Citrus Sinensis ID: 019486

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340
MAAQLLTPVCIDVLKLQNPSLNSFSSRSSSRLLANNSSSLSLMGHSSKRRSCGRARVTAEDSASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGSGSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYRNSEEEVKERSKRAAAAARRWREYSRRGADQPPTFKLPEATTSKEK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccHHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccc
cHHHHcccccHHHHccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHcHEEccccEEccHHHHHHHcccHEEEEcccccEEEEEEcccHHHHHHHHHHccccEEEEEcHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccc
MAAQLLTPVCIDVlklqnpslnsfssrsssrllannssslslmghsskrrscgrarvtaedsastdaiADDYYAVlgllpdatpEQIKKAYYNCMkachpdlsgddpettnFCMFINEVYAvlsdpvqrmvydeihgysliatnpflddscpkdhvfvdefscigckncnnvapeVFKIEEDFGRARVYNQCGINEFVQQAIEscpvdcihrTSAQQLSLLEDEMRRVERVNVAMMLSgmgsgsadVFRMASSRWERRQAKVLEQAKIRMMnrekdsdkTVSYWSniwgkpkdyrnseEEVKERSKRAAAAARRWREysrrgadqpptfklpeattskek
MAAQLLTPVCIDVLKLQNPSLNSFSSRSSSRLLANNssslslmghsskrrscgrarvtaedsastdaIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMlsgmgsgsaDVFRMASSRWERRQAKVLeqakirmmnrekdsdktvsywsniwgkpkdyrnseeevkERSKRAAAAARRWreysrrgadqpptfklpeattskek
MAAQLLTPVCIDVLKLQNPslnsfssrsssrllannssslslmghssKRRSCGRARVTAEDSASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGSGSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYrnseeevkerskraaaaarrwreysrrGADQPPTFKLPEATTSKEK
****LLTPVCIDVLKL**************************************************AIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMML*******************************************VSYWSNIWG***************************************************
******TPVCIDVLKLQNPS**********************************************AIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDP****************TNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLE*********************SADVFRMA********************************WSNIW****************************************************
MAAQLLTPVCIDVLKLQNPSL************ANNSSSLS*********************ASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGSGSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKD******************************DQPPTFKL*********
****LLTPVCIDVLKLQN********************************SCGRARVTAEDSASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGSGSADVFRMASSRWERRQAKVLEQAKIRMM***************************************************ADQPPTFKLP********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAQLLTPVCIDVLKLQNPSLNSFSSRSSSRLLANNSSSLSLMGHSSKRRSCGRARVTAEDSASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGMGSGSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYRNSEEEVKERSKRAAAAARRWREYSRRGADQPPTFKLPEATTSKEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query340 2.2.26 [Sep-21-2011]
P39101 391 Protein CAJ1 OS=Saccharom yes no 0.455 0.396 0.298 5e-11
Q3AF07 381 Chaperone protein DnaJ OS yes no 0.191 0.170 0.492 7e-11
Q8GYX8 398 Chaperone protein dnaJ 10 no no 0.264 0.226 0.395 6e-10
Q96EY1 480 DnaJ homolog subfamily A yes no 0.335 0.237 0.352 8e-10
Q67S53 386 Chaperone protein DnaJ OS yes no 0.191 0.168 0.461 2e-09
Q24331 529 Protein tumorous imaginal N/A no 0.191 0.122 0.461 2e-09
Q27237 520 Protein tumorous imaginal no no 0.2 0.130 0.441 3e-09
Q56237280 Chaperone protein DnaJ 2 yes no 0.194 0.235 0.477 3e-09
B8CXL0 375 Chaperone protein DnaJ OS yes no 0.232 0.210 0.4 7e-09
Q82BY4 378 Chaperone protein DnaJ 2 yes no 0.191 0.171 0.469 8e-09
>sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 77/174 (44%), Gaps = 19/174 (10%)

Query: 71  DYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRM 130
           +YY +LG+ P+ATP +IKKAY       HPD   DDP+       + E Y VLSDP  R 
Sbjct: 6   EYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRS 65

Query: 131 VYDEIHGYSLIATNPFLDDSCPKDHVF--------VDEFSCIGCKNCNNVAPEVFKIEED 182
            YD+      +    F D S     +F        + EFS    K  N  A E+F  E++
Sbjct: 66  KYDQFGKEDAVPQQGFEDASEYFTAIFGGDGFKDWIGEFSLF--KELNE-ATEMFGKEDE 122

Query: 183 FGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMM 236
            G A            ++A ES     +   + +  SL +D++ + +R  +  M
Sbjct: 123 EGTAATE--------TEKADESTDGGMVKHDTNKAESLKKDKLSKEQREKLMEM 168

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
>sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q8GYX8|DNJ10_ARATH Chaperone protein dnaJ 10 OS=Arabidopsis thaliana GN=ATJ10 PE=2 SV=2 Back     alignment and function description
>sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 Back     alignment and function description
>sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q24331|TID_DROVI Protein tumorous imaginal discs, mitochondrial OS=Drosophila virilis GN=l(2)tid PE=2 SV=1 Back     alignment and function description
>sp|Q27237|TID_DROME Protein tumorous imaginal discs, mitochondrial OS=Drosophila melanogaster GN=l(2)tid PE=1 SV=2 Back     alignment and function description
>sp|Q56237|DNAJ2_THET8 Chaperone protein DnaJ 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ2 PE=3 SV=2 Back     alignment and function description
>sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q82BY4|DNAJ2_STRAW Chaperone protein DnaJ 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query340
356542195339 PREDICTED: uncharacterized protein LOC10 0.988 0.991 0.75 1e-140
363806974339 uncharacterized protein LOC100809007 [Gl 0.985 0.988 0.743 1e-139
388517387335 unknown [Lotus japonicus] 0.979 0.994 0.764 1e-139
225446674331 PREDICTED: uncharacterized protein LOC10 0.967 0.993 0.745 1e-139
357452867338 Chaperone protein dnaJ [Medicago truncat 0.988 0.994 0.749 1e-138
255578687334 expressed protein, putative [Ricinus com 0.973 0.991 0.747 1e-134
356543106332 PREDICTED: uncharacterized protein LOC10 0.967 0.990 0.725 1e-134
356517314332 PREDICTED: uncharacterized protein LOC10 0.964 0.987 0.729 1e-132
224128772335 predicted protein [Populus trichocarpa] 0.979 0.994 0.737 1e-131
297824243344 DNAJ heat shock N-terminal domain-contai 0.976 0.965 0.709 1e-130
>gi|356542195|ref|XP_003539555.1| PREDICTED: uncharacterized protein LOC100786494 [Glycine max] Back     alignment and taxonomy information
 Score =  505 bits (1300), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 255/340 (75%), Positives = 290/340 (85%), Gaps = 4/340 (1%)

Query: 3   AQLLTPVCIDVLKLQNPSLNSFSSRSSSRLLANNSSSLSLMGHSS-KRRSCGRARVTAED 61
           AQLL+PVC++ LK+ NPSLN   SRSS R+L   +S  + + HS  KRR CGR RVTAED
Sbjct: 2   AQLLSPVCMEALKIHNPSLN-LCSRSSWRMLVKGASPCTFVTHSGWKRRGCGRVRVTAED 60

Query: 62  SAS-TDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVY 120
           S S ++ IADDYY VLGLLPDATPEQIKKAYYNCMK+CHPDLSG+DPETTNFC+FINEVY
Sbjct: 61  SVSPSETIADDYYEVLGLLPDATPEQIKKAYYNCMKSCHPDLSGNDPETTNFCIFINEVY 120

Query: 121 AVLSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEVFKIE 180
            VLSDPVQR +YDEIHGYSL + NPFLDDS P+DH FVDEFSCIGCKNC NVAP VF IE
Sbjct: 121 TVLSDPVQRRIYDEIHGYSLTSINPFLDDSSPRDHAFVDEFSCIGCKNCANVAPGVFAIE 180

Query: 181 EDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMMLSGM 240
           EDFGRAR YNQ G  E VQQAI+SCPV CIH TSA QLSLLEDEMRRVERVNVA+MLSGM
Sbjct: 181 EDFGRARAYNQSGNPELVQQAIDSCPVSCIHWTSAAQLSLLEDEMRRVERVNVALMLSGM 240

Query: 241 GSGSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYRNSEEE 300
           G+ S DVFRMASSRWE+RQ+KVL +AK+RMM RE+ +DK  SYW N+WGK KDY++S+EE
Sbjct: 241 GTASIDVFRMASSRWEKRQSKVLAKAKLRMM-REEGADKKNSYWDNLWGKQKDYQSSDEE 299

Query: 301 VKERSKRAAAAARRWREYSRRGADQPPTFKLPEATTSKEK 340
           V+ER+KRAA+AARRWREYSRRG D+PPTFKLPEA+  K+K
Sbjct: 300 VEERAKRAASAARRWREYSRRGVDKPPTFKLPEASLGKDK 339

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|363806974|ref|NP_001242058.1| uncharacterized protein LOC100809007 [Glycine max] gi|255635510|gb|ACU18106.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388517387|gb|AFK46755.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225446674|ref|XP_002281976.1| PREDICTED: uncharacterized protein LOC100260760 [Vitis vinifera] gi|302143456|emb|CBI22017.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357452867|ref|XP_003596710.1| Chaperone protein dnaJ [Medicago truncatula] gi|217073254|gb|ACJ84986.1| unknown [Medicago truncatula] gi|355485758|gb|AES66961.1| Chaperone protein dnaJ [Medicago truncatula] Back     alignment and taxonomy information
>gi|255578687|ref|XP_002530203.1| expressed protein, putative [Ricinus communis] gi|223530279|gb|EEF32177.1| expressed protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356543106|ref|XP_003540004.1| PREDICTED: uncharacterized protein LOC100812547 [Glycine max] Back     alignment and taxonomy information
>gi|356517314|ref|XP_003527333.1| PREDICTED: uncharacterized protein LOC100799778 [Glycine max] Back     alignment and taxonomy information
>gi|224128772|ref|XP_002320418.1| predicted protein [Populus trichocarpa] gi|222861191|gb|EEE98733.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297824243|ref|XP_002880004.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325843|gb|EFH56263.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query340
TAIR|locus:2052426344 AT2G42750 [Arabidopsis thalian 0.979 0.968 0.614 7.8e-110
TAIR|locus:2166968 465 AT5G23240 [Arabidopsis thalian 0.673 0.492 0.330 2.7e-26
UNIPROTKB|Q55980133 sll0662 "Ferredoxin (Bacterial 0.220 0.563 0.506 2.9e-16
TAIR|locus:5019474746244 AT3G05345 "AT3G05345" [Arabido 0.423 0.590 0.296 1.7e-10
TIGR_CMR|CHY_0416 381 CHY_0416 "chaperone protein dn 0.214 0.191 0.459 4e-10
TAIR|locus:2030101 398 AT1G76700 [Arabidopsis thalian 0.561 0.479 0.293 3.9e-09
UNIPROTKB|F1NNE0393 DNAJA3 "Uncharacterized protei 0.238 0.206 0.451 6.6e-09
UNIPROTKB|E9PSW5429 Dnaja3 "Protein Dnaja3" [Rattu 0.223 0.177 0.434 1.3e-08
SGD|S000000850 391 CAJ1 "Nuclear type II J heat s 0.332 0.289 0.354 1.5e-08
UNIPROTKB|G3V9U3453 Dnaja3 "Protein Dnaja3" [Rattu 0.223 0.167 0.434 1.5e-08
TAIR|locus:2052426 AT2G42750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1085 (387.0 bits), Expect = 7.8e-110, P = 7.8e-110
 Identities = 209/340 (61%), Positives = 243/340 (71%)

Query:     3 AQLLTPVCIDVLKLQNPXXXXXXXXXXXXXXXXXXXXXXXXX--XXXKRR--SCGRARVT 58
             AQ+L+PVC D+LK QN                               KRR  S GR RV 
Sbjct:     2 AQILSPVCTDLLKFQNSALSSRSGASPRFSAKTTGASSSWYLPRYAGKRRTDSIGRLRVA 61

Query:    59 AED--SASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFI 116
              ED  S ST  +ADDYYAVLGLLPDAT E+IKKAYYNCMK+CHPDLSG+DPETTNFCMFI
Sbjct:    62 TEDASSLSTGDVADDYYAVLGLLPDATQEEIKKAYYNCMKSCHPDLSGNDPETTNFCMFI 121

Query:   117 NEVYAVLSDPVQRMVYDEIHGYSLIATNPFLDDSCPKDHVFVDEFSCIGCKNCNNVAPEV 176
             N++Y +LSDPVQRMVYDEIHGY++ A NPFLDDS P+DHVFVDEF+CIGCKNC NVAP++
Sbjct:   122 NDIYEILSDPVQRMVYDEIHGYTVTAINPFLDDSTPRDHVFVDEFACIGCKNCANVAPDI 181

Query:   177 FKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIHRTSAQQLSLLEDEMRRVERVNVAMM 236
             F+IEEDFGRAR  NQ G  + VQQA+E+CPVDCIH+TSA QLSLLEDEMRRVERVNVA+M
Sbjct:   182 FQIEEDFGRARACNQRGNPDLVQQAVETCPVDCIHQTSAAQLSLLEDEMRRVERVNVALM 241

Query:   237 LSGMGSGSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGKPKDYXX 296
             LSGMGSG+ DVFRMA SRWE+RQAKVL QA+ RMM R K++D+T SYW N+WGK  +Y  
Sbjct:   242 LSGMGSGAVDVFRMARSRWEKRQAKVLNQARSRMMKR-KNTDETPSYWDNLWGKQNEYQK 300

Query:   297 XXXXXXXXXXXXXXXXXXXXXXXXXGADQPPTFKLPEATT 336
                                      G D+ PTFKLP++ +
Sbjct:   301 SEEEVQERAQRAAAAARRWREYSRRGVDKRPTFKLPDSAS 340
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
TAIR|locus:2166968 AT5G23240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q55980 sll0662 "Ferredoxin (Bacterial type ferredoxin family)" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
TAIR|locus:5019474746 AT3G05345 "AT3G05345" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0416 CHY_0416 "chaperone protein dnaJ" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TAIR|locus:2030101 AT1G76700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNE0 DNAJA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSW5 Dnaja3 "Protein Dnaja3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
SGD|S000000850 CAJ1 "Nuclear type II J heat shock protein of the E. coli dnaJ family" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9U3 Dnaja3 "Protein Dnaja3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
pfam0022663 pfam00226, DnaJ, DnaJ domain 3e-21
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-18
pfam1345960 pfam13459, Fer4_15, 4Fe-4S single cluster domain 5e-16
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 6e-15
pfam1337058 pfam13370, Fer4_13, 4Fe-4S single cluster domain 2e-14
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-12
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-12
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-11
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-11
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 2e-11
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 3e-11
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-11
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-11
COG114168 COG1141, Fer, Ferredoxin [Energy production and co 2e-10
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 4e-10
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 4e-10
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 6e-10
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 6e-10
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 7e-10
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 3e-09
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 4e-09
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 4e-09
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 8e-09
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 1e-08
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 1e-08
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 2e-08
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-08
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 6e-08
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 8e-08
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 4e-07
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 4e-07
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 9e-07
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-06
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 5e-06
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 6e-06
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-05
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-05
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 3e-05
pfam1318744 pfam13187, Fer4_9, 4Fe-4S dicluster domain 3e-05
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 4e-05
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 7e-04
COG114491 COG1144, COG1144, Pyruvate:ferredoxin oxidoreducta 0.003
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 85.7 bits (213), Expect = 3e-21
 Identities = 30/63 (47%), Positives = 37/63 (58%)

Query: 71  DYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRM 130
           DYY +LG+  DA+ E+IKKAY       HPD +  DP        INE Y VLSDP +R 
Sbjct: 1   DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60

Query: 131 VYD 133
           +YD
Sbjct: 61  IYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|222145 pfam13459, Fer4_15, 4Fe-4S single cluster domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|222081 pfam13370, Fer4_13, 4Fe-4S single cluster domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224064 COG1141, Fer, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|221966 pfam13187, Fer4_9, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224067 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 340
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.9
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.87
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.85
PRK14288369 chaperone protein DnaJ; Provisional 99.77
PRK14296372 chaperone protein DnaJ; Provisional 99.75
PRK14279 392 chaperone protein DnaJ; Provisional 99.75
PRK14286372 chaperone protein DnaJ; Provisional 99.73
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.73
PRK14282369 chaperone protein DnaJ; Provisional 99.71
PRK14287371 chaperone protein DnaJ; Provisional 99.71
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.71
PRK14285365 chaperone protein DnaJ; Provisional 99.71
PRK14277 386 chaperone protein DnaJ; Provisional 99.7
PRK14297 380 chaperone protein DnaJ; Provisional 99.7
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.7
PRK14294366 chaperone protein DnaJ; Provisional 99.7
PRK14301373 chaperone protein DnaJ; Provisional 99.69
PRK14299291 chaperone protein DnaJ; Provisional 99.69
PRK14276 380 chaperone protein DnaJ; Provisional 99.69
PRK14298 377 chaperone protein DnaJ; Provisional 99.69
PRK14283 378 chaperone protein DnaJ; Provisional 99.69
PRK14284 391 chaperone protein DnaJ; Provisional 99.69
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
PRK14295 389 chaperone protein DnaJ; Provisional 99.69
PRK14278 378 chaperone protein DnaJ; Provisional 99.68
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.68
PRK14291 382 chaperone protein DnaJ; Provisional 99.68
PRK10767371 chaperone protein DnaJ; Provisional 99.68
PRK14280 376 chaperone protein DnaJ; Provisional 99.68
PRK14281 397 chaperone protein DnaJ; Provisional 99.67
PRK14289 386 chaperone protein DnaJ; Provisional 99.65
PRK14290365 chaperone protein DnaJ; Provisional 99.64
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.63
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.63
PRK14292371 chaperone protein DnaJ; Provisional 99.63
PRK14300372 chaperone protein DnaJ; Provisional 99.63
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.62
PRK14293 374 chaperone protein DnaJ; Provisional 99.61
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.61
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.61
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.59
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.58
PHA03102153 Small T antigen; Reviewed 99.52
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.51
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.51
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.47
PRK05014171 hscB co-chaperone HscB; Provisional 99.42
PRK03578176 hscB co-chaperone HscB; Provisional 99.39
PRK01356166 hscB co-chaperone HscB; Provisional 99.38
PRK00294173 hscB co-chaperone HscB; Provisional 99.38
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.32
PRK06991270 ferredoxin; Provisional 99.31
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.31
PTZ00100116 DnaJ chaperone protein; Provisional 99.28
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.23
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.18
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.17
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.15
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.15
COG114168 Fer Ferredoxin [Energy production and conversion] 99.11
PHA02624 647 large T antigen; Provisional 99.11
PF1345965 Fer4_15: 4Fe-4S single cluster domain 99.04
PRK01773173 hscB co-chaperone HscB; Provisional 99.04
PF1337058 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 98.99
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.89
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.87
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.84
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.67
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit 98.42
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.2
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.16
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 97.81
PRK05035 695 electron transport complex protein RnfC; Provision 97.7
PF0690264 Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro: 97.35
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 97.19
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-o 97.17
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.14
PRK08348120 NADH-plastoquinone oxidoreductase subunit; Provisi 97.11
KOG3256212 consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 97.06
COG114668 Ferredoxin [Energy production and conversion] 97.05
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 96.87
PRK05113191 electron transport complex protein RnfB; Provision 96.84
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subuni 96.82
TIGR00403183 ndhI NADH-plastoquinone oxidoreductase subunit I p 96.72
CHL0006581 psaC photosystem I subunit VII 96.72
TIGR02060132 aprB adenosine phosphosulphate reductase, beta sub 96.53
COG1142165 HycB Fe-S-cluster-containing hydrogenase component 96.49
PRK09625133 porD pyruvate flavodoxin oxidoreductase subunit de 96.48
PLN0007181 photosystem I subunit VII; Provisional 96.46
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase s 96.43
PRK0265181 photosystem I subunit VII; Provisional 96.39
TIGR0293691 fdxN_nitrog ferredoxin III, nif-specific. Members 96.37
TIGR01944165 rnfB electron transport complex, RnfABCDGE type, B 96.34
TIGR02494295 PFLE_PFLC glycyl-radical enzyme activating protein 96.12
TIGR0217978 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta 96.11
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 96.07
TIGR02163255 napH_ ferredoxin-type protein, NapH/MauN family. M 96.02
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 96.0
PRK13984 604 putative oxidoreductase; Provisional 96.0
PRK07569234 bidirectional hydrogenase complex protein HoxU; Va 95.97
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. 95.97
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit del 95.95
PRK08222181 hydrogenase 4 subunit H; Validated 95.94
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.92
CHL00014167 ndhI NADH dehydrogenase subunit I 95.9
PRK05888164 NADH dehydrogenase subunit I; Provisional 95.89
PRK09898208 hypothetical protein; Provisional 95.89
PRK09477271 napH quinol dehydrogenase membrane component; Prov 95.88
PRK12387180 formate hydrogenlyase complex iron-sulfur subunit; 95.83
PF1324798 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX 95.82
TIGR01971122 NuoI NADH-quinone oxidoreductase, chain I. This mo 95.78
COG114599 NapF Ferredoxin [Energy production and conversion] 95.74
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.6
PRK08764135 ferredoxin; Provisional 95.53
PRK14028312 pyruvate ferredoxin oxidoreductase subunit gamma/d 95.48
COG0437203 HybA Fe-S-cluster-containing hydrogenase component 95.41
PRK06273165 ferredoxin; Provisional 95.36
TIGR00402101 napF ferredoxin-type protein NapF. The gene codes 95.31
TIGR01582283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 95.29
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 95.16
KOG0431453 consensus Auxilin-like protein and related protein 95.08
PRK10882328 hydrogenase 2 protein HybA; Provisional 95.08
TIGR02700234 flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T 95.03
PRK10194163 ferredoxin-type protein; Provisional 94.95
PRK10330181 formate dehydrogenase-H ferredoxin subunit; Provis 94.86
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 94.63
PRK00783263 DNA-directed RNA polymerase subunit D; Provisional 94.54
TIGR02512 374 Fe_only_hydrog hydrogenases, Fe-only. This model d 94.52
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 94.45
TIGR01660 492 narH nitrate reductase, beta subunit. The Nitrate 94.18
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 93.97
TIGR02745434 ccoG_rdxA_fixG cytochrome c oxidase accessory prot 93.8
PRK08166 847 NADH dehydrogenase subunit G; Validated 93.79
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 93.67
PTZ00305297 NADH:ubiquinone oxidoreductase; Provisional 93.61
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 93.6
PRK08493 819 NADH dehydrogenase subunit G; Validated 93.53
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 93.45
COG1149284 MinD superfamily P-loop ATPase containing an inser 93.21
cd07030259 RNAP_D D subunit of Archaeal RNA polymerase. The D 93.07
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 92.71
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 92.39
TIGR02951161 DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi 92.36
TIGR02912314 sulfite_red_C sulfite reductase, subunit C. Member 92.24
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 92.23
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 92.16
PRK09129 776 NADH dehydrogenase subunit G; Validated 92.05
PRK07118280 ferredoxin; Validated 92.02
PRK14993244 tetrathionate reductase subunit B; Provisional 92.01
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 m 91.78
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzy 91.76
PRK13795636 hypothetical protein; Provisional 91.71
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 91.69
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 91.39
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 91.34
PRK12771564 putative glutamate synthase (NADPH) small subunit; 91.29
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 91.29
PRK10194163 ferredoxin-type protein; Provisional 91.24
COG2768354 Uncharacterized Fe-S center protein [General funct 90.81
COG359274 Uncharacterized conserved protein [Function unknow 90.81
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. Thi 90.7
PRK09130 687 NADH dehydrogenase subunit G; Validated 90.7
PRK07860 797 NADH dehydrogenase subunit G; Validated 90.68
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 90.56
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzy 90.18
PRK07118280 ferredoxin; Validated 90.14
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 90.05
PRK09476254 napG quinol dehydrogenase periplasmic component; P 89.88
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 89.24
TIGR01660492 narH nitrate reductase, beta subunit. The Nitrate 89.14
PRK098531019 putative selenate reductase subunit YgfK; Provisio 88.52
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 88.23
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 88.13
PRK14993244 tetrathionate reductase subunit B; Provisional 87.94
cd01916 731 ACS_1 Acetyl-CoA synthase (ACS), also known as ace 87.54
TIGR01582283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 87.03
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 86.09
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 85.78
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 83.63
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 83.46
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 83.17
PRK09476254 napG quinol dehydrogenase periplasmic component; P 83.13
TIGR00273432 iron-sulfur cluster-binding protein. Members of th 83.01
PRK09326 341 F420H2 dehydrogenase subunit F; Provisional 81.8
TIGR00314 784 cdhA CO dehydrogenase/acetyl-CoA synthase complex, 80.87
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.90  E-value=2e-25  Score=206.50  Aligned_cols=239  Identities=29%  Similarity=0.354  Sum_probs=151.1

Q ss_pred             CCCCCCCCchhhcCCCCCCCHHHHHHHHHHHHHhcCCCCCCCChHHHHHHHHHHHHHHHhcChhhhhhhccccccccccc
Q 019486           64 STDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIHGYSLIAT  143 (340)
Q Consensus        64 ~~~~~~~d~Y~vLgv~~~as~~eIk~AYr~la~~~HPD~~~~~~~~~~~f~~i~~Ay~vLsdp~~R~~YD~~~~~~~~~l  143 (340)
                      +.+....|+|+||||+++|+.++||++||+|+++||||+++++|++.++|++||+||+||+||.+|..||+++++.....
T Consensus        25 ~~~~~~~~LYdVLgl~k~at~d~IKKaYR~L~~k~HPD~~gd~P~~~dkf~eIN~Ay~ILsD~~kR~~YD~~g~~~l~l~  104 (279