Citrus Sinensis ID: 019484
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 340 | 2.2.26 [Sep-21-2011] | |||||||
| Q8VYZ0 | 645 | E3 ubiquitin-protein liga | yes | no | 0.973 | 0.513 | 0.634 | 1e-120 | |
| Q9FKA7 | 617 | E3 ubiquitin-protein liga | no | no | 0.920 | 0.507 | 0.591 | 1e-106 | |
| Q9C8E1 | 622 | Putative E3 ubiquitin-pro | no | no | 0.920 | 0.503 | 0.579 | 1e-105 | |
| Q680I0 | 623 | E3 ubiquitin-protein liga | no | no | 0.920 | 0.502 | 0.576 | 1e-104 | |
| Q9FVS2 | 660 | E3 ubiquitin-protein liga | no | no | 0.958 | 0.493 | 0.529 | 1e-102 | |
| Q681I0 | 465 | E3 ubiquitin-protein liga | no | no | 0.867 | 0.634 | 0.476 | 1e-74 | |
| Q96T88 | 793 | E3 ubiquitin-protein liga | yes | no | 0.261 | 0.112 | 0.438 | 6e-14 | |
| A7E320 | 786 | E3 ubiquitin-protein liga | yes | no | 0.261 | 0.113 | 0.448 | 7e-14 | |
| Q8VDF2 | 782 | E3 ubiquitin-protein liga | yes | no | 0.267 | 0.116 | 0.446 | 3e-13 | |
| Q7TPK1 | 774 | E3 ubiquitin-protein liga | yes | no | 0.238 | 0.104 | 0.467 | 5e-13 |
| >sp|Q8VYZ0|ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana GN=ORTH2 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 433 bits (1113), Expect = e-120, Method: Compositional matrix adjust.
Identities = 217/342 (63%), Positives = 250/342 (73%), Gaps = 11/342 (3%)
Query: 1 MAHVIQLPCNGDGMCMRCKETPVEEEQLCCKTCATPWHVACLVRPPESLASTLLWECPDC 60
MA IQLPC+GDG+CMRCK P EE L C TC TPWHV+CL PP++LASTL W CPDC
Sbjct: 1 MARDIQLPCDGDGVCMRCKSNPPPEESLTCGTCVTPWHVSCLSSPPKTLASTLQWHCPDC 60
Query: 61 TGDAAVAEDAGQAAG---GAGGIVAEIMAIEADVSLTESEKARRRQELLSGKAGSDGRGG 117
+G+ +G A G +VA I AIEAD SL+ EKA+ RQ LLSGK +
Sbjct: 61 SGEIDPLPVSGGATGFESAGSDLVAAIRAIEADESLSTEEKAKMRQRLLSGKGVEEDDEE 120
Query: 118 DHDGTKDKKGKHKVAGDGDENELSDIFGGSLNCSFCMQLPERPVTTPCGHNFCLKCFQKW 177
+ K K + ++ G +L CSFCMQLPERPVT PCGHN CLKCF+KW
Sbjct: 121 EKRKKKGKGKNPNL-------DVLSALGDNLMCSFCMQLPERPVTKPCGHNACLKCFEKW 173
Query: 178 IGLGKKTCAKCRCIIPSKMAGQPRINSTLVAAIRMAKRSNTTVPGGPSKIYHFVHNQDRP 237
+G GK+TC KCR IIP KMA PRINS+LVAAIR+AK S + SK++HF+ NQDRP
Sbjct: 174 MGQGKRTCGKCRSIIPEKMAKNPRINSSLVAAIRLAKVSKSAA-ATTSKVFHFISNQDRP 232
Query: 238 DKAYTTERAKRKGKANAASGKIFVTLPPDHFGPILAENDPERNQGVLVGESWEGRLECRQ 297
DKA+TTERAK+ GKANAASGKI+VT+PPDHFGPI AENDP RNQG+LVGESWE RLECRQ
Sbjct: 233 DKAFTTERAKKTGKANAASGKIYVTIPPDHFGPIPAENDPVRNQGLLVGESWEDRLECRQ 292
Query: 298 WGVHYPPVAGIAGQSKCGAQSVVLSGGYEDDEDHGEWFLYTG 339
WG H+P VAGIAGQS GAQSV LSGGY+DDEDHGEWFLYTG
Sbjct: 293 WGAHFPHVAGIAGQSTYGAQSVALSGGYKDDEDHGEWFLYTG 334
|
E3 ubiquitin-protein ligase. Participates in CpG methylation-dependent transcriptional regulation and epigenetic transcriptional silencing. Mediates ubiquitination with the E2 ubiquitin-conjugating enzyme UBC11. Promotes methylation-mediated gene silencing leading, for example, to early flowering. Associates with methylated DNA, and can binds to CpG, CpNpG, and CpNpN DNA motifs, with a strong preference for methylated forms, and with highest affinity for CpG substrate. Probably acts at the DNA methylation?histone interface to maintain centromeric heterochromatin. Arabidopsis thaliana (taxid: 3702) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FVS2|ORTH3_ARATH E3 ubiquitin-protein ligase ORTHRUS 3 OS=Arabidopsis thaliana GN=ORTH3 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q681I0|ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana GN=ORTHL PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 340 | ||||||
| 449445270 | 667 | PREDICTED: E3 ubiquitin-protein ligase O | 0.964 | 0.491 | 0.676 | 1e-131 | |
| 449487895 | 688 | PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu | 0.964 | 0.476 | 0.673 | 1e-130 | |
| 449457333 | 608 | PREDICTED: E3 ubiquitin-protein ligase O | 0.947 | 0.529 | 0.651 | 1e-127 | |
| 225425270 | 815 | PREDICTED: E3 ubiquitin-protein ligase O | 0.967 | 0.403 | 0.656 | 1e-126 | |
| 296085530 | 803 | unnamed protein product [Vitis vinifera] | 0.955 | 0.404 | 0.665 | 1e-125 | |
| 255543216 | 735 | zinc finger protein, putative [Ricinus c | 0.958 | 0.443 | 0.646 | 1e-124 | |
| 297837707 | 649 | hypothetical protein ARALYDRAFT_315436 [ | 0.964 | 0.505 | 0.649 | 1e-124 | |
| 255577358 | 752 | zinc finger protein, putative [Ricinus c | 0.958 | 0.433 | 0.646 | 1e-122 | |
| 313760924 | 713 | VARIANT IN METHYLATION-like protein [Lir | 0.964 | 0.460 | 0.659 | 1e-122 | |
| 449515239 | 745 | PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu | 0.947 | 0.432 | 0.651 | 1e-122 |
| >gi|449445270|ref|XP_004140396.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 474 bits (1219), Expect = e-131, Method: Compositional matrix adjust.
Identities = 232/343 (67%), Positives = 260/343 (75%), Gaps = 15/343 (4%)
Query: 2 AHVIQLPCNGDGMCMRCKETPVEEEQLCCKTCATPWHVACLVRPPESLASTLLWECPDCT 61
V QLPC+GDG+CM CK P + E + CKTC TPWHV+CL PPE+LASTL W+CPDC+
Sbjct: 20 TQVTQLPCDGDGICMLCKAKPSDVETITCKTCVTPWHVSCLSSPPETLASTLQWDCPDCS 79
Query: 62 G---DAAVAEDAGQA--AGGAGGIVAEIMAIEADVSLTESEKARRRQELLSGKAGSDGRG 116
D + + + +V I AIEADVSLT+ EKA +RQELLSGK SD
Sbjct: 80 TPPEDVILPPPGNHSFPTAPSSDLVTSIRAIEADVSLTDREKANKRQELLSGKLQSDK-- 137
Query: 117 GDHDGTKDKKGKHKVAGDGDENELSDIFGGSLNCSFCMQLPERPVTTPCGHNFCLKCFQK 176
