
*QLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETGLHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPAKLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPASQWFKLVDSTRSSTTTKSFFQFNPILDLPGKDFIWKFFGLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
255547996 566 hydrolase, hydrolyzing O-glycosyl compou 0.997 0.600 0.762 1e-158
224102379 544 predicted protein [Populus trichocarpa] 0.994 0.623 0.738 1e-151
224110842 513 predicted protein [Populus trichocarpa] 0.929 0.617 0.760 1e-145
225424600 552 PREDICTED: uncharacterized protein LOC10 0.967 0.597 0.701 1e-137
356511061 557 PREDICTED: uncharacterized protein LOC10 0.932 0.570 0.704 1e-137
449435438 549 PREDICTED: uncharacterized protein LOC10 0.944 0.586 0.674 1e-128
449527929421 PREDICTED: uncharacterized LOC101217177, 0.944 0.764 0.674 1e-128
356528434 574 PREDICTED: uncharacterized protein LOC10 0.970 0.576 0.630 1e-126
356511059 571 PREDICTED: endoglucanase E1-like [Glycin 0.970 0.579 0.636 1e-126
356541382 544 PREDICTED: endoglucanase-like [Glycine m 0.917 0.575 0.659 1e-125
>gi|255547996|ref|XP_002515055.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223546106|gb|EEF47609.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 260/341 (76%), Positives = 296/341 (86%), Gaps = 1/341 (0%)

Query: 1   MQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWV 60
           M+ GAEAVH+ANP+VLVILSGLN+DKD SF+RN+ VNL+FTGK+VFE HWYGF+DGQAW 
Sbjct: 225 MEKGAEAVHSANPDVLVILSGLNYDKDFSFLRNRPVNLSFTGKVVFEVHWYGFSDGQAWR 284

Query: 61  DGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELD 120
            GNPNQVCGRVVDN+MR+SGFLLEQGWP+FVSEFG D RG NVNDNRYL CF GVAAELD
Sbjct: 285 SGNPNQVCGRVVDNLMRISGFLLEQGWPMFVSEFGVDQRGTNVNDNRYLGCFIGVAAELD 344

Query: 121 WDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETG 180
           WDWALWTLVGSYYLR+GVIGLNEYYG+ +WNWCD+RNSSFL++IS+LQSPF+GPG+ ET 
Sbjct: 345 WDWALWTLVGSYYLRQGVIGLNEYYGVLNWNWCDVRNSSFLQQISALQSPFQGPGLSETN 404

Query: 181 LHKVIYHPATGLCVQRKSFLDPLTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGKPA 240
            HKVI+HP+TGLCVQRKS L+PL LG CT+SEAW YT   T++L+G YFCLQA  +GKPA
Sbjct: 405 PHKVIFHPSTGLCVQRKSMLEPLRLGSCTDSEAWRYTSENTLTLRGTYFCLQADELGKPA 464

Query: 241 KLGIICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTCDPA 300
           KLGIICTD  S W++ISDSKMHLSSK  NGT VCLDVDS+NTIV +TCKCLSRD TCDP 
Sbjct: 465 KLGIICTDSTSKWDVISDSKMHLSSKITNGTAVCLDVDSNNTIVISTCKCLSRDNTCDPE 524

Query: 301 SQWFKLVDSTRSSTTTKSFFQFNPI-LDLPGKDFIWKFFGL 340
           SQWFKLV+STRSS T K   + N I LDLP K+F WKF GL
Sbjct: 525 SQWFKLVNSTRSSATAKPSLRINSILLDLPAKEFFWKFLGL 565

