Citrus Sinensis ID: 019472

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340
MLEIGVWIMRSPPPPSFGHLCLLLSYLVVISFVMPLSRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
cHHHHHHHHcccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHcccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHcccHHHHHHHHHHHHHcccccEEEEccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccEEEEEEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHEEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MLEIGVWimrsppppsfghlCLLLSYLVVISFVMPLSRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFeeggdwerknRLKVYEGLYCMSTRNFKKAASLFLDSistfttyelfpydtfIFYTVLTSIISLdrvslkqkvvdapeiltviGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQikldrylyphFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
MLEIGVWIMRSPPPPSFGHLCLLLSYLVVISFVMPLSRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTesktvavgqkMDLVFYTLQLGFFYMDFDLISKSIDKAKSLfeeggdwerknrLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
MLEIGVWIMRSPPPPSFGHLCLLLSYLVVISFVMPLSRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
***IGVWIMRSPPPPSFGHLCLLLSYLVVISFVMPLSRIADAEENLG**EVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKL******
*LEIGVWIMRSPPPPSFGHLCLLLSYLVVISFVMPLSRI*D***NLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKA************KNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
MLEIGVWIMRSPPPPSFGHLCLLLSYLVVISFVMPLSRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
MLEIGVWIMRSPPPPSFGHLCLLLSYLVVISFVMPLSRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEIGVWIMRSPPPPSFGHLCLLLSYLVVISFVMPLSRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query340 2.2.26 [Sep-21-2011]
Q8W425389 26S proteasome non-ATPase yes no 0.891 0.778 0.910 1e-164
Q93Y35387 Probable 26S proteasome n yes no 0.891 0.782 0.907 1e-163
Q15008389 26S proteasome non-ATPase yes no 0.958 0.838 0.535 1e-105
Q99JI4389 26S proteasome non-ATPase yes no 0.888 0.776 0.586 1e-105
Q3T0B2389 26S proteasome non-ATPase yes no 0.888 0.776 0.586 1e-104
Q9V3G7389 26S proteasome non-ATPase yes no 0.958 0.838 0.523 1e-104
Q55C75382 26S proteasome non-ATPase yes no 0.894 0.795 0.552 1e-101
Q20585410 26S proteasome non-ATPase yes no 0.891 0.739 0.516 7e-86
Q10335409 Probable 26S proteasome r yes no 0.867 0.721 0.458 4e-76
Q06103429 26S proteasome regulatory yes no 0.823 0.652 0.422 3e-64
>sp|Q8W425|PSMD6_ORYSJ 26S proteasome non-ATPase regulatory subunit 6 OS=Oryza sativa subsp. japonica GN=RPN7 PE=2 SV=1 Back     alignment and function desciption
 Score =  577 bits (1486), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 276/303 (91%), Positives = 295/303 (97%)

Query: 38  RIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQ 97
           +IADAEENLGESEVREAHLAKSL++I++G+KEKALEQLKVTE KTVAVGQKMDLVF+TLQ
Sbjct: 87  KIADAEENLGESEVREAHLAKSLYFIRVGEKEKALEQLKVTEGKTVAVGQKMDLVFHTLQ 146

Query: 98  LGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSIS 157
           +GFFYMDFDLISKSIDKAK LFEEGGDWERKNRLKVYEGLYCM+TRNFKKAASLFLDSIS
Sbjct: 147 IGFFYMDFDLISKSIDKAKKLFEEGGDWERKNRLKVYEGLYCMATRNFKKAASLFLDSIS 206

Query: 158 TFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDC 217
           TFTTYELFPYDTFIFYTVLTS+ISLDRVSLK KVVDAPEIL VIGK+P+LSEFLNSLY+C
Sbjct: 207 TFTTYELFPYDTFIFYTVLTSVISLDRVSLKAKVVDAPEILAVIGKVPHLSEFLNSLYNC 266

Query: 218 QYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVT 277
           QYKSFF+AF+GLTEQIKLDRYL PHFRYYMREVRTVVYSQFLESYKSVT+EAMA AFGVT
Sbjct: 267 QYKSFFAAFSGLTEQIKLDRYLQPHFRYYMREVRTVVYSQFLESYKSVTMEAMASAFGVT 326

Query: 278 VEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRV 337
           V+FID+ELSRFIAAGKLHCKIDKVA VLETNRPDA+NA YQATIKQGDFLLNRIQKLSRV
Sbjct: 327 VDFIDLELSRFIAAGKLHCKIDKVACVLETNRPDARNAFYQATIKQGDFLLNRIQKLSRV 386