DHD K+K K GD + D+ LNCSFCMQLPERPVTTPCGHNFCLKCFQK
Sbjct: 138 DDHDTNKEKIKK----GDN----VFDLIDERLNCSFCMQLPERPVTTPCGHNFCLKCFQK 189
Query: 177 WIGLGKKTCAKCRCIIPSKMAGQPRINSTLVAAIRMAKRSNTTVPGGPSKIYHFVHNQDR 236
WIG GK TCAKCR +IPSKMA QPRINSTLV IRMAK S + GG K+YHFVHNQ+R
Sbjct: 190 WIGQGKNTCAKCRSVIPSKMASQPRINSTLVTVIRMAKLSKSFASGGSQKVYHFVHNQNR 249
Query: 237 PDKAYTTERAKRKGKANAASGKIFVTLPPDHFGPILAENDPERNQGVLVGESWEGRLECR 296
PDKAYTT+RA++KGKANAASGKIFVT+P DHFGPI +ENDPERNQGVLVGE WE RLECR
Sbjct: 250 PDKAYTTDRAQKKGKANAASGKIFVTIPSDHFGPIPSENDPERNQGVLVGECWEDRLECR 309
Query: 297 QWGVHYPPVAGIAGQSKCGAQSVVLSGGYEDDEDHGEWFLYTG 339
QWG H+P VAGIAGQS GAQSVVLSGGY+DDEDHGEWFLYTG
Sbjct: 310 QWGAHFPHVAGIAGQSSIGAQSVVLSGGYQDDEDHGEWFLYTG 352
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449487895|ref|XP_004157854.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase ORTHRUS 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449457333|ref|XP_004146403.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225425270|ref|XP_002267902.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296085530|emb|CBI29262.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255543216|ref|XP_002512671.1| zinc finger protein, putative [Ricinus communis] gi|223548632|gb|EEF50123.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297837707|ref|XP_002886735.1| hypothetical protein ARALYDRAFT_315436 [Arabidopsis lyrata subsp. lyrata] gi|297332576|gb|EFH62994.1| hypothetical protein ARALYDRAFT_315436 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255577358|ref|XP_002529559.1| zinc finger protein, putative [Ricinus communis] gi|223530971|gb|EEF32828.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|313760924|gb|ADR79438.1| VARIANT IN METHYLATION-like protein [Liriodendron tulipifera] | Back alignment and taxonomy information |
|---|
| >gi|449515239|ref|XP_004164657.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase ORTHRUS 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 340 | ||||||
| TAIR|locus:2009420 | 645 | VIM1 "AT1G57820" [Arabidopsis | 0.973 | 0.513 | 0.596 | 3.9e-108 | |
| TAIR|locus:2013800 | 622 | VIM4 "VARIANT IN METHYLATION 4 | 0.558 | 0.305 | 0.701 | 2.6e-98 | |
| TAIR|locus:2013840 | 623 | VIM2 "VARIANT IN METHYLATION 2 | 0.558 | 0.304 | 0.701 | 8.7e-98 | |
| TAIR|locus:2164835 | 617 | VIM3 "VARIANT IN METHYLATION 3 | 0.558 | 0.307 | 0.691 | 3.7e-97 | |
| TAIR|locus:2009425 | 660 | VIM5 "VARIANT IN METHYLATION 5 | 0.958 | 0.493 | 0.490 | 2.8e-89 | |
| TAIR|locus:2138591 | 465 | ORTHL "ORTHRUS-like" [Arabidop | 0.7 | 0.511 | 0.529 | 1.4e-70 | |
| UNIPROTKB|A7E320 | 786 | UHRF1 "E3 ubiquitin-protein li | 0.261 | 0.113 | 0.459 | 1e-17 | |
| UNIPROTKB|Q96T88 | 793 | UHRF1 "E3 ubiquitin-protein li | 0.261 | 0.112 | 0.448 | 1.2e-17 | |
| UNIPROTKB|F1S7K1 | 813 | UHRF1 "Uncharacterized protein | 0.261 | 0.109 | 0.448 | 1.5e-17 | |
| MGI|MGI:1338889 | 782 | Uhrf1 "ubiquitin-like, contain | 0.267 | 0.116 | 0.456 | 4.2e-17 |
| TAIR|locus:2009420 VIM1 "AT1G57820" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1069 (381.4 bits), Expect = 3.9e-108, P = 3.9e-108
Identities = 204/342 (59%), Positives = 231/342 (67%)
Query: 1 MAHVIQLPCNGDGMCMRCKETPVEEEQLCCKTCATPWHVACLVRPPESLASTLLWECPDC 60
MA IQLPC+GDG+CMRCK P EE L C TC TPWHV+CL PP++LASTL W CPDC
Sbjct: 1 MARDIQLPCDGDGVCMRCKSNPPPEESLTCGTCVTPWHVSCLSSPPKTLASTLQWHCPDC 60
Query: 61 TXXXX---XXXXXXXXXXXXXXXXXXXXXXXXDVSLTESEKARRRQELLSGKAGSXXXXX 117
+ D SL+ EKA+ RQ LLSGK
Sbjct: 61 SGEIDPLPVSGGATGFESAGSDLVAAIRAIEADESLSTEEKAKMRQRLLSGKGVEEDDEE 120
Query: 118 XXXXXXXXXXXXXXXXXXXENELSDIFGGSLNCSFCMQLPERPVTTPCGHNFCLKCFQKW 177
++ G +L CSFCMQLPERPVT PCGHN CLKCF+KW
Sbjct: 121 EKRKKKGKGKNPNL-------DVLSALGDNLMCSFCMQLPERPVTKPCGHNACLKCFEKW 173
Query: 178 IGLGKKTCAKCRCIIPSKMAGQPRINSTLVAAIRMAKRSNTTVPGGPSKIYHFVHNQDRP 237
+G GK+TC KCR IIP KMA PRINS+LVAAIR+AK S + SK++HF+ NQDRP
Sbjct: 174 MGQGKRTCGKCRSIIPEKMAKNPRINSSLVAAIRLAKVSKSAA-ATTSKVFHFISNQDRP 232
Query: 238 DKAYTTERAKRKGKANAASGKIFVTLPPDHFGPILAENDPERNQGVLVGESWEGRLECRQ 297
DKA+TTERAK+ GKANAASGKI+VT+PPDHFGPI AENDP RNQG+LVGESWE RLECRQ
Sbjct: 233 DKAFTTERAKKTGKANAASGKIYVTIPPDHFGPIPAENDPVRNQGLLVGESWEDRLECRQ 292
Query: 298 WGVHYPPVAGIAGQSKCGAQSVVLSGGYEDDEDHGEWFLYTG 339
WG H+P VAGIAGQS GAQSV LSGGY+DDEDHGEWFLYTG
Sbjct: 293 WGAHFPHVAGIAGQSTYGAQSVALSGGYKDDEDHGEWFLYTG 334
|
|
| TAIR|locus:2013800 VIM4 "VARIANT IN METHYLATION 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013840 VIM2 "VARIANT IN METHYLATION 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2164835 VIM3 "VARIANT IN METHYLATION 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009425 VIM5 "VARIANT IN METHYLATION 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2138591 ORTHL "ORTHRUS-like" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7E320 UHRF1 "E3 ubiquitin-protein ligase UHRF1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96T88 UHRF1 "E3 ubiquitin-protein ligase UHRF1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S7K1 UHRF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1338889 Uhrf1 "ubiquitin-like, containing PHD and RING finger domains, 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 340 | |||
| smart00466 | 155 | smart00466, SRA, SET and RING finger associated do | 2e-25 | |
| pfam02182 | 154 | pfam02182, YDG_SRA, YDG/SRA domain | 5e-25 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 1e-09 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 1e-07 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 2e-06 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 7e-06 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 9e-06 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-05 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 4e-05 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 4e-05 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 4e-04 | |
| COG5222 | 427 | COG5222, COG5222, Uncharacterized conserved protei | 0.004 |
| >gnl|CDD|197742 smart00466, SRA, SET and RING finger associated domain | Back alignment and domain information |
|---|
Score = 99.4 bits (248), Expect = 2e-25
Identities = 30/72 (41%), Positives = 39/72 (54%), Gaps = 4/72 (5%)
Query: 273 AENDPERNQGVLVGESWEGRLECRQWGVHYPPVAGIAGQS----KCGAQSVVLSGGYEDD 328
+ GV VG+ + R+E G+H P AGI G + GA SVV SGGYEDD
Sbjct: 1 MKRIFGPVPGVEVGDIFFYRVELCLVGLHRPTQAGIDGLESDEGEPGATSVVSSGGYEDD 60
Query: 329 EDHGEWFLYTGR 340
D G+ +YTG+
Sbjct: 61 TDDGDVLIYTGQ 72
|
Domain of unknown function in SET domain containing proteins and in Deinococcus radiodurans DRA1533. Length = 155 |
| >gnl|CDD|216920 pfam02182, YDG_SRA, YDG/SRA domain | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227547 COG5222, COG5222, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 340 | |||
| smart00466 | 155 | SRA SET and RING finger associated domain. Domain | 99.87 | |
| PF02182 | 155 | SAD_SRA: SAD/SRA domain; InterPro: IPR003105 This | 99.86 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 99.38 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.25 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 99.19 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.17 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.14 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 99.11 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.11 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 99.09 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.08 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 99.0 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.95 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 98.93 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.86 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.83 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.81 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.81 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.78 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.78 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.73 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.69 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.69 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.67 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.66 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.64 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.63 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.55 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.54 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.52 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.5 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.44 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.44 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.42 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 98.41 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 98.4 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 98.37 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.32 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.28 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 98.25 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.23 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.15 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.06 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 98.0 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.99 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 97.9 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.87 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.84 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.84 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.69 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 97.67 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.6 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.59 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.56 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.51 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 97.41 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.39 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.25 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 96.9 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.84 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.79 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.78 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.64 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 96.46 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.43 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.37 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.29 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.28 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.19 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 96.1 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 96.09 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 96.07 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 95.99 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 95.99 | |
| KOG1246 | 904 | consensus DNA-binding protein jumonji/RBP2/SMCY, c | 95.94 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.9 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 95.7 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 95.63 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 95.52 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.38 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.09 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 95.02 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 94.89 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 94.84 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 94.78 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 94.73 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.69 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 93.9 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 93.75 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 93.42 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 93.23 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 93.18 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 93.0 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 92.97 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 92.85 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 92.44 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 92.27 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.2 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.18 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 92.18 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 91.95 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.94 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 91.74 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 91.22 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 90.99 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 90.55 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 90.44 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 90.06 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 89.82 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 89.71 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.59 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 86.88 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 86.39 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 85.54 | |
| PHA03096 | 284 | p28-like protein; Provisional | 85.4 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 84.58 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 84.25 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 84.09 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.71 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 81.41 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 80.98 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.52 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 80.4 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 80.04 |
| >smart00466 SRA SET and RING finger associated domain | Back alignment and domain information |
|---|
Probab=99.87 E-value=5.4e-23 Score=173.96 Aligned_cols=67 Identities=49% Similarity=0.783 Sum_probs=64.5
Q ss_pred CCCCCCCCCCCCcccCCCCcccceecchhhhhhhcccCCCcCCccCCC----CCCcEEEEecCccccCCCCCceEEEecC
Q 019484 265 PDHFGPILAENDPERNQGVLVGESWEGRLECRQWGVHYPPVAGIAGQS----KCGAQSVVLSGGYEDDEDHGEWFLYTGR 340 (340)
Q Consensus 265 ~~~~G~ip~~~d~~r~~g~~vG~~~~~r~~~~~~g~h~~~~~Gi~~~~----~~ga~si~~sg~y~~d~d~g~~~~ytg~ 340 (340)
.++||+|| |++||++|++|++|+.+|+|+++++||++++ ..||+|||+||||+||+|+||+|+|||+
T Consensus 2 ~~~~G~vp---------Gv~vGd~f~~R~el~~~GlH~~~~~GI~~~~~~~~~~~A~SIV~SggYedd~D~gd~liYtG~ 72 (155)
T smart00466 2 KHIFGPVP---------GVEVGDIFFFRVELCLVGLHRPTQAGIDGLTADEGEPGATSVVSSGGYEDDTDDGDVLIYTGQ 72 (155)
T ss_pred CceEeCCC---------CccCCCEEcchhHhhhhcccCcccCCcccccccCCCccEEEEEECCCccCcccCCCEEEEEcc
Confidence 57899999 9999999999999999999999999999988 6789999999999999999999999996
|
Domain of unknown function in SET domain containing proteins and in Deinococcus radiodurans DRA1533. Domain in SET domain containing proteins and in Deinococcus radiodurans DRA1533. |
| >PF02182 SAD_SRA: SAD/SRA domain; InterPro: IPR003105 This domain has been termed SRA-YDG, for SET and Ring finger Associated, and because of the conserved YDG motif within the domain | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 340 | ||||
| 3clz_A | 212 | The Set And Ring Associated (Sra) Domain Of Uhrf1 B | 2e-14 | ||
| 2zo0_B | 212 | Mouse Np95 Sra Domain Dna Specific Complex 1 Length | 2e-14 | ||
| 2pb7_A | 239 | Crystal Structure Of The Sra Domain Of The Human Uh | 2e-14 | ||
| 3dwh_A | 208 | Structural And Functional Analysis Of Sra Domain Le | 3e-14 | ||
| 3f8j_B | 212 | Mouse Uhrf1 Sra Domain Bound With Hemi-methylated C | 3e-14 | ||
| 2zkd_A | 210 | Crystal Structure Of The Sra Domain Of Mouse Np95 I | 4e-14 | ||
| 3bi7_A | 212 | Crystal Structure Of The Sra Domain Of E3 Ubiquitin | 4e-14 | ||
| 3oln_A | 231 | Crystal Structure Of The Sra Domain Of E3 Ubiquitin | 2e-11 | ||
| 3q0c_X | 167 | Crystal Structure Of Suvh5 Sra-Fully Methylated Cg | 1e-04 | ||
| 3q0b_X | 167 | Crystal Structure Of Suvh5 Sra- Fully Methylated Cg | 4e-04 | ||
| 2ysl_A | 73 | Solution Structure Of The Ring Domain (1-66) From T | 4e-04 | ||
| 2ysj_A | 63 | Solution Structure Of The Ring Domain (1-56) From T | 6e-04 |
| >pdb|3CLZ|A Chain A, The Set And Ring Associated (Sra) Domain Of Uhrf1 Bound To Methylated Dna Length = 212 | Back alignment and structure |
|
| >pdb|2ZO0|B Chain B, Mouse Np95 Sra Domain Dna Specific Complex 1 Length = 212 | Back alignment and structure |
| >pdb|2PB7|A Chain A, Crystal Structure Of The Sra Domain Of The Human Uhrf1 Protein Length = 239 | Back alignment and structure |
| >pdb|3DWH|A Chain A, Structural And Functional Analysis Of Sra Domain Length = 208 | Back alignment and structure |
| >pdb|3F8J|B Chain B, Mouse Uhrf1 Sra Domain Bound With Hemi-methylated Cpg, Crystal Structure In Space Group C222(1) Length = 212 | Back alignment and structure |
| >pdb|2ZKD|A Chain A, Crystal Structure Of The Sra Domain Of Mouse Np95 In Complex With Hemi-Methylated Cpg Dna Length = 210 | Back alignment and structure |
| >pdb|3BI7|A Chain A, Crystal Structure Of The Sra Domain Of E3 Ubiquitin-Protein Ligase Uhrf1 Length = 212 | Back alignment and structure |
| >pdb|3OLN|A Chain A, Crystal Structure Of The Sra Domain Of E3 Ubiquitin-Protein Ligase Uhrf2 Length = 231 | Back alignment and structure |
| >pdb|3Q0C|X Chain X, Crystal Structure Of Suvh5 Sra-Fully Methylated Cg Dna Complex In Space Group P6122 Length = 167 | Back alignment and structure |
| >pdb|3Q0B|X Chain X, Crystal Structure Of Suvh5 Sra- Fully Methylated Cg Dna Complex In Space Group P42212 Length = 167 | Back alignment and structure |
| >pdb|2YSL|A Chain A, Solution Structure Of The Ring Domain (1-66) From Tripartite Motif-containing Protein 31 Length = 73 | Back alignment and structure |
| >pdb|2YSJ|A Chain A, Solution Structure Of The Ring Domain (1-56) From Tripartite Motif-containing Protein 31 Length = 63 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3oln_A E3 ubiquitin-protein ligase UHRF2; DNA-binding, metal-binding, nucleus, phosphorylation transcription, transcription regulation; 2.30A {Homo sapiens} Length = 231 | Back alignment and structure |
|---|
Score = 110 bits (277), Expect = 4e-29
Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 11/100 (11%)
Query: 242 TTERAKRKGKANAASG--KIFVTLPPDHFGPILAENDPERNQGVLVGESWEGRLECRQWG 299
+TE + G+ A G + +P +H+GPI G+ VG +W R++ + G
Sbjct: 2 STESRRDWGRGMACVGRTRECTIVPSNHYGPI---------PGIPVGSTWRFRVQVSEAG 52
Query: 300 VHYPPVAGIAGQSKCGAQSVVLSGGYEDDEDHGEWFLYTG 339
VH P V GI G+S GA S+VL+GG+ D+ D G+ F YTG
Sbjct: 53 VHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGDEFTYTG 92
|
| >3fde_A E3 ubiquitin-protein ligase UHRF1; SRA domain, base flipping, DNA CPG methylation, cell cycle, developmental protein, DNA damage; HET: 5CM; 1.41A {Mus musculus} PDB: 2zo0_B* 2zo2_B* 3f8i_A* 2zo1_B* 3f8j_B* 2zkd_A* 2zke_A* 2zkf_A* 2zkg_A 3dwh_A 3bi7_A 3clz_A* Length = 212 | Back alignment and structure |
|---|
| >2pb7_A E3 ubiquitin-protein ligase UHRF1; beta barrel, NEW fold; 1.90A {Homo sapiens} SCOP: b.122.1.12 Length = 239 | Back alignment and structure |
|---|
| >3q0b_X Histone-lysine N-methyltransferase, H3 lysine-9 S SUVH5; SRA, fully methylated CG, SUVH5, 5MC binding protein, fully methylated CG duplex DNA; HET: DNA 5CM; 2.20A {Arabidopsis thaliana} PDB: 3q0c_X* 3q0d_X* 3q0f_X* Length = 167 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 340 | |||
| 3oln_A | 231 | E3 ubiquitin-protein ligase UHRF2; DNA-binding, me | 99.95 | |
| 3fde_A | 212 | E3 ubiquitin-protein ligase UHRF1; SRA domain, bas | 99.9 | |
| 2pb7_A | 239 | E3 ubiquitin-protein ligase UHRF1; beta barrel, NE | 99.9 | |
| 3q0b_X | 167 | Histone-lysine N-methyltransferase, H3 lysine-9 S | 99.87 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.63 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.63 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.61 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.61 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.6 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 99.6 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.6 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.57 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.56 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.54 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.54 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.52 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.51 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.5 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.5 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 99.49 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.48 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.48 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.48 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.47 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.46 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.46 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 99.45 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.45 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.44 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.41 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.41 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 99.41 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.4 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.38 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.37 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 99.36 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.36 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.36 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.36 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.35 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.35 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.35 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.35 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.34 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.33 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.32 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.31 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.31 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.31 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.31 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.3 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.3 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.29 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.28 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.28 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.27 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.26 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.24 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.23 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.21 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 99.17 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.17 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.17 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.16 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.15 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.13 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.13 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.12 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.12 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.11 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.1 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.1 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 99.08 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.05 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.05 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.04 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.04 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.04 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.03 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 99.02 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.98 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.97 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.97 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.91 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.91 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.87 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.86 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 98.84 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 98.81 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.79 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.79 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.74 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.72 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 98.72 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.7 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 98.7 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.69 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 98.68 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.65 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.63 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.63 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.6 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.52 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.49 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.46 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.43 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 98.35 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.32 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.3 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 98.19 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 98.09 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.99 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 97.93 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.86 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 97.8 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.76 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 97.73 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 97.71 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.6 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 97.6 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 97.59 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 97.55 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 97.54 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 97.5 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 97.33 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 97.17 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.1 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 96.94 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 96.57 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 96.48 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 96.42 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 96.12 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 95.74 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 95.29 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 94.38 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 93.45 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 92.7 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 92.04 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 87.49 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 86.32 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 85.43 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 85.38 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 85.22 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 83.44 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 83.44 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 83.02 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 81.75 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 80.72 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 80.2 |
| >3oln_A E3 ubiquitin-protein ligase UHRF2; DNA-binding, metal-binding, nucleus, phosphorylation transcription, transcription regulation; 2.30A {Homo sapiens} SCOP: b.122.1.12 | Back alignment and structure |
|---|
Probab=99.95 E-value=1.4e-28 Score=216.57 Aligned_cols=89 Identities=43% Similarity=0.782 Sum_probs=68.4
Q ss_pred hHHHhhhCccccccccccc--cCCCCCCCCCCCCCCcccCCCCcccceecchhhhhhhcccCCCcCCccCCCCCCcEEEE
Q 019484 243 TERAKRKGKANAASGKIFV--TLPPDHFGPILAENDPERNQGVLVGESWEGRLECRQWGVHYPPVAGIAGQSKCGAQSVV 320 (340)
Q Consensus 243 ~era~r~~~~na~sG~~~~--~~~~~~~G~ip~~~d~~r~~g~~vG~~~~~r~~~~~~g~h~~~~~Gi~~~~~~ga~si~ 320 (340)
++.+++|++++|++|++|+ ++|.++||+|| ||+||+||++|++|+++|+|+|+|+||+|+.+.||+|||
T Consensus 3 ~~~~~~~g~~~a~~g~~~~~~~~p~~~~G~IP---------GV~VGd~f~~R~el~~~GlH~p~~aGI~g~~~~GA~SIV 73 (231)
T 3oln_A 3 TESRRDWGRGMACVGRTRECTIVPSNHYGPIP---------GIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLV 73 (231)
T ss_dssp ---------------------CCCTTCCSCCT---------TCCTTCEESSHHHHHHTTSSCCSSCSEEEETTTEEEEEE
T ss_pred ccccccccccccccceeEEEeecCCccCcCCC---------CCcCcCEEccHHHHhhhCCCCcccCCcccCCCCCeEEEE
Confidence 3466789999999999998 56999999999 999999999999999999999999999999999999999
Q ss_pred ecCccccCCCCCceEEEecC
Q 019484 321 LSGGYEDDEDHGEWFLYTGR 340 (340)
Q Consensus 321 ~sg~y~~d~d~g~~~~ytg~ 340 (340)
+||||+||+|+||+|+||||
T Consensus 74 lSGgYeDD~D~Gd~liYTGs 93 (231)
T 3oln_A 74 LAGGFADEVDRGDEFTYTGS 93 (231)
T ss_dssp ESSCSSTTCBCSSEEEEECC
T ss_pred ecCCccccCCCCCEEEEEcC
Confidence 99999999999999999997
|
| >3fde_A E3 ubiquitin-protein ligase UHRF1; SRA domain, base flipping, DNA CPG methylation, cell cycle, developmental protein, DNA damage; HET: 5CM; 1.41A {Mus musculus} SCOP: b.122.1.12 PDB: 2zo0_B* 2zo2_B* 3f8i_A* 2zo1_B* 3f8j_B* 2zkd_A* 2zke_A* 2zkf_A* 2zkg_A 3dwh_A 3bi7_A 3clz_A* | Back alignment and structure |
|---|
| >2pb7_A E3 ubiquitin-protein ligase UHRF1; beta barrel, NEW fold; 1.90A {Homo sapiens} SCOP: b.122.1.12 | Back alignment and structure |
|---|
| >3q0b_X Histone-lysine N-methyltransferase, H3 lysine-9 S SUVH5; SRA, fully methylated CG, SUVH5, 5MC binding protein, fully methylated CG duplex DNA; HET: DNA 5CM; 2.20A {Arabidopsis thaliana} PDB: 3q0c_X* 3q0d_X* 3q0f_X* | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 340 | ||||
| d2zkda1 | 209 | b.122.1.12 (A:405-613) E3 ubiquitin-protein ligase | 6e-29 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 3e-12 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 1e-11 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 8e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 4e-09 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 8e-08 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 3e-07 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 1e-06 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-06 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 4e-06 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 6e-06 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 4e-04 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 5e-04 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 6e-04 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 8e-04 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 0.001 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 0.002 |
| >d2zkda1 b.122.1.12 (A:405-613) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PUA domain-like superfamily: PUA domain-like family: SRA domain-like domain: E3 ubiquitin-protein ligase UHRF1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 108 bits (272), Expect = 6e-29
Identities = 41/90 (45%), Positives = 51/90 (56%), Gaps = 9/90 (10%)
Query: 250 GKANAASGKIFVTLPPDHFGPILAENDPERNQGVLVGESWEGRLECRQWGVHYPPVAGIA 309
G A +P +HFGPI GV VG W R++ + GVH P VAGI
Sbjct: 1 GMACVGRTTECTIVPANHFGPI---------PGVPVGTMWRFRVQVSESGVHRPHVAGIH 51
Query: 310 GQSKCGAQSVVLSGGYEDDEDHGEWFLYTG 339
G+S GA S+VL+GGYEDD D+G +F YTG
Sbjct: 52 GRSNDGAYSLVLAGGYEDDVDNGNYFTYTG 81
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 340 | |||
| d2zkda1 | 209 | E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musc | 99.91 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.58 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.55 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.54 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.5 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 99.48 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.45 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.39 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.39 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 99.29 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.22 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.21 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.12 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.12 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.11 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.08 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 99.03 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 98.8 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.7 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 98.62 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 98.6 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.59 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.55 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.55 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 98.08 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 98.03 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.82 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 97.52 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 92.07 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 87.86 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 86.78 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 85.36 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 83.33 |
| >d2zkda1 b.122.1.12 (A:405-613) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PUA domain-like superfamily: PUA domain-like family: SRA domain-like domain: E3 ubiquitin-protein ligase UHRF1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.91 E-value=6.1e-26 Score=196.26 Aligned_cols=81 Identities=49% Similarity=0.836 Sum_probs=76.2
Q ss_pred ccccccccccccCCCCCCCCCCCCCCcccCCCCcccceecchhhhhhhcccCCCcCCccCCCCCCcEEEEecCccccCCC
Q 019484 251 KANAASGKIFVTLPPDHFGPILAENDPERNQGVLVGESWEGRLECRQWGVHYPPVAGIAGQSKCGAQSVVLSGGYEDDED 330 (340)
Q Consensus 251 ~~na~sG~~~~~~~~~~~G~ip~~~d~~r~~g~~vG~~~~~r~~~~~~g~h~~~~~Gi~~~~~~ga~si~~sg~y~~d~d 330 (340)
.+.+.+++++.++|.+|||+|| ||+||++|++|++|+.+|+|+++++||+|+...||+|||+||||+||+|
T Consensus 2 ~~~~~~~~~~~~~p~~~~G~vp---------Gv~VGd~F~~R~el~~~GlH~~~~aGI~g~~~~GA~SIV~SGgYeDD~D 72 (209)
T d2zkda1 2 MACVGRTTECTIVPANHFGPIP---------GVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVD 72 (209)
T ss_dssp TTTCCCSCCCCSSCTTCCSCCT---------TCCTTCEESSHHHHHHTTSSCCSSCSEEEETTTEEEEEEECSCSTTCEE
T ss_pred cccccccceEEeCCCCcccCCC---------CCCCCCEECCHHHHHHcCCCCCccCcEeecCCCceEEEEECCCcccccc
Confidence 3455667778889999999999 9999999999999999999999999999999999999999999999999
Q ss_pred CCceEEEecC
Q 019484 331 HGEWFLYTGR 340 (340)
Q Consensus 331 ~g~~~~ytg~ 340 (340)
+||+|+|||+
T Consensus 73 ~gd~liYTG~ 82 (209)
T d2zkda1 73 NGNYFTYTGS 82 (209)
T ss_dssp CSSEEEEECS
T ss_pred CCcEEEEECC
Confidence 9999999996
|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|