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224102379|ref|XP_002312657.1| predicted protein [Populus trichocarpa] gi|222852477|gb|EEE90024.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110842|ref|XP_002315653.1| predicted protein [Populus trichocarpa] gi|222864693|gb|EEF01824.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225424600|ref|XP_002285424.1| PREDICTED: uncharacterized protein LOC100244027 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511061|ref|XP_003524250.1| PREDICTED: uncharacterized protein LOC100790415 [Glycine max] Back     alignment and taxonomy information
>gi|449435438|ref|XP_004135502.1| PREDICTED: uncharacterized protein LOC101217177 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449527929|ref|XP_004170960.1| PREDICTED: uncharacterized LOC101217177, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356528434|ref|XP_003532808.1| PREDICTED: uncharacterized protein LOC100818309 [Glycine max] Back     alignment and taxonomy information
>gi|356511059|ref|XP_003524249.1| PREDICTED: endoglucanase E1-like [Glycine max] Back     alignment and taxonomy information
>gi|356541382|ref|XP_003539156.1| PREDICTED: endoglucanase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
TAIR|locus:2031850552 AT1G13130 [Arabidopsis thalian 0.891 0.550 0.567 1.1e-96
TAIR|locus:2093551551 AT3G26130 [Arabidopsis thalian 0.956 0.591 0.502 3.7e-87
TAIR|locus:2093571508 AT3G26140 [Arabidopsis thalian 0.888 0.596 0.522 5.4e-86
TAIR|locus:2157482526 AT5G17500 [Arabidopsis thalian 0.882 0.572 0.524 1.2e-83
TAIR|locus:2149005488 AT5G16700 [Arabidopsis thalian 0.401 0.280 0.557 4.2e-67
UNIPROTKB|G4N8V8423 MGG_03374 "Beta-1,6-galactanas 0.466 0.375 0.306 1.3e-11
ASPGD|ASPL0000037062412 AN9166 [Emericella nidulans (t 0.466 0.385 0.265 1.6e-07
UNIPROTKB|G4MKY3480 MGG_05381 "Beta-1,6-galactanas 0.222 0.158 0.263 2.9e-07
TAIR|locus:2031850 AT1G13130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 961 (343.3 bits), Expect = 1.1e-96, P = 1.1e-96
 Identities = 176/310 (56%), Positives = 224/310 (72%)

Query:     1 MQLGAEAVHAANPEVLVILSGLNFDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQAWV 60
             MQ GAEAVH+AN +VLVILSGL+FD DLSFVR++ V L+FTGKLVFE HWY F+DG +W 
Sbjct:   227 MQQGAEAVHSANNKVLVILSGLSFDADLSFVRSRPVKLSFTGKLVFELHWYSFSDGNSWA 286

Query:    61 DGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELD 120
               NPN +CGRV++ +    G+LL QG+PLF+SEFG D RG N NDNRY  C  G AAE D
Sbjct:   287 ANNPNDICGRVLNRIGNGGGYLLNQGFPLFLSEFGIDERGVNTNDNRYFGCLTGWAAEND 346

Query:   121 WDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISSLQSPFRGPGVFETG 180
              DW+LW L GSYYLR+G +G+NEYYG+ D +W  +RNSSFL++IS LQSP +GPG   T 
Sbjct:   347 VDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNSSFLQKISFLQSPLQGPGP-RTD 405

Query:   181 LHKVIYHPATGLCVQRKSFLDP--LTLGPCTESEAWSYTPHKTISLKGAYFCLQAKHVGK 238
              + +++HP TGLC+ R S  DP  LTLGPC  SE WSYT  K + +K    CLQ+     
Sbjct:   406 AYNLVFHPLTGLCIVR-SLDDPKMLTLGPCNSSEPWSYTK-KALRIKDQQLCLQSNGPKN 463

Query:   239 PAKLG-IICTDCGSTWEIISDSKMHLSSKADNGTTVCLDVDSSNTIVTNTCKCLSRDKTC 297
             P  +    C+  GS W+ IS S+MHL+S   N T++CLDVD++N +V N CKCLS+DK+C
Sbjct:   464 PVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTSLCLDVDTANNVVANACKCLSKDKSC 523