Query: 338 IDL 340
           IDL
Sbjct: 387 IDL 389
Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q93Y35|PSMD6_ARATH Probable 26S proteasome non-ATPase regulatory subunit 6 OS=Arabidopsis thaliana GN=At4g24820 PE=2 SV=1 Back     alignment and function description
>sp|Q15008|PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens GN=PSMD6 PE=1 SV=1 Back     alignment and function description
>sp|Q99JI4|PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus GN=Psmd6 PE=1 SV=1 Back     alignment and function description
>sp|Q3T0B2|PSMD6_BOVIN 26S proteasome non-ATPase regulatory subunit 6 OS=Bos taurus GN=PSMD6 PE=2 SV=1 Back     alignment and function description
>sp|Q9V3G7|PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster GN=Rpn7 PE=2 SV=1 Back     alignment and function description
>sp|Q55C75|PSMD6_DICDI 26S proteasome non-ATPase regulatory subunit 6 OS=Dictyostelium discoideum GN=psmD6 PE=1 SV=1 Back     alignment and function description
>sp|Q20585|PSMD6_CAEEL 26S proteasome non-ATPase regulatory subunit 6 OS=Caenorhabditis elegans GN=rpn-7 PE=3 SV=1 Back     alignment and function description
>sp|Q10335|RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn7 PE=2 SV=1 Back     alignment and function description
>sp|Q06103|RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN7 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query340
225457441386 PREDICTED: 26S proteasome non-ATPase reg 0.891 0.784 0.970 1e-170
224133850386 predicted protein [Populus trichocarpa] 0.891 0.784 0.963 1e-170
224119590386 predicted protein [Populus trichocarpa] 0.891 0.784 0.960 1e-169
255540369386 26S proteasome non-atpase regulatory sub 0.891 0.784 0.963 1e-169
307136119386 26S proteasome non-ATPase regulatory sub 0.891 0.784 0.953 1e-168
449469610386 PREDICTED: probable 26S proteasome non-A 0.891 0.784 0.953 1e-168
363807644386 uncharacterized protein LOC100810692 [Gl 0.891 0.784 0.960 1e-168
449487714386 PREDICTED: LOW QUALITY PROTEIN: probable 0.891 0.784 0.947 1e-166
356513856386 PREDICTED: probable 26S proteasome non-A 0.891 0.784 0.953 1e-166
356513900384 PREDICTED: probable 26S proteasome non-A 0.891 0.789 0.947 1e-165
>gi|225457441|ref|XP_002262921.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Vitis vinifera] gi|297733617|emb|CBI14864.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 294/303 (97%), Positives = 300/303 (99%)

Query: 38  RIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQ 97
           +IADAEENLGESEVREAHLAKSLFYI+IGDKEKALEQLKVTESKTVAVGQKMDLVFYTL 
Sbjct: 84  KIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLL 143

Query: 98  LGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSIS 157
           LGFFYMDFDLISKSIDKAK+LFEEGGDWERKNRLKVYEGLYCMSTRNFKKAA+LFLDSIS
Sbjct: 144 LGFFYMDFDLISKSIDKAKNLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAANLFLDSIS 203

Query: 158 TFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDC 217
           TFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEIL VIGKIPYLSEFLNSLYDC
Sbjct: 204 TFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILAVIGKIPYLSEFLNSLYDC 263

Query: 218 QYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVT 277
           QYKSFFSAFAGL EQIKLDRYL+PHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVT
Sbjct: 264 QYKSFFSAFAGLAEQIKLDRYLHPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVT 323

Query: 278 VEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRV 337
           VEFID+ELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRV
Sbjct: 324 VEFIDLELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRV 383

Query: 338 IDL 340
           IDL
Sbjct: 384 IDL 386

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224133850|ref|XP_002321676.1| predicted protein [Populus trichocarpa] gi|222868672|gb|EEF05803.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224119590|ref|XP_002318111.1| predicted protein [Populus trichocarpa] gi|222858784|gb|EEE96331.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255540369|ref|XP_002511249.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] gi|223550364|gb|EEF51851.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|307136119|gb|ADN33965.1| 26S proteasome non-ATPase regulatory subunit [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|449469610|ref|XP_004152512.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363807644|ref|NP_001242671.1| uncharacterized protein LOC100810692 [Glycine max] gi|255644637|gb|ACU22821.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449487714|ref|XP_004157764.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S proteasome non-ATPase regulatory subunit 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356513856|ref|XP_003525624.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 6-like [Glycine max] Back     alignment and taxonomy information
>gi|356513900|ref|XP_003525646.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 6-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query340
TAIR|locus:2126798387 AT4G24820 "AT4G24820" [Arabido 0.891 0.782 0.907 4.5e-146
UNIPROTKB|F1N903398 PSMD6 "Uncharacterized protein 0.894 0.763 0.585 5.9e-96
RGD|735127389 Psmd6 "proteasome (prosome, ma 0.888 0.776 0.589 7.6e-96
ZFIN|ZDB-GENE-040426-1038386 psmd6 "proteasome (prosome, ma 0.888 0.782 0.582 1.6e-95
UNIPROTKB|C9IZE4442 PSMD6 "Proteasome (Prosome, ma 0.888 0.683 0.586 2e-95
UNIPROTKB|Q15008389 PSMD6 "26S proteasome non-ATPa 0.888 0.776 0.586 2e-95
UNIPROTKB|Q6UV22351 PSMD6 "KIAA0107 isoform" [Homo 0.888 0.860 0.586 2e-95
MGI|MGI:1913663389 Psmd6 "proteasome (prosome, ma 0.888 0.776 0.586 2e-95
UNIPROTKB|F1MXE4389 PSMD6 "26S proteasome non-ATPa 0.888 0.776 0.589 2.6e-95
UNIPROTKB|E2RN00516 PSMD6 "Uncharacterized protein 0.888 0.585 0.579 6.8e-95
TAIR|locus:2126798 AT4G24820 "AT4G24820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1427 (507.4 bits), Expect = 4.5e-146, P = 4.5e-146
 Identities = 275/303 (90%), Positives = 295/303 (97%)

Query:    38 RIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQ 97
             +IADAEENLGESEVREAHLAK+L++I+I DKEKALEQLK+TE KTVAVGQKMD+VFYTLQ
Sbjct:    85 KIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLKLTEGKTVAVGQKMDVVFYTLQ 144

Query:    98 LGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSIS 157
             L FFYMDFDL+SKSIDKAK LFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSIS
Sbjct:   145 LAFFYMDFDLVSKSIDKAKKLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSIS 204

Query:   158 TFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDC 217
             TFTTYE+FPY+TFIFYTVLTSII+LDRVSLKQKVVDAPEILTV+GKIP+LSEFLNSLY+C
Sbjct:   205 TFTTYEIFPYETFIFYTVLTSIITLDRVSLKQKVVDAPEILTVLGKIPFLSEFLNSLYEC 264

Query:   218 QYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVT 277
             QYK+FFSAFAG+  QIK DRYLYPHFR+YMREVRTVVYSQFLESYKSVT+EAMAKAFGV+
Sbjct:   265 QYKAFFSAFAGMAVQIKYDRYLYPHFRFYMREVRTVVYSQFLESYKSVTVEAMAKAFGVS 324

Query:   278 VEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRV 337
             V+FID ELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRV
Sbjct:   325 VDFIDQELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRV 384

Query:   338 IDL 340
             IDL
Sbjct:   385 IDL 387
GO:0003674 "molecular_function" evidence=ND
GO:0008541 "proteasome regulatory particle, lid subcomplex" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
GO:0005634 "nucleus" evidence=TAS
GO:0030163 "protein catabolic process" evidence=TAS
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0000502 "proteasome complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009735 "response to cytokinin stimulus" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0042023 "DNA endoreduplication" evidence=RCA
GO:0043090 "amino acid import" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0043248 "proteasome assembly" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0051302 "regulation of cell division" evidence=RCA
GO:0051510 "regulation of unidimensional cell growth" evidence=RCA
GO:0051604 "protein maturation" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
UNIPROTKB|F1N903 PSMD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|735127 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1038 psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|C9IZE4 PSMD6 "Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6, isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q15008 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6UV22 PSMD6 "KIAA0107 isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913663 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXE4 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RN00 PSMD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9V3G7PSMD6_DROMENo assigned EC number0.52360.95880.8380yesno
Q3T0B2PSMD6_BOVINNo assigned EC number0.58600.88820.7763yesno
Q20585PSMD6_CAEELNo assigned EC number0.51610.89110.7390yesno
Q93Y35PSMD6_ARATHNo assigned EC number0.90750.89110.7829yesno
Q55C75PSMD6_DICDINo assigned EC number0.55260.89410.7958yesno
Q99JI4PSMD6_MOUSENo assigned EC number0.58600.88820.7763yesno
Q8W425PSMD6_ORYSJNo assigned EC number0.91080.89110.7789yesno
Q15008PSMD6_HUMANNo assigned EC number0.53550.95880.8380yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
COG5187412 COG5187, RPN7, 26S proteasome regulatory complex c 1e-97
pfam10602174 pfam10602, RPN7, 26S proteasome subunit RPN7 4e-69
pfam01399100 pfam01399, PCI, PCI domain 2e-19
smart0075388 smart00753, PAM, PCI/PINT associated module 2e-16
smart0008888 smart00088, PINT, motif in proteasome subunits, In 2e-16
COG5159421 COG5159, RPN6, 26S proteasome regulatory complex c 0.002
>gnl|CDD|227514 COG5187, RPN7, 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  294 bits (754), Expect = 1e-97
 Identities = 121/300 (40%), Positives = 187/300 (62%), Gaps = 4/300 (1%)

Query: 38  RIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQ 97
           RI + EE+ GE+E  EA    + +Y QI D +   E ++      ++ G K+D+    ++
Sbjct: 101 RIREKEEDNGETEGSEADRNIAEYYCQIMDIQNGFEWMRRLMRDAMSTGLKIDVFLCKIR 160

Query: 98  LGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSIS 157
           LG  Y D  ++ +S++ A  + E+GGDWER+NR KVY+G++ M  RNFK+AA L  D + 
Sbjct: 161 LGLIYGDRKVVEESLEVADDIIEKGGDWERRNRYKVYKGIFKMMRRNFKEAAILLSDILP 220

Query: 158 TFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIG---KIPYLSEFLNSL 214
           TF + EL  Y   + Y +   ++ L+R  +K K++D+PE+L VIG   K+  L +   SL
Sbjct: 221 TFESSELISYSRAVRYAIFCGLLRLERRDIKTKILDSPEVLDVIGSSEKLGSLVQLATSL 280

Query: 215 YDCQYKSFFSAFAGL-TEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKA 273
           Y+C Y   F     L    ++ D +L  H   ++RE+R  VY+Q LESY+ +++E+MA+ 
Sbjct: 281 YECDYGGDFMNLLYLFCNSLQDDVFLGRHVDLFVREMRRRVYAQLLESYRLLSLESMAQT 340

Query: 274 FGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQK 333
           FGV+VE++D +L  FI  G+L+C ID+V GV+ETNRPD KN  Y + +KQGD LL ++QK
Sbjct: 341 FGVSVEYVDRDLGEFIPEGRLNCVIDRVNGVVETNRPDEKNQQYSSVVKQGDDLLRKLQK 400

Length = 412
>gnl|CDD|220821 pfam10602, RPN7, 26S proteasome subunit RPN7 Back     alignment and domain information
>gnl|CDD|216479 pfam01399, PCI, PCI domain Back     alignment and domain information
>gnl|CDD|214803 smart00753, PAM, PCI/PINT associated module Back     alignment and domain information
>gnl|CDD|214509 smart00088, PINT, motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>gnl|CDD|227488 COG5159, RPN6, 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 340
KOG0687393 consensus 26S proteasome regulatory complex, subun 100.0
COG5187412 RPN7 26S proteasome regulatory complex component, 100.0
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 100.0
KOG1463411 consensus 26S proteasome regulatory complex, subun 100.0
COG5159421 RPN6 26S proteasome regulatory complex component [ 100.0
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 100.0
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 100.0
KOG2758432 consensus Translation initiation factor 3, subunit 99.96
KOG1498439 consensus 26S proteasome regulatory complex, subun 99.84
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 99.83
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 99.81
KOG2908380 consensus 26S proteasome regulatory complex, subun 99.8
COG5071439 RPN5 26S proteasome regulatory complex component [ 99.72
smart0075388 PAM PCI/PINT associated module. 99.58
smart0008888 PINT motif in proteasome subunits, Int-6, Nip-1 an 99.58
KOG2581493 consensus 26S proteasome regulatory complex, subun 99.39
KOG2582422 consensus COP9 signalosome, subunit CSN3 [Posttran 99.02
KOG2753378 consensus Uncharacterized conserved protein, conta 98.94
KOG1076843 consensus Translation initiation factor 3, subunit 98.71
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.09
KOG2688394 consensus Transcription-associated recombination p 97.81
PF10075143 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro 97.44
COG5600413 Transcription-associated recombination protein [DN 97.37
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.34
KOG2072 988 consensus Translation initiation factor 3, subunit 97.07
PF09756188 DDRGK: DDRGK domain; InterPro: IPR019153 This is a 96.65
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 96.6
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.53
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.33
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 96.12
PF03399204 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; I 96.1
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 95.94
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.87
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.78
PF12688120 TPR_5: Tetratrico peptide repeat 95.72
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 95.58
KOG1586288 consensus Protein required for fusion of vesicles 95.52
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.33
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 95.3
KOG1861540 consensus Leucine permease transcriptional regulat 95.08
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.08
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.01
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 94.83
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 94.62
PRK02603172 photosystem I assembly protein Ycf3; Provisional 94.57
CHL00033168 ycf3 photosystem I assembly protein Ycf3 94.55
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.51
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.5
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.36
PRK11788389 tetratricopeptide repeat protein; Provisional 93.76
KOG3054299 consensus Uncharacterized conserved protein [Funct 93.7
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 93.59
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.55
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 93.46
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 93.4
PRK1543178 ferrous iron transport protein FeoC; Provisional 93.35
KOG2003840 consensus TPR repeat-containing protein [General f 93.06
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 92.85
PRK10803263 tol-pal system protein YbgF; Provisional 92.81
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 92.69
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.66
PRK11788389 tetratricopeptide repeat protein; Provisional 92.63
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 92.47
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 92.05
KOG1125579 consensus TPR repeat-containing protein [General f 92.04
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.95
PRK15359144 type III secretion system chaperone protein SscB; 91.84
PRK15331165 chaperone protein SicA; Provisional 91.79
KOG1585308 consensus Protein required for fusion of vesicles 91.71
COG4700251 Uncharacterized protein conserved in bacteria cont 91.68
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 91.52
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 91.48
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.44
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 91.32
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 91.27
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 91.14
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 91.13
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 90.97
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 90.9
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 90.85
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 90.82
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 90.65
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 90.34
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.31
KOG0547 606 consensus Translocase of outer mitochondrial membr 90.28
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 90.27
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 89.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 89.78
cd05804355 StaR_like StaR_like; a well-conserved protein foun 89.62
PF03704146 BTAD: Bacterial transcriptional activator domain; 89.35
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 89.07
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 89.04
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.0
cd00189100 TPR Tetratricopeptide repeat domain; typically con 88.63
PF1342844 TPR_14: Tetratricopeptide repeat 88.62
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 88.51
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 88.23
PF13512142 TPR_18: Tetratricopeptide repeat 88.16
PRK10370198 formate-dependent nitrite reductase complex subuni 88.15
PF1337173 TPR_9: Tetratricopeptide repeat 87.93
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 87.64
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 87.56
COG4105254 ComL DNA uptake lipoprotein [General function pred 87.54
KOG3677525 consensus RNA polymerase I-associated factor - PAF 87.33
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 86.89
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 86.7
KOG4414197 consensus COP9 signalosome, subunit CSN8 [Posttran 86.37
KOG1126638 consensus DNA-binding cell division cycle control 85.96
PRK10803263 tol-pal system protein YbgF; Provisional 85.93
PF09743272 DUF2042: Uncharacterized conserved protein (DUF204 85.92
TIGR02787251 codY_Gpos GTP-sensing transcriptional pleiotropic 85.86
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 85.73
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 85.66
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 85.65
PRK10747398 putative protoheme IX biogenesis protein; Provisio 85.59
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 85.53
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 85.08
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 85.05
KOG2796366 consensus Uncharacterized conserved protein [Funct 84.81
KOG2003840 consensus TPR repeat-containing protein [General f 84.66
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Pr 84.5
PRK11189296 lipoprotein NlpI; Provisional 84.49
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 84.31
CHL00033168 ycf3 photosystem I assembly protein Ycf3 83.71
PRK14574 822 hmsH outer membrane protein; Provisional 83.62
PLN03218 1060 maturation of RBCL 1; Provisional 83.61
PRK10411 240 DNA-binding transcriptional activator FucR; Provis 83.39
PF1286294 Apc5: Anaphase-promoting complex subunit 5 83.24
PRK04424185 fatty acid biosynthesis transcriptional regulator; 83.22
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 83.04
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 82.7
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 82.67
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 82.65
PRK06266178 transcription initiation factor E subunit alpha; V 82.16
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 82.07
COG2976207 Uncharacterized protein conserved in bacteria [Fun 82.03
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.03
COG1729262 Uncharacterized protein conserved in bacteria [Fun 81.99
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 81.68
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 81.67
COG1349 253 GlpR Transcriptional regulators of sugar metabolis 81.34
PRK13509 251 transcriptional repressor UlaR; Provisional 81.15
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 80.63
KOG3250258 consensus COP9 signalosome, subunit CSN7 [Posttran 80.28
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 80.22
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 80.17
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-73  Score=513.24  Aligned_cols=334  Identities=63%  Similarity=1.028  Sum_probs=324.2

Q ss_pred             cccCCCCcchhHhhhhhhcchHHHHhhcc------------ccchhHHHHhhCHHHHHHHHHHHHHHHHHhCCHHHHHHH
Q 019472            7 WIMRSPPPPSFGHLCLLLSYLVVISFVMP------------LSRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQ   74 (340)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------~~~l~~~~~n~~~~~ir~~~~~La~~~~~~Gd~~~A~~~   74 (340)
                      -|-.-.|+|+|..+|.+..+++|++++..            .++++++++|+|+.++|+++.++|++|+++||.++|++.
T Consensus        47 ~Ird~~Map~Ye~lce~~~i~~D~~~l~~m~~~neeki~eld~~iedaeenlGE~ev~ea~~~kaeYycqigDkena~~~  126 (393)
T KOG0687|consen   47 AIRDEDMAPLYEYLCESLVIKLDQDLLNSMKKANEEKIKELDEKIEDAEENLGESEVREAMLRKAEYYCQIGDKENALEA  126 (393)
T ss_pred             HHHhcccchHHHHHHhhcceeccHHHHHHHHHhhHHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHHhccHHHHHHH
Confidence            45667899999999999999999999953            666788999999999999999999999999999999999


Q ss_pred             HHHHHhhhccchhHHHhHHHHHHHHHHhcCHHHHHhHHHHHHHHHhcCCChhhhhHhhHHHHHhccccCCHHHHHHHHHh
Q 019472           75 LKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLD  154 (340)
Q Consensus        75 l~~~~~~~~~~~~~i~~~l~~i~~~i~~~~~~~~~~~i~ka~~~l~~~~~~~~~~~l~~~~gl~~l~~r~y~~Aa~~F~e  154 (340)
                      +.+..+..++.++++|+.+..+|++++.+|...+.++++||+++++.||||+++||+|+|+|++.++.|||++||.+|+|
T Consensus       127 ~~~t~~ktvs~g~kiDVvf~~iRlglfy~D~~lV~~~iekak~liE~GgDWeRrNRlKvY~Gly~msvR~Fk~Aa~Lfld  206 (393)
T KOG0687|consen  127 LRKTYEKTVSLGHKIDVVFYKIRLGLFYLDHDLVTESIEKAKSLIEEGGDWERRNRLKVYQGLYCMSVRNFKEAADLFLD  206 (393)
T ss_pred             HHHHHHHHhhcccchhhHHHHHHHHHhhccHHHHHHHHHHHHHHHHhCCChhhhhhHHHHHHHHHHHHHhHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCcCccCCHhHHHHHHHHHHhhhcChhHHHHhccCChHHHHHhcCcchHHHHHHHHHhccHHHHHHHHHHh-HHHh
Q 019472          155 SISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFAGL-TEQI  233 (340)
Q Consensus       155 ~~~~f~~~e~~~~~~~~~Y~~L~al~s~~r~~l~~~ll~~~~~~~~l~~~p~l~~ll~af~~~~~~~~~~~L~~~-~~~l  233 (340)
                      +.+||++.|++++.+++.|+++|++.+++|.+++++|+++|++...++..|.+.+++.++++|+|..|+..|... ..++
T Consensus       207 ~vsTFtS~El~~Y~~~v~Ytv~~g~i~leR~dlktKVi~~~Evl~vl~~l~~~~q~l~SLY~C~Y~~Ff~~L~~~~~~~l  286 (393)
T KOG0687|consen  207 SVSTFTSYELMSYETFVRYTVITGLIALERVDLKTKVIKCPEVLEVLHKLPSVSQLLNSLYECDYSDFFNDLAAVEAKQL  286 (393)
T ss_pred             HcccccceecccHHHHHHHHHHHhhheeccchHHhhhcCcHHHHHHhhcCchHHHHHHHHHhccHHHHHHHHHHHHHHhh
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999655 7889


Q ss_pred             hcChhHhhhHHHHHHHHHHHHHHHhhhhhccccHHHHHHHhCCChHHHHHHHHHHhhCCccceEEecCCCEEEEcCCCcc
Q 019472          234 KLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAK  313 (340)
Q Consensus       234 ~~D~~l~~h~~~l~~~ir~~~l~q~i~pYs~I~l~~mA~~~g~~~~~vE~~L~~lI~~g~l~akID~~~g~l~~~~~~~r  313 (340)
                      ..|.|+++|.+.+.+++|.+++.|+++||++++++.||+.||+|+++++++|.++|.+|+++|+||.++|+|++++||++
T Consensus       287 k~D~~l~~h~~yyvREMR~rvY~QlLESYrsl~l~~MA~aFgVSVefiDreL~rFI~~grL~ckIDrVnGVVEtNrpD~K  366 (393)
T KOG0687|consen  287 KDDRYLGPHYRYYVREMRRRVYAQLLESYRSLTLESMAKAFGVSVEFIDRELGRFIAAGRLHCKIDRVNGVVETNRPDEK  366 (393)
T ss_pred             ccchhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCchHHHHHhHHHHhhccCceeeeeecccceeecCCcccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHhhHHHHHHHHHhhhhhcC
Q 019472          314 NALYQATIKQGDFLLNRIQKLSRVIDL  340 (340)
Q Consensus       314 ~~~y~~~l~~~~~l~~ri~~l~~~v~~  340 (340)
                      +..|+.+|++||.++|||||+++||++
T Consensus       367 N~qyq~vikqGd~LLnriQK~~rvi~~  393 (393)
T KOG0687|consen  367 NAQYQAVIKQGDLLLNRIQKLSRVINL  393 (393)
T ss_pred             chHHHHHHhhhHHHHHHHHHHHHHhcC
Confidence            999999999999999999999999985

>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00753 PAM PCI/PINT associated module Back     alignment and domain information
>smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2753 consensus Uncharacterized conserved protein, contains PCI domain [General function prediction only] Back     alignment and domain information
>KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8 Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09756 DDRGK: DDRGK domain; InterPro: IPR019153 This is a family of proteins of approximately 300 residues Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PF03399 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; InterPro: IPR005062 This large family includes diverse proteins involved in large complexes [, , ] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1861 consensus Leucine permease transcriptional regulator [Transcription] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG3054 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK15431 ferrous iron transport protein FeoC; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG3677 consensus RNA polymerase I-associated factor - PAF67 [Translation, ribosomal structure and biogenesis; Transcription] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4414 consensus COP9 signalosome, subunit CSN8 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms Back     alignment and domain information
>TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG3250 consensus COP9 signalosome, subunit CSN7 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
4b4t_R429 Near-Atomic Resolution Structural Model Of The Yeas 3e-65
>pdb|4B4T|R Chain R, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 429 Back     alignment and structure 
Iteration: 1

 Score =  245 bits (626), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 185/284 (65%), Gaps = 4/284 (1%)
Query: 61  FYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFE 120
           +Y QIGDK+ A + L  + SK ++ G K+D++    +LGFFY D   + + ++   S+ E
Sbjct: 140 YYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIE 199
Query: 121 EGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSII 180
           +GGDWER+NR K Y G++C++ RNFK+AA L +DS++TFT+ EL  Y++   Y  +T + 
Sbjct: 200 KGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLF 259
Query: 181 SLDRVSLKQKVVDAPEILTVIGKIPYL---SEFLNSLYDCQYKSFFSAFAGLTEQIKLD- 236
           +L+R  LK KV+D+PE+L++I     L   S    SLY   Y S+F         + +  
Sbjct: 260 TLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPC 319
Query: 237 RYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHC 296
           +YL  H  +++RE+R  VY+Q LESYK++++++MA AFGV+V F+D +L +FI   +L+C
Sbjct: 320 KYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNC 379
Query: 297 KIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL 340
            ID+V G++ETNRPD KNA Y   +KQGD LL ++QK    + L
Sbjct: 380 VIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRL 423
  Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 9e-44
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 8e-05
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
 Score =  154 bits (389), Expect = 9e-44
 Identities = 47/311 (15%), Positives = 104/311 (33%), Gaps = 20/311 (6%)

Query: 39  IADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQL 98
           I  A++       +         Y       +AL        +     +K+D     +++
Sbjct: 86  IEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLREL----KKLDDKNLLVEV 141

Query: 99  GFFYMDFDLISKSIDKAKSLFEEGG--------DWERKNRLKVYEGLYCM-STRNFKKAA 149
                       ++ KA++                + +  L +  G+      R+FK A 
Sbjct: 142 QLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAF 201

Query: 150 SLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSE 209
           S F ++   F + +     T + Y +L  I+      + Q V     I      I  +  
Sbjct: 202 SYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKS 261

Query: 210 FLNSLYDCQYKSFFSAFAGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEA 269
              + +      F +A     +++  D  +  H       +      + +E Y  V +  
Sbjct: 262 VAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAH 321

Query: 270 MAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLN 329
           +A++  + +  ++ +LS+ I   K    +D+  GVL        +  Y+  ++       
Sbjct: 322 VAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERVLET------ 375

Query: 330 RIQKLSRVIDL 340
            IQ + +V+D 
Sbjct: 376 -IQSMGKVVDT 385
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Length = 84 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 100.0
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 100.0
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 100.0
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 100.0
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 99.91
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 99.67
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 99.66
1ufm_A84 COP9 complex subunit 4; helix-turn-helix, structur 99.63
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 99.4
3chm_A169 COP9 signalosome complex subunit 7; heat/ARM repea 99.11
4b0z_A229 RPN12, 26S proteasome regulatory subunit RPN12; pr 98.18
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.97
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.68
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.62
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.58
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 97.41
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.37
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.36
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 97.33
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.23
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.18
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.17
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.14
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.93
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.91
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 96.9
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.87
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.86
3q15_A378 PSP28, response regulator aspartate phosphatase H; 96.86
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 96.85
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 96.83
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.83
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.81
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.79
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.73
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 96.73
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 96.69
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.68
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.67
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.63
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 96.6
3u4t_A272 TPR repeat-containing protein; structural genomics 96.57
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.56
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.54
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.48
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 96.46
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.4
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.39
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.33
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.31
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.31
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.26
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.25
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.23
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.17
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.11
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 96.08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.04
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.03
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.02
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.0
4b4t_T274 26S proteasome regulatory subunit RPN12; hydrolase 95.99
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.92
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.87
1rz4_A226 Eukaryotic translation initiation factor 3 subuni; 95.83
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 95.83
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.79
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.79
3u4t_A272 TPR repeat-containing protein; structural genomics 95.72
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.6
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.6
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.58
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.54
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.48
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.39
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.38
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.35
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.3
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.28
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.16
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.13
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.09
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.03
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.02
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 95.02
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.0
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 94.95
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 94.95
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 94.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 94.88
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 94.83
4g1t_A 472 Interferon-induced protein with tetratricopeptide 94.81
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 94.8
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 94.76
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 94.71
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 94.67
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 94.64
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 94.56
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 94.45
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.42
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 94.39
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 94.35
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 94.27
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 94.26
3k9i_A117 BH0479 protein; putative protein binding protein, 94.18
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.15
2gw1_A 514 Mitochondrial precursor proteins import receptor; 94.13
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 94.08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 94.04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.0
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.96
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 93.89
4eqf_A365 PEX5-related protein; accessory protein, tetratric 93.85
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 93.85
2jt1_A77 PEFI protein; solution structure, winged helix-tur 93.83
3k9i_A117 BH0479 protein; putative protein binding protein, 93.67
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 93.64
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 93.48
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 93.43
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.42
4eqf_A365 PEX5-related protein; accessory protein, tetratric 93.37
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 93.25
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 93.16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 93.04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 93.04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 92.9
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 92.83
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 92.79
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 92.69
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 92.64
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 92.35
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 92.3
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 92.3
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 92.24
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 92.22
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 92.06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 92.05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 92.01
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 92.0
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 91.84
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 91.77
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 91.74
2gw1_A514 Mitochondrial precursor proteins import receptor; 91.67
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 91.52
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 91.49
1qbj_A81 Protein (double-stranded RNA specific adenosine D 91.28
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 91.17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 91.12
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 91.02
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 90.92
1sfx_A109 Conserved hypothetical protein AF2008; structural 90.91
3q49_B137 STIP1 homology and U box-containing protein 1; E3 90.76
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 90.71
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 90.53
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 90.36
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 90.35
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 90.28
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 90.22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 90.15
3qww_A433 SET and MYND domain-containing protein 2; methyltr 89.83
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 89.64
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 89.6
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 89.59
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 89.51
3qww_A433 SET and MYND domain-containing protein 2; methyltr 89.35
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 89.33
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 89.12
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 88.67
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.2
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 88.0
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 87.91
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 87.76
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 87.51
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 87.47
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 87.11
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 86.78
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 86.68
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 86.59
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 86.15
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 86.11
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 85.97
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 85.96
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 85.63
3by6_A126 Predicted transcriptional regulator; structural ge 85.37
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 84.94
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 84.9
3t5v_A316 Nuclear mRNA export protein SAC3; PCI, mRNA nuclea 84.5
3r0a_A123 Putative transcriptional regulator; structural gen 84.35
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 84.06
2oqg_A114 Possible transcriptional regulator, ARSR family P; 83.89
2pg4_A95 Uncharacterized protein; structural genomics, join 83.1
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 82.72
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 82.58
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 82.39
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 82.31
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 81.84
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 81.78
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 81.47
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 81.27
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 80.16
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=9.1e-64  Score=489.58  Aligned_cols=333  Identities=39%  Similarity=0.691  Sum_probs=275.9

Q ss_pred             ccCCCCcchhHhhhhhhcc--------------------hHHHHhhcc--------c----cchhHHHH-hhCHHHHHHH
Q 019472            8 IMRSPPPPSFGHLCLLLSY--------------------LVVISFVMP--------L----SRIADAEE-NLGESEVREA   54 (340)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~--------------------~~~~~~~~~--------~----~~l~~~~~-n~~~~~ir~~   54 (340)
                      |...+|+|+|..+|.....                    +.+..|++.        +    +.++++++ +.++.+||++
T Consensus        54 ik~~~ma~~y~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~n~~~l~~l~~~~~~~~~~~~~e~e~~~~  133 (429)
T 4b4t_R           54 IKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQA  133 (429)
T ss_dssp             HHHTCCHHHHHHHHHHSCCCCSCCSSCSHHHHHHHHHTTTTCCSSCTTTTCCSSCCHHHHHHHHHHHHHCCSCCCCCSSC
T ss_pred             HHHhCCHHHHHHHHHHHhhcccchhhhhhhhhhhhhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccHHHHHH
Confidence            4567899999999986532                    233344432        2    23344443 6677789999


Q ss_pred             HHHHHHHHHHhCCHHHHHHHHHHHHhhhccchhHHHhHHHHHHHHHHhcCHHHHHhHHHHHHHHHhcCCChhhhhHhhHH
Q 019472           55 HLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVY  134 (340)
Q Consensus        55 ~~~La~~~~~~Gd~~~A~~~l~~~~~~~~~~~~~i~~~l~~i~~~i~~~~~~~~~~~i~ka~~~l~~~~~~~~~~~l~~~  134 (340)
                      +.+||+||+++||+++|+++|.+++++|++++++++++|.++|++++.+||.++..+++|++..++++++|++++++++|
T Consensus       134 ~~~la~~~~~~Gd~~~A~~~~~~~~~~~~~~~~kid~~l~~irl~l~~~d~~~~~~~~~ka~~~~~~~~d~~~~~~lk~~  213 (429)
T 4b4t_R          134 WINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTY  213 (429)
T ss_dssp             CHHHHHHHHHHCCCTTHHHHHHHHHHHHTCCCSHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHTTCCCTHHHHHHHHH
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHhhhcCCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhccccCCHHHHHHHHHhccccCCcCccCCHhHHHHHHHHHHhhhcChhHHHHhccCChHHHHHhcCcch---HHHHH
Q 019472          135 EGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPY---LSEFL  211 (340)
Q Consensus       135 ~gl~~l~~r~y~~Aa~~F~e~~~~f~~~e~~~~~~~~~Y~~L~al~s~~r~~l~~~ll~~~~~~~~l~~~p~---l~~ll  211 (340)
                      +|+++++.|+|.+|+++|++++++|++.+.+++.++++|++||++++++|++++.+++++++++.+++..|.   +.+++
T Consensus       214 ~gl~~l~~r~f~~Aa~~f~e~~~t~~~~e~~~~~~~~~y~~l~al~~~~r~~l~~~v~~~~~~~~~l~~~p~~~~~~~l~  293 (429)
T 4b4t_R          214 YGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLT  293 (429)
T ss_dssp             HHHGGGGTSCHHHHHHHHHHHHHHSCCSCHHHHHHHHHHHHHHHHHTTCHHHHHHSSSSSHHHHHGGGSHHHHHHHHHHH
T ss_pred             HHHHHHHhChHHHHHHHHHHHhccCCccchhhHHHHHHHHHHHHHhcCCHHHHHHHHhcCHHHHhhccCChhHHHHHHHH
Confidence            999999999999999999999999999899999999999999999999999999999999999999988885   56679


Q ss_pred             HHHHhccHHHHHHHH-HHhHHHhhcChhHhhhHHHHHHHHHHHHHHHhhhhhccccHHHHHHHhCCChHHHHHHHHHHhh
Q 019472          212 NSLYDCQYKSFFSAF-AGLTEQIKLDRYLYPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIA  290 (340)
Q Consensus       212 ~af~~~~~~~~~~~L-~~~~~~l~~D~~l~~h~~~l~~~ir~~~l~q~i~pYs~I~l~~mA~~~g~~~~~vE~~L~~lI~  290 (340)
                      .+|++++|..|++.+ ..+...+..|+|+++|++.|+++||.+++.||++||++|+|++||+.||+|++++|++|++||.
T Consensus       294 ~~~~~~~~~~~~~~~l~~~~~~l~~d~~l~~h~~~l~~~ir~~~l~q~~~~Ys~I~l~~mA~~l~~s~~~~E~~L~~lI~  373 (429)
T 4b4t_R          294 ISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIP  373 (429)
T ss_dssp             HHHHHTCHHHHHHHHHHHHSTTTTTCTTSTTTHHHHHHHHHHHHHHHHHHTCSEEEHHHHHHHHTSCHHHHHHHHHHHHH
T ss_pred             HHHHhccHHHHHHHHHHHHHhhhccCHHHHHHHHHHHHHHHHHHHHHHhHHhceeeHHHHHHHhCcCHHHHHHHHHHHHH
Confidence            999999999998865 4456678999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccceEEecCCCEEEEcCCCcchHHHHHHHHhhHHHHHHHHHhhhhhcC
Q 019472          291 AGKLHCKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL  340 (340)
Q Consensus       291 ~g~l~akID~~~g~l~~~~~~~r~~~y~~~l~~~~~l~~ri~~l~~~v~~  340 (340)
                      +|+|+||||+++|+|++++||+|+++|++++++||.|+||+||+|++||+
T Consensus       374 ~g~l~akID~~~giv~~~~~d~~~~~y~~~i~~gd~Ll~riqkl~~~i~l  423 (429)
T 4b4t_R          374 NKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRL  423 (429)
T ss_dssp             HTSSCEEEETTTTEEEECC-------------------------------
T ss_pred             cCCeEEEEcCCCCEEEECCCCchhHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999986
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4b4t_T 26S proteasome regulatory subunit RPN12; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1rz4_A Eukaryotic translation initiation factor 3 subuni; heat analogous motif, winged-helix, biosynthetic protein; 2.10A {Homo sapiens} SCOP: a.4.5.53 a.118.1.18 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>3t5v_A Nuclear mRNA export protein SAC3; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 340
d1ufma_84 a.4.5.47 (A:) COP9 signalosome complex subunit 4, 2e-13
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 84 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 62.5 bits (152), Expect = 2e-13
 Identities = 11/72 (15%), Positives = 29/72 (40%), Gaps = 8/72 (11%)

Query: 252 TVVYSQFLE--------SYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAG 303
           +++    +E         Y ++T E +     +     +   S+ I  G+++  ID++ G
Sbjct: 10  SILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDG 69

Query: 304 VLETNRPDAKNA 315
           ++     +A   
Sbjct: 70  IVHFETREASGP 81

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
d1ufma_84 COP9 signalosome complex subunit 4, GSN4 {Mouse (M 99.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.19
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.31
d1wi9a_72 Hypothetical protein C20orf116 homolog {Mouse (Mus 97.13
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.57
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.17
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.09
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.04
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.01
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.95
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 95.91
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 95.64
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.61
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 95.59
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.25
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.2
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.03
d1hz4a_366 Transcription factor MalT domain III {Escherichia 94.85
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.66
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.18
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 93.51
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 93.41
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 92.76
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 92.75
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 92.63
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 92.61
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 92.53
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 92.51
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 92.2
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 92.07
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 91.97
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 91.63
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 91.52
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 91.35
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 91.3
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 91.09
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 90.76
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 90.45
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 90.15
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 89.9
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.49
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 89.02
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 88.61
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 87.98
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 87.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 87.51
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 87.49
d1hw1a174 Fatty acid responsive transcription factor FadR, N 87.38
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 85.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 85.11
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 84.73
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 84.08
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 82.39
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 82.31
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 80.9
>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: PCI domain (PINT motif)
domain: COP9 signalosome complex subunit 4, GSN4
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.58  E-value=1.1e-15  Score=112.80  Aligned_cols=67  Identities=18%  Similarity=0.278  Sum_probs=62.9

Q ss_pred             HHHHHHHHHHHHhhhhhccccHHHHHHHhCCChHHHHHHHHHHhhCCccceEEecCCCEEEEcCCCc
Q 019472          246 YMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVEFIDVELSRFIAAGKLHCKIDKVAGVLETNRPDA  312 (340)
Q Consensus       246 l~~~ir~~~l~q~i~pYs~I~l~~mA~~~g~~~~~vE~~L~~lI~~g~l~akID~~~g~l~~~~~~~  312 (340)
                      |.+++++.++..+.+||++|+|++||+.||++++++|.+|++||.+|+|+|+||+++|+|++..++.
T Consensus        12 L~~~i~Ehni~~is~~Y~~Isl~~la~~l~l~~~evE~~l~~mI~~~~i~akIDq~~g~V~F~~~e~   78 (84)
T d1ufma_          12 LDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREA   78 (84)
T ss_dssp             CCHHHHHHHHHHHHHSCSEEEHHHHHHHTTSCHHHHHHHHHHHHHTTSSCEEEETTTTEEEECCSSC
T ss_pred             HHHHHHHHHHHHHHHhhceeeHHHHHHHHCCCHHHHHHHHHHHHhcCeEEEEEeCCCCEEEECCCCc
Confidence            5677888899999999999999999999999999999999999999999999999999999987654
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure