Citrus Sinensis ID: 019478
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 340 | ||||||
| 449440973 | 475 | PREDICTED: putative FBD-associated F-box | 0.891 | 0.637 | 0.382 | 3e-47 | |
| 255544812 | 464 | ubiquitin-protein ligase, putative [Rici | 0.776 | 0.568 | 0.407 | 2e-46 | |
| 255540581 | 457 | ubiquitin-protein ligase, putative [Rici | 0.867 | 0.645 | 0.396 | 2e-43 | |
| 302142991 | 402 | unnamed protein product [Vitis vinifera] | 0.814 | 0.689 | 0.359 | 2e-36 | |
| 357477131 | 447 | F-box family-6 [Medicago truncatula] gi| | 0.814 | 0.619 | 0.319 | 1e-30 | |
| 356544606 | 444 | PREDICTED: putative F-box protein At3g58 | 0.702 | 0.538 | 0.333 | 5e-25 | |
| 357162424 | 482 | PREDICTED: putative FBD-associated F-box | 0.782 | 0.551 | 0.285 | 7e-21 | |
| 147865783 | 1789 | hypothetical protein VITISV_020815 [Viti | 0.867 | 0.164 | 0.276 | 3e-19 | |
| 297736820 | 487 | unnamed protein product [Vitis vinifera] | 0.858 | 0.599 | 0.270 | 1e-18 | |
| 357119372 | 497 | PREDICTED: uncharacterized protein LOC10 | 0.735 | 0.503 | 0.285 | 2e-17 |
| >gi|449440973|ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 195 bits (495), Expect = 3e-47, Method: Compositional matrix adjust.
Identities = 119/311 (38%), Positives = 180/311 (57%), Gaps = 8/311 (2%)
Query: 18 VDWISRLPDEILVNIISRLAVREAARTSVLSSRWKYLWTFTTCLNFSALKMLWNVKKDPA 77
VD IS LP +ILV I+S L ++EAARTS LS +W+ LW+F CLNF A K L +++
Sbjct: 44 VDSISHLPQDILVFILSLLPLKEAARTSTLSHKWRCLWSFIPCLNFDAHKKLLDLQFTDE 103
Query: 78 TLEEERYNYINWVNDVLDSHMGLCINEFRLCFELRNSHGSFITHWIFTALAKKVQKLELN 137
L+ ER ++ WVN V+DS+ G + R+ F L +S + W+ A+ K++ ELN
Sbjct: 104 NLKSERRQFVKWVNRVIDSYKGSNLETLRIRFNLDSSFQCDVDRWVQFAMQWKLKMFELN 163
Query: 138 L-HPVGGGFWPPL---ELYAFPPECLKLFRSPRTLSNIKSLRSLCLDAVNVSGEVLEFFI 193
L G + P +L P E F SN SL++L L AVNV GE LE F+
Sbjct: 164 LSDSYDSGIYSPCSFPQLSDGPKENFPRF----MFSNSSSLKTLKLIAVNVGGEALECFL 219
Query: 194 YSCPLLARLRVVFSLDLLSLKVVGSSVKLKYLDICYCYFMEEVEISAPSVRSFKYYGPEI 253
+ PLL L V +S LLSL+VVG+S+KL+ L++C C ++E +E+SAP++ SFKY GP +
Sbjct: 220 TNSPLLEILVVEYSHCLLSLRVVGASLKLRQLEVCMCNYLESLEVSAPNLESFKYVGPWL 279
Query: 254 KLRMENVPQLLDISIGGGYGVRMKHAISPIMSYFHQLETLELGFVLNAVSILNLKCFRVV 313
+ ++N P+LL+ G +GV + + SY QL+ L L ++ + + + ++
Sbjct: 280 SMPLKNTPKLLETYFGSEFGVEIIDHFFLLSSYSSQLQKLILDLEVDFMENQGFRKWPIL 339
Query: 314 NNFLCFCLILL 324
N LI++
Sbjct: 340 ANLKELKLIVI 350
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255544812|ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255540581|ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|302142991|emb|CBI20286.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357477131|ref|XP_003608851.1| F-box family-6 [Medicago truncatula] gi|355509906|gb|AES91048.1| F-box family-6 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356544606|ref|XP_003540740.1| PREDICTED: putative F-box protein At3g58860-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357162424|ref|XP_003579406.1| PREDICTED: putative FBD-associated F-box protein At1g61330-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|147865783|emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297736820|emb|CBI26021.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357119372|ref|XP_003561416.1| PREDICTED: uncharacterized protein LOC100838353 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 340 | ||||||
| TAIR|locus:2010032 | 416 | AT1G13570 "AT1G13570" [Arabido | 0.582 | 0.475 | 0.328 | 1.1e-16 | |
| TAIR|locus:2052351 | 737 | AT2G42730 [Arabidopsis thalian | 0.664 | 0.306 | 0.315 | 2.4e-14 | |
| TAIR|locus:2081172 | 484 | AT3G59210 "AT3G59210" [Arabido | 0.811 | 0.570 | 0.287 | 1.3e-13 | |
| TAIR|locus:2162499 | 443 | AT5G22670 "AT5G22670" [Arabido | 0.6 | 0.460 | 0.309 | 6.1e-12 | |