Query:   298 DPASQWFKLV 307
             +P SQWFK++
Sbjct:   524 EPMSQWFKII 533
GO:0003824 "catalytic activity" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA;ISS
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0043169 "cation binding" evidence=IEA
TAIR|locus:2093551 AT3G26130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093571 AT3G26140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157482 AT5G17500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149005 AT5G16700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8V8 MGG_03374 "Beta-1,6-galactanase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000037062 AN9166 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MKY3 MGG_05381 "Beta-1,6-galactanase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
cd00161124 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydr 5e-04
smart00458118 smart00458, RICIN, Ricin-type beta-trefoil 6e-04
pfam00150269 pfam00150, Cellulase, Cellulase (glycosyl hydrolas 0.001
>gnl|CDD|238092 cd00161, RICIN, Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information 
 Score = 39.0 bits (91), Expect = 5e-04
 Identities = 30/113 (26%), Positives = 43/113 (38%), Gaps = 19/113 (16%)

Query: 189 ATGLCVQRKSFLD--PLTLGPCTESEA---WSYTPHKTISLKGAYFCLQAKHVGKPAKLG 243
            TGLC+      D  P+ L PC  +     W+ T   TI +K +  CL        +K+ 
Sbjct: 8   NTGLCLDVNGGSDGGPVQLYPCHGNGNNQKWTLTSDGTIRIKSSNLCLDVGGDAPGSKVR 67

Query: 244 II-CTDCGST--WEIISDSK-MHLSSKADNGTTVCLDVDSSNT----IVTNTC 288
           +  C+       W    D    +L S        CLDV   NT    ++  TC
Sbjct: 68  LYTCSGGSDNQRWTFNKDGTIRNLKSG------KCLDVKGGNTNGTNLILWTC 114

The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture. Length = 124
>gnl|CDD|214672 smart00458, RICIN, Ricin-type beta-trefoil Back     alignment and domain information
>gnl|CDD|215751 pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 341
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 99.48
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 99.13
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 98.99
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 98.83
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 98.08
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 98.08
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 98.0
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 97.81
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 97.72
KOG3736578 consensus Polypeptide N-acetylgalactosaminyltransf 97.2
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 96.52
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 95.92
KOG3738559 consensus Predicted polypeptide N-acetylgalactosam 95.86
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 92.23
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 91.91
KOG3736578 consensus Polypeptide N-acetylgalactosaminyltransf 90.15
KOG3737603 consensus Predicted polypeptide N-acetylgalactosam 87.35
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 85.67
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information 
Probab=99.48  E-value=9.5e-14  Score=128.61  Aligned_cols=124  Identities=20%  Similarity=0.360  Sum_probs=93.6

Q ss_pred             hhHHHHHHhcCCCcEEEEcCCCCCCCchh-hhcccccccCCCcEEEEeeecCCCCC-ccccCCCCCcchhhHHHHHHhhh
Q 019432            2 QLGAEAVHAANPEVLVILSGLNFDKDLSF-VRNQAVNLTFTGKLVFEAHWYGFTDG-QAWVDGNPNQVCGRVVDNVMRLS   79 (341)
Q Consensus         2 ~~ga~aIhaaNPn~LIIVsG~~~~~DLs~-v~~~Pv~l~~~~KLVYs~H~Y~~s~~-~~W~~~~~~~~c~~l~~~l~~~~   79 (341)
                      +++.++||+++|+.+|+|+|..|..++.. +.+.|..  ..+++||++|.|.+... ..+... ....-..+.+.+....
T Consensus       153 ~~~~~~Ir~~~~~~~i~~~~~~~~~~~~~~~~~~P~~--~~~~~~~~~H~Y~~~~~~~~~~~~-~~~~~~~~~~~~~~~~  229 (281)
T PF00150_consen  153 QRAIDAIRAADPNHLIIVGGGGWGADPDGAAADNPND--ADNNDVYSFHFYDPYDFSDQWNPG-NWGDASALESSFRAAL  229 (281)
T ss_dssp             HHHHHHHHHTTSSSEEEEEEHHHHTBHHHHHHHSTTT--TTTSEEEEEEEETTTCHHTTTSTC-SHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhcCCcceeecCCCccccccchhhhcCccc--ccCceeEEeeEeCCCCcCCccccc-cchhhhHHHHHHHHHH
Confidence            67899999999999999999999998887 6666622  25789999999996542 222110 0011233456666666


Q ss_pred             hhhhhcCCceEEeecccCCCCCCcCchHHHHHHHHHHHhCCcceEeeecc
Q 019432           80 GFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAAELDWDWALWTLV  129 (341)
Q Consensus        80 gfll~~~~Pl~isEFG~~~~g~~~~d~~w~~~l~~yl~e~~i~Wa~W~l~  129 (341)
                      .++.+.+.||+|+|||....+.+ ....++..+++++++++++|++|++.
T Consensus       230 ~~~~~~g~pv~~gE~G~~~~~~~-~~~~~~~~~~~~~~~~~~g~~~W~~~  278 (281)
T PF00150_consen  230 NWAKKNGKPVVVGEFGWSNNDGN-GSTDYADAWLDYLEQNGIGWIYWSWK  278 (281)
T ss_dssp             HHHHHTTSEEEEEEEESSTTTSC-HHHHHHHHHHHHHHHTTCEEEECEES
T ss_pred             HHHHHcCCeEEEeCcCCcCCCCC-cCHHHHHHHHHHHHHCCCeEEEEecC
Confidence            77777889999999999854332 34688889999999999999999996

2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 5 GH5 from CAZY comprises enzymes with several known activities; endoglucanase (3.2.1.4 from EC); beta-mannanase (3.2.1.78 from EC); exo-1,3-glucanase (3.2.1.58 from EC); endo-1,6-glucanase (3.2.1.75 from EC); xylanase (3.2.1.8 from EC); endoglycoceramidase (3.2.1.123 from EC). The microbial degradation of cellulose and xylans requires several types of enzymes. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family A [] or as the glycosyl hydrolases family 5 []. One of the conserved regions in this family contains a conserved glutamic acid residue which is potentially involved [] in the catalytic mechanism.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3NDY_A 3NDZ_B 1LF1_A 1TVP_B 1TVN_A 3AYR_A 3AYS_A 1QI0_A 1W3K_A 1OCQ_A ....
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>KOG3738 consensus Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3737 consensus Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 3e-24
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 6e-17
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 3e-10
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 2e-09
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 2e-09
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 2e-09
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 3e-09
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 9e-09
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 1e-08
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 2e-07
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 4e-07
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 8e-07
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 9e-07
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 1e-06
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 2e-06
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 2e-06
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 3e-06
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 3e-06
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 2e-05
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 3e-05
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 1e-04
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 1e-04
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 4e-04
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 5e-04
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Length = 358 Back     alignment and structure
 Score =  100 bits (250), Expect = 3e-24
 Identities = 31/189 (16%), Positives = 61/189 (32%), Gaps = 28/189 (14%)

Query: 1   MQLGAEAVHAANPEVLVILSGLN--------FDKDLSFVRNQAVNLTFTGKLVFEAHWYG 52
            +    AV + NP +L+ + G+         +  +L       V L    +LV+ AH Y 
Sbjct: 182 AERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYA 241

Query: 53  FTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQ-GWPLFVSEFGADLRGNNVNDNRYLNC 111
            +        +P      +     +  G+L  Q   P+++ EFG  L+     D  +L  
Sbjct: 242 TSVYPQTWFSDPTF-PNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQST--TDQTWLKT 298

Query: 112 F------FGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERIS 165
                          + W  W+               +  G+   +W  +        ++
Sbjct: 299 LVQYLRPTAQYGADSFQWTFWSWNPDS---------GDTGGILKDDWQTVDT-VKDGYLA 348

Query: 166 SLQSPFRGP 174
            ++S    P
Sbjct: 349 PIKSSIFDP 357
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Length = 364 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Length = 302 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Length = 327 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Length = 303 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Length = 306 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Length = 464 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Length = 345 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Length = 294 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Length = 291 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Length = 293 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Length = 305 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Length = 340 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 99.97
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 99.88
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 99.79
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 99.75
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 99.75
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 99.75
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 99.75
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.74
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 99.73
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 99.73
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 99.72
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 99.71
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 99.67
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 99.67
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 99.65
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 99.64
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 99.63
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 99.62
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.6
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 99.6
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 99.59
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 99.59
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 99.56
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 99.56
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 99.54
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 99.53
3a07_A118 Actinohivin; carbohydrate-binding module family 13 99.48
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.42
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 99.36
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 99.36
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 99.35
2y8k_A491 Arabinoxylanase, carbohydrate binding family 6; hy 99.34
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 99.22
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 99.18
1abr_B267 Abrin-A; glycosidase/carbohydrate complex, lectin, 99.18
3c9z_A258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 99.17
1ggp_B254 TKL-1, protein (lectin 1 B chain); sugar binding p 99.14
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.13
3phz_A 286 Ricin B-related lectin; beta trefoil, saccharide b 99.13
1m2t_B263 Mistletoe lectin I B chain; ribosome inactivation, 99.1
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 99.04
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 99.02
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 99.0
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 98.99
3ef2_A 293 Agglutinin, lectin; beta-trefoil, calcium-binding, 98.97
2vlc_A570 Cinnamomin, type 2 ribosome-inactivating protein c 98.95
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 98.94
1ggp_B254 TKL-1, protein (lectin 1 B chain); sugar binding p 98.92
3c9z_A258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 98.91
1m2t_B263 Mistletoe lectin I B chain; ribosome inactivation, 98.91
1abr_B267 Abrin-A; glycosidase/carbohydrate complex, lectin, 98.89
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 98.88
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 98.87
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 98.86
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 98.81
3a07_A118 Actinohivin; carbohydrate-binding module family 13 98.76
2vlc_A570 Cinnamomin, type 2 ribosome-inactivating protein c 98.69
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 98.63
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 98.62
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 98.59
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 98.54
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 98.53
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 98.46
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 98.45
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 98.39
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 98.37
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 98.34
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 98.32
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 98.2
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 98.18
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 98.16
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 98.14
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 98.13
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 98.06
3phz_A286 Ricin B-related lectin; beta trefoil, saccharide b 98.05
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 98.02
3ef2_A293 Agglutinin, lectin; beta-trefoil, calcium-binding, 98.01
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 98.0
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 97.97
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 97.92
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 97.69
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 97.65
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 97.28
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 97.19
1sr4_A206 CDT A, cytolethal distending toxin subunit A; bact 96.51
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 96.48
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 96.42
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 96.39
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 96.31
4ekj_A500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 95.95
1w91_A503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 95.44
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 95.16
1uhv_A500 Beta-xylosidase; family 39 glycoside hydrolase, xy 94.71
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 94.0
4aw7_A591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 92.99
1sr4_A206 CDT A, cytolethal distending toxin subunit A; bact 92.69
1xez_A721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 92.39
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 91.93
2x2s_A153 Agglutinin, agglutinin SSA; fungal lectin, beta-tr 91.9
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 91.14
1xez_A 721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 90.97
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 90.7
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 90.68
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 90.55
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 90.36
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 87.93
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 86.56
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 86.39
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 84.21
2w61_A555 GAS2P, glycolipid-anchored surface protein 2; glyc 83.53
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 82.82
1qw9_A502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 81.73
3cmg_A667 Putative beta-galactosidase; structural genomics, 81.2
2c7f_A513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 80.76
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
Probab=99.97  E-value=2.3e-32  Score=275.42  Aligned_cols=157  Identities=20%  Similarity=0.365  Sum_probs=139.2

Q ss_pred             ChhHHHHHHhcCCCcEEEEcCCCCCC-----------------CchhhhcccccccCCCcEEEEeeecCCCCC-ccccCC
Q 019432            1 MQLGAEAVHAANPEVLVILSGLNFDK-----------------DLSFVRNQAVNLTFTGKLVFEAHWYGFTDG-QAWVDG   62 (341)
Q Consensus         1 m~~ga~aIhaaNPn~LIIVsG~~~~~-----------------DLs~v~~~Pv~l~~~~KLVYs~H~Y~~s~~-~~W~~~   62 (341)
                      |++++++||++||+++|||+|++|++                 ||++++++||++. .+||||++|+|+++++ ++|+. 
T Consensus       233 ~~~ai~aIRa~dp~~lIiv~G~~w~~~~~~~~~~~~~~~wwg~~l~~v~~~Pi~l~-~~nlvYs~H~Y~~~~~~~~~~~-  310 (458)
T 3qho_A          233 AERIGKAILKVAPHWLIFVEGTQFTNPKTDSSYKWGYNAWWGGNLMAVKDYPVNLP-RNKLVYSPHVFGPDVYNQPYFG-  310 (458)
T ss_dssp             HHHHHHHHHHHCTTCEEEECCBSCCCHHHHHTSTTTTCCCTTCBCGGGTTSCCCSC-TTTEEECCBCCCTTTCCCGGGS-
T ss_pred             HHHHHHHHHHhCCCCEEEEcCCcccCccccccccccccCcCCCCchhhhcCCCcCC-CCCEEEEEEECCCCCCCCcccc-
Confidence            47899999999999999999999987                 9999999999986 6899999999999986 47763 


Q ss_pred             CCCcchhhHHHHHHhhhhhhh-hcCCceEEeecccCCCC-CCcCchHHHHHHHHHHHhCCc-ceEeeeccceEeeecccc
Q 019432           63 NPNQVCGRVVDNVMRLSGFLL-EQGWPLFVSEFGADLRG-NNVNDNRYLNCFFGVAAELDW-DWALWTLVGSYYLREGVI  139 (341)
Q Consensus        63 ~~~~~c~~l~~~l~~~~gfll-~~~~Pl~isEFG~~~~g-~~~~d~~w~~~l~~yl~e~~i-~Wa~W~l~GsYy~R~g~~  139 (341)
                      +.+.+|+++.+.|+++++|+. ++++||||||||+.+.+ .+..+.+|+++|++||++++| +|++|+++         +
T Consensus       311 ~~~~~~~~~~~~w~~~~g~l~~~~~~Pl~igEfG~~~~~g~~~~~~~w~~~~~~yl~~~~i~~w~~W~~n---------p  381 (458)
T 3qho_A          311 PAKGFPDNLPDIWYHHFGYVKLELGYSVVIGEFGGKYGHGGDPRDVIWQNKLVDWMIENKFCDFFYWSWN---------P  381 (458)
T ss_dssp             GGGTTTTTHHHHHHHHTTHHHHTTCCCBCBCBCCCCTTSSSCTHHHHHHHHHHHHHHHTTCCCEEESCSS---------S
T ss_pred             CccchHHHHHHHHHhhhhhHhhcCCCcEEEEecCCCcCCCCCcchHHHHHHHHHHHHhcCCCCEEEEecC---------C
Confidence            345788999999999999997 68999999999999853 455578999999999999997 89999999         8