| TAIR|locus:2025812 | 486 | AT1G80960 "AT1G80960" [Arabido | 0.632 | 0.442 | 0.281 | 7.5e-12 | |
| TAIR|locus:2085013 | 532 | AT3G42770 "AT3G42770" [Arabido | 0.802 | 0.513 | 0.265 | 2.6e-11 | |
| TAIR|locus:2099054 | 454 | AT3G58880 "AT3G58880" [Arabido | 0.541 | 0.405 | 0.311 | 7.3e-11 | |
| TAIR|locus:2157922 | 444 | AT5G53840 "AT5G53840" [Arabido | 0.558 | 0.427 | 0.277 | 9e-11 | |
| TAIR|locus:2099644 | 481 | AT3G03360 [Arabidopsis thalian | 0.679 | 0.480 | 0.278 | 1.4e-10 | |
| TAIR|locus:5019474764 | 306 | AT3G26922 "AT3G26922" [Arabido | 0.8 | 0.888 | 0.282 | 2e-10 |
| TAIR|locus:2010032 AT1G13570 "AT1G13570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 224 (83.9 bits), Expect = 1.1e-16, P = 1.1e-16
Identities = 70/213 (32%), Positives = 106/213 (49%)
Query: 19 DWISRLPDEILVNIISRLAVREAARTSVLSSRWKYLWTFTTCLNFSALKMLWNVKKDPAT 78
D+IS LP I+ NI++RL++R+A RTSVLSS+W+Y W+ T L F K + + D
Sbjct: 6 DFISDLPQSIIENILTRLSIRDAIRTSVLSSKWRYKWSTLTDLVFDE-KCV-SPSNDRCV 63
Query: 79 LEEERYNYINWVNDVLDSHMGLCINEFRLCFELRNSHGSFITHWIFTALAKKVQKLELNL 138
+E N + ++ VL H G I++F+L + I W+ +++L L L
Sbjct: 64 VET---NLVRFITGVLLLHQGP-IHKFQLSTSFKQCRPD-IDQWLLFLSRNGIKELVLKL 118
Query: 139 HPVGGGFWPPLELY-AFPPECLKL----FRSPRTLSNIKSLRSLCLDAVNVSGEVLEFFI 193
G F P L+ CL+L F P+ L+SL L + V+ EV+E I
Sbjct: 119 GE--GEFRVPACLFNCLKLTCLELCHCEFDPPQYFKGFSYLKSLNLHQILVAPEVIESLI 176
Query: 194 YSCPLLARLRVVFSLDLLSLKVVGSSVKLKYLD 226
CPLL L + + D L L + ++ YLD
Sbjct: 177 SGCPLLEFLSLSY-FDSLVLSISAPNLMYLYLD 208
|
|
| TAIR|locus:2052351 AT2G42730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081172 AT3G59210 "AT3G59210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162499 AT5G22670 "AT5G22670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025812 AT1G80960 "AT1G80960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085013 AT3G42770 "AT3G42770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099054 AT3G58880 "AT3G58880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157922 AT5G53840 "AT5G53840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099644 AT3G03360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:5019474764 AT3G26922 "AT3G26922" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 340 | |||
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 0.001 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Score = 36.0 bits (84), Expect = 0.001
Identities = 14/38 (36%), Positives = 24/38 (63%)
Query: 19 DWISRLPDEILVNIISRLAVREAARTSVLSSRWKYLWT 56
+ LPD++L+ I+SRL ++ R S++S RW+ L
Sbjct: 1 FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVD 38
|
This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.75 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.55 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.84 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.4 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.37 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.01 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.96 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.9 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.87 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.72 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.71 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.69 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.42 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.39 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.37 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.31 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.28 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.27 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.23 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.07 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.03 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 96.97 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.71 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.56 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 96.48 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.95 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.9 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 95.54 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 95.37 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.22 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 95.02 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 94.75 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 94.58 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.53 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 94.25 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 94.19 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.17 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 93.71 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 93.55 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 93.5 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 93.21 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 93.06 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 92.57 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 92.37 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 92.28 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 92.0 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 91.94 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 91.52 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 91.11 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 90.92 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 90.29 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 88.21 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 87.69 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 87.02 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 86.28 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 85.8 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 85.39 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 84.4 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 84.29 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 80.67 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.75 E-value=2.3e-19 Score=151.74 Aligned_cols=272 Identities=19% Similarity=0.289 Sum_probs=178.4
Q ss_pred ccCCcCCCCChHHHHHHHhcCChHHHHHHHHhhhhhhhh------ccccceeEecccccccccCCCchhhHHhHHHHHHH
Q 019478 16 ILVDWISRLPDEILVNIISRLAVREAARTSVLSSRWKYL------WTFTTCLNFSALKMLWNVKKDPATLEEERYNYINW 89 (340)
Q Consensus 16 ~~~d~~s~LPd~il~~Ils~L~~~d~~r~~~vsk~W~~l------w~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 89 (340)
.++-.|+.|||||+..||+.|+-+|+.+++.|||||+++ |.. +++..+.+.+ +.
T Consensus 93 npgv~~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~---lDl~~r~i~p-----------------~~ 152 (419)
T KOG2120|consen 93 NPGVSWDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQT---LDLTGRNIHP-----------------DV 152 (419)
T ss_pred CCCCCcccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceee---eccCCCccCh-----------------hH
Confidence 444558999999999999999999999999999999875 554 5555554443 23
Q ss_pred HHHHHhhcCCCceeEEEEEEEeCCCCchhHHHHHHHHHhCCCeEEEEEecCCCCCCCCCCceeeecCCceEeCCCCCCCC
Q 019478 90 VNDVLDSHMGLCINEFRLCFELRNSHGSFITHWIFTALAKKVQKLELNLHPVGGGFWPPLELYAFPPECLKLFRSPRTLS 169 (340)
Q Consensus 90 v~~~l~~~~~~~l~~l~l~~~~~~~~~~~~~~w~~~~~~~~l~~L~l~~~~~~~~~~~~~~~~~~~~~~L~L~~~~~~~~ 169 (340)
..+++.+ +|..|++.-.+.. ++. +.. ....+..+++.++++...-.- . .+...+.
T Consensus 153 l~~l~~r----gV~v~Rlar~~~~-~pr-lae-~~~~frsRlq~lDLS~s~it~-----s-------------tl~~iLs 207 (419)
T KOG2120|consen 153 LGRLLSR----GVIVFRLARSFMD-QPR-LAE-HFSPFRSRLQHLDLSNSVITV-----S-------------TLHGILS 207 (419)
T ss_pred HHHHHhC----CeEEEEcchhhhc-Cch-hhh-hhhhhhhhhHHhhcchhheeH-----H-------------HHHHHHH
Confidence 3333322 3666655211110 110 111 112233467777776543210 0 1111235
Q ss_pred CCCCCceEEeeeEEecHHHHHHHHhcCccceEEeeeecCCcceEEE---eccCCCcceEEEEecCCceEE-----EEECC
Q 019478 170 NIKSLRSLCLDAVNVSGEVLEFFIYSCPLLARLRVVFSLDLLSLKV---VGSSVKLKYLDICYCYFMEEV-----EISAP 241 (340)
Q Consensus 170 ~~~~L~~L~L~~~~i~~~~l~~lls~cp~Le~L~L~~c~~~~~l~i---~~~~~~L~~L~l~~c~~l~~l-----~i~~p 241 (340)
.|.+|+.|+|.+.+++|.-... ++...+|+.|+|+.|.|++.-.. -++|+.|.+|+++.|....+. ..-.+
T Consensus 208 ~C~kLk~lSlEg~~LdD~I~~~-iAkN~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise 286 (419)
T KOG2120|consen 208 QCSKLKNLSLEGLRLDDPIVNT-IAKNSNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISE 286 (419)
T ss_pred HHHhhhhccccccccCcHHHHH-HhccccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhch
Confidence 7899999999999998875554 55667899999999999874322 246689999999999855542 22259
Q ss_pred ceeEEEEeccceee-------ecCCCcccceEEEeeccCchhhhhhhhhhccCCCcceEEEE-----ccc---CCcCCCc
Q 019478 242 SVRSFKYYGPEIKL-------RMENVPQLLDISIGGGYGVRMKHAISPIMSYFHQLETLELG-----FVL---NAVSILN 306 (340)
Q Consensus 242 ~L~~l~l~~~~~~~-------~~~~~~~L~~l~l~~~~~~~~~~~~~~ll~~~~~L~~L~l~-----~~~---~~~~f~~ 306 (340)
+|..|.++|+...+ ....||+|.++.+.-+.. +.......+..++-|++|.+. .|+ .+...+.
T Consensus 287 ~l~~LNlsG~rrnl~~sh~~tL~~rcp~l~~LDLSD~v~--l~~~~~~~~~kf~~L~~lSlsRCY~i~p~~~~~l~s~ps 364 (419)
T KOG2120|consen 287 TLTQLNLSGYRRNLQKSHLSTLVRRCPNLVHLDLSDSVM--LKNDCFQEFFKFNYLQHLSLSRCYDIIPETLLELNSKPS 364 (419)
T ss_pred hhhhhhhhhhHhhhhhhHHHHHHHhCCceeeeccccccc--cCchHHHHHHhcchheeeehhhhcCCChHHeeeeccCcc
Confidence 99999999985432 346799999999875521 112233445688999999998 333 3557778
Q ss_pred ceEEEEEcCCchhhhHHHHHHHHhcccccccc
Q 019478 307 LKCFRVVNNFLCFCLILLLFLRKICNSHNVSC 338 (340)
Q Consensus 307 L~~L~l~~~~~~~c~~l~~~~l~~cp~~~~~~ 338 (340)
|.+|++.+.+.. . -..++.+.||++++.|
T Consensus 365 l~yLdv~g~vsd--t-~mel~~e~~~~lkin~ 393 (419)
T KOG2120|consen 365 LVYLDVFGCVSD--T-TMELLKEMLSHLKINC 393 (419)
T ss_pred eEEEEeccccCc--h-HHHHHHHhCccccccc
Confidence 999999763322 1 3456788999987665
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 340 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 4e-04 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 4e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 41.8 bits (97), Expect = 3e-04
Identities = 41/241 (17%), Positives = 81/241 (33%), Gaps = 55/241 (22%)
Query: 9 LDTKQDEILVDWISRL--PD-EILVNIISRLAVREAARTSVLSSRWKYLWT----FTTCL 61
L +KQ+E++ ++ + + + L++ I + + T + + L+ F
Sbjct: 71 LLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAK-Y 129
Query: 62 NFSALKMLWNVKKDPATLEEERYNYI----------NW-VNDVLDSHMGLCINEFRLCFE 110
N S L+ +++ A LE + W DV S+ C +F++
Sbjct: 130 NVSRLQPYLKLRQ--ALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKI--- 184
Query: 111 LRNSHGSFITHWI-------FTALAKKVQKLELNLHPVG-----GGFWPPLELYAFPPEC 158
W+ + + +QKL + P L +++ E
Sbjct: 185 ----------FWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAEL 234
Query: 159 LKLFRSPRTLSNIKSLRSLCLDAVNVSGEVLEFFIYSCPLLARLR---VVFSLDLLSLKV 215
+L +S L L L V + + F SC +L R V L +
Sbjct: 235 RRLLKSKP---YENCL--LVLLNVQ-NAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTH 288
Query: 216 V 216
+
Sbjct: 289 I 289
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.77 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.74 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.71 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.89 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.83 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.78 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.72 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.55 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.43 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.41 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.36 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.32 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.31 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.3 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.27 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.24 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.21 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.18 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.18 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.16 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.16 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.14 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.12 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.1 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.09 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.09 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.07 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.04 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.04 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.02 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.02 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.0 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.0 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.99 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.99 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.99 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.98 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.97 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.96 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.95 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 97.94 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.94 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.94 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.89 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.88 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.88 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.88 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.86 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.86 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.86 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.85 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.85 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.85 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.84 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.84 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.84 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.84 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.83 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.82 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.82 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.81 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.8 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.8 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.8 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.79 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.77 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.77 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.76 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.76 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.75 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.73 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.7 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.7 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.69 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.69 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.69 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.66 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.66 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.65 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.63 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.63 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.6 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.56 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.54 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.54 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.51 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.51 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.49 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.49 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.47 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.47 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.45 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.43 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.42 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.42 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.42 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.42 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.41 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.39 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.38 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.38 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.37 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.34 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.29 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.26 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.24 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.24 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.22 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.18 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.17 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.15 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.14 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.12 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.02 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.98 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.97 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.96 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.93 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.84 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.78 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 96.73 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.72 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.6 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.45 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.35 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.32 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 96.29 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.24 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.14 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.11 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.05 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.0 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 95.85 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.84 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 95.69 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 95.16 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 95.15 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 95.14 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 94.98 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 94.91 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 94.48 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 94.48 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 94.37 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 94.08 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 94.02 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 93.41 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 92.57 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 92.0 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 91.98 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 91.65 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 88.71 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 85.13 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 83.35 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 80.43 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 80.39 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 80.38 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=99.77 E-value=1e-18 Score=169.28 Aligned_cols=153 Identities=15% Similarity=0.168 Sum_probs=90.1
Q ss_pred cCCcCCCCChHHHHHHHhcCC-hHHHHHHHHhhhhhhhhcc-ccceeEecccccccccCCCchhhHHhHHHHHHHHHHHH
Q 019478 17 LVDWISRLPDEILVNIISRLA-VREAARTSVLSSRWKYLWT-FTTCLNFSALKMLWNVKKDPATLEEERYNYINWVNDVL 94 (340)
Q Consensus 17 ~~d~~s~LPd~il~~Ils~L~-~~d~~r~~~vsk~W~~lw~-~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l 94 (340)
+.|.|+.||||||.+||+||+ .+|+++++.|||+|+++.. ....+.+....... ....+
T Consensus 2 ~~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~~-------------------~~~~~ 62 (594)
T 2p1m_B 2 QKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVS-------------------PATVI 62 (594)
T ss_dssp --------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSSC-------------------HHHHH
T ss_pred cccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeeccccccC-------------------HHHHH
Confidence 358899999999999999999 9999999999999998722 12234443221110 01223
Q ss_pred hhcCCCceeEEEEEEEeCC--------CCchhHHHHHHHHHh--CCCeEEEEEecCCCCCCCCCCceeeecCCceEeCCC
Q 019478 95 DSHMGLCINEFRLCFELRN--------SHGSFITHWIFTALA--KKVQKLELNLHPVGGGFWPPLELYAFPPECLKLFRS 164 (340)
Q Consensus 95 ~~~~~~~l~~l~l~~~~~~--------~~~~~~~~w~~~~~~--~~l~~L~l~~~~~~~~~~~~~~~~~~~~~~L~L~~~ 164 (340)
... +.++.+.+...... .....+..|+..... +++++|++..+.... .....+.
T Consensus 63 ~~~--~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~~-----~~~~~l~--------- 126 (594)
T 2p1m_B 63 RRF--PKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTD-----DCLELIA--------- 126 (594)
T ss_dssp HHC--TTCCEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCH-----HHHHHHH---------
T ss_pred hhC--CCceEEeccCCCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEcH-----HHHHHHH---------
Confidence 333 34888888654211 111345567777654 489999997653211 1111111
Q ss_pred CCCCCCCCCCceEEeeeE-EecHHHHHHHHhcCccceEEeeeecC
Q 019478 165 PRTLSNIKSLRSLCLDAV-NVSGEVLEFFIYSCPLLARLRVVFSL 208 (340)
Q Consensus 165 ~~~~~~~~~L~~L~L~~~-~i~~~~l~~lls~cp~Le~L~L~~c~ 208 (340)
..+++|++|+|.++ .+++.++..++.+||+|++|++.+|.
T Consensus 127 ----~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~ 167 (594)
T 2p1m_B 127 ----KSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESD 167 (594)
T ss_dssp ----HHCTTCCEEEEESCEEEEHHHHHHHHHHCTTCCEEECTTCE
T ss_pred ----HhCCCCcEEeCCCcCCCCHHHHHHHHHhCCCCCEEeCcCCc
Confidence 24677777777776 46666677777777777777777664
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 340 | ||||
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 1e-05 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 1e-05 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 0.001 | |
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 0.002 |
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Cdc4 F-box and linker domains species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 41.2 bits (96), Expect = 1e-05
Identities = 12/43 (27%), Positives = 20/43 (46%)
Query: 19 DWISRLPDEILVNIISRLAVREAARTSVLSSRWKYLWTFTTCL 61
D I+ LP EI + I + L + + +S W + +T L
Sbjct: 4 DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSL 46
|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.09 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.85 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.72 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.7 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.36 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.82 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.78 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.77 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.72 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.7 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.69 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.63 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.61 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.49 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.27 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.08 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.05 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.84 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.68 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 96.63 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.61 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.53 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.51 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.39 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.12 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.02 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.56 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 95.54 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 95.31 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.3 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 94.86 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 94.64 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 94.46 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 94.4 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 93.65 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 93.38 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 92.74 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 92.71 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 91.69 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 91.23 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 81.52 |
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.15 E-value=1e-11 Score=73.09 Aligned_cols=36 Identities=36% Similarity=0.552 Sum_probs=33.4
Q ss_pred CCCCChHHHHHHHhcCChHHHHHHHHhhhhhhhhcc
Q 019478 21 ISRLPDEILVNIISRLAVREAARTSVLSSRWKYLWT 56 (340)
Q Consensus 21 ~s~LPd~il~~Ils~L~~~d~~r~~~vsk~W~~lw~ 56 (340)
++.||+||+.+||+||+.+|+++++.|||+|+++..
T Consensus 1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~ 36 (41)
T d1fs1a1 1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLAS 36 (41)
T ss_dssp CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHT
T ss_pred CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhC
Confidence 578999999999999999999999999999998654
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|