Q ss_pred             CCCceeeccccCCCcccchhHHHHhhcccCCCC
Q 019432          140 GLNEYYGLFDWNWCDIRNSSFLERISSLQSPFR  172 (341)
Q Consensus       140 ~~dEt~GLl~~dW~t~rn~~~l~rl~~l~~~~~  172 (341)
                      +++||+|||++||++||++|+    +.|++.+.
T Consensus       382 ~s~dt~Gll~~dW~t~~~~k~----~~l~~~~~  410 (458)
T 3qho_A          382 DSGDTGGILQDDWTTIWEDKY----NNLKRLMD  410 (458)
T ss_dssp             CCTTTCCSBCTTSSSBCHHHH----HHHGGGGC
T ss_pred             CCCCCCcccccccCCcChHHH----HHHHHHhc
Confidence            999999999999999999997    55555553
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>2x2s_A Agglutinin, agglutinin SSA; fungal lectin, beta-trefoil domain, cell adhesion; 1.60A {Sclerotinia sclerotiorum} PDB: 2x2t_A* Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 341
d1ecea_358 c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellul 7e-15
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 1e-11
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 1e-09
d1g01a_357 c.1.8.3 (A:) Alkaline cellulase K catalytic domain 5e-08
d1bqca_302 c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca 3e-07
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 2e-06
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 4e-06
d1egza_291 c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysant 5e-06
d7a3ha_300 c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradh 6e-06
d1tvna1293 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalter 9e-04
d1wkya2297 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JA 0.002
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Length = 358 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Endocellulase E1
species: Acidothermus cellulolyticus [TaxId: 28049]

 Score = 72.4 bits (176), Expect = 7e-15
 Identities = 28/188 (14%), Positives = 57/188 (30%), Gaps = 26/188 (13%)

Query: 1   MQLGAEAVHAANPEVLVILSGLNF--------DKDLSFVRNQAVNLTFTGKLVFEAHWYG 52
            +    AV + NP +L+ + G+            +L       V L    +LV+ AH Y 
Sbjct: 182 AERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYA 241

Query: 53  FTDGQAWVDGNPNQVCGRVVDNVMRLSGFLLEQGWPLFVSEFGADLRGNNVNDNRYLNCF 112
            +        +P                   +   P+++ EFG  L+     D  +L   
Sbjct: 242 TSVYPQTWFSDPTFPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQST--TDQTWLKTL 299

Query: 113 ------FGVAAELDWDWALWTLVGSYYLREGVIGLNEYYGLFDWNWCDIRNSSFLERISS 166
                         + W  W+               +  G+   +W  + ++     ++ 
Sbjct: 300 VQYLRPTAQYGADSFQWTFWSWNPDS---------GDTGGILKDDWQTV-DTVKDGYLAP 349

Query: 167 LQSPFRGP 174
           ++S    P
Sbjct: 350 IKSSIFDP 357
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Length = 357 Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Length = 302 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Length = 291 Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Length = 300 Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Length = 293 Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Length = 297 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 99.8
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 99.72
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 99.7
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 99.69
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 99.69
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 99.54
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 99.54
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 99.51
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 99.49
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 99.48
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 99.42
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 99.4
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 99.39
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 99.3
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 99.28
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 99.22
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 99.19
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 99.12
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 99.09
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 99.08
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 99.08
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 99.05
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 99.03
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 99.02
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 98.93
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 98.87
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 98.84
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.81
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 98.81
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 98.73
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.42
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 98.42
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 98.39
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.36
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 98.35
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.32
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 98.3
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 98.25
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 98.24
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 98.24
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.24
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.22
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 98.19
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 98.12
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 98.11
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 98.04
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 97.99
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 97.94
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 97.91
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 97.87
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 97.82
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 97.81
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 97.77
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 97.77
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 97.72
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 97.56
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 97.27
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 97.16
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 96.97
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 96.82
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 96.79
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 96.61
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 96.57
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 96.52
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 96.0
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 95.95
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 95.89
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 95.61
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 95.07
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 92.42
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 90.41
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 86.9
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 84.87
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 84.76
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 80.04
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Endocellulase E1
species: Acidothermus cellulolyticus [TaxId: 28049]

Probab=99.80  E-value=1.7e-19  Score=167.68  Aligned_cols=160  Identities=19%  Similarity=0.389  Sum_probs=124.2

Q ss_pred             ChhHHHHHHhcCCCcEEEEcCCC--------CCCCchhhhcccccccCCCcEEEEeeecCCCCCc-cccCCCCCcchhhH
Q 019432            1 MQLGAEAVHAANPEVLVILSGLN--------FDKDLSFVRNQAVNLTFTGKLVFEAHWYGFTDGQ-AWVDGNPNQVCGRV   71 (341)
Q Consensus         1 m~~ga~aIhaaNPn~LIIVsG~~--------~~~DLs~v~~~Pv~l~~~~KLVYs~H~Y~~s~~~-~W~~~~~~~~c~~l   71 (341)
                      +++++++||+++|+.+|||+|..        |+.++.+....++.+...+++||++|.|++.... .+..  ....+..+
T Consensus       182 ~~~~~~~Ir~~d~~~~v~v~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~H~Y~~~~~~~~~~~--~~~~~~~~  259 (358)
T d1ecea_         182 AERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFS--DPTFPNNM  259 (358)
T ss_dssp             HHHHHHHHHHHCTTSEEEEECBSEETTEECSTTTBCTTTTTSCCCCSSSSCEEEEEECCCTTTCCCGGGS--CTTTTTTH
T ss_pred             HHHHHHHHHhhCCCcEEEEeccccCccccccccccccchhhCCccCCccCceEEEeeecCCCcCCccccc--cchhhhhH
Confidence            36889999999999999999876        4557888888888777788999999999876532 2221  12334456


Q ss_pred             HHHHHhhhhhhhh-cCCceEEeecccCCCCCCcCchHHHHHHHHHHH------hCCcceEeeeccceEeeeccccCCCce
Q 019432           72 VDNVMRLSGFLLE-QGWPLFVSEFGADLRGNNVNDNRYLNCFFGVAA------ELDWDWALWTLVGSYYLREGVIGLNEY  144 (341)
Q Consensus        72 ~~~l~~~~gfll~-~~~Pl~isEFG~~~~g~~~~d~~w~~~l~~yl~------e~~i~Wa~W~l~GsYy~R~g~~~~dEt  144 (341)
                      .+.+.+.++++.. .+.||+|+|||....+..  +.+|++++.+|++      +.+++|+||++.         ++.+|+
T Consensus       260 ~~~~~~~~~~~~~~~~~Pv~igEfG~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~gw~~W~~k---------~~~~~~  328 (358)
T d1ecea_         260 PGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTT--DQTWLKTLVQYLRPTAQYGADSFQWTFWSWN---------PDSGDT  328 (358)
T ss_dssp             HHHHHHHTHHHHHTTSSCEEEEECCCCCCSHH--HHHHHHHHHHHTCCHHHHTTSSCEEEESCSC---------SCCTTT
T ss_pred             HHHHHHHHHHHHHhcCCeEEEecCCCCCCCCC--hHHHHHHHHHHHHHHHHhcccCceEEEEcCC---------CCCCCC
Confidence            6666666666644 679999999999876542  4678888888875      678999999996         677899


Q ss_pred             eeccccCCCcccchhHHHHhhcccCCCCCC
Q 019432          145 YGLFDWNWCDIRNSSFLERISSLQSPFRGP  174 (341)
Q Consensus       145 ~GLl~~dW~t~rn~~~l~rl~~l~~~~~~p  174 (341)
                      +|++.+||++++.++ ...|..++..+-+|
T Consensus       329 ~G~~~~dw~~~~~~~-~~~i~~~~~~~~~~  357 (358)
T d1ecea_         329 GGILKDDWQTVDTVK-DGYLAPIKSSIFDP  357 (358)
T ss_dssp             CCSBCTTSSSBCHHH-HHHHGGGCCCCCCC
T ss_pred             cceecCCCCCCChhh-hhhccccccccCCC
Confidence            999999999998877 46677777766555
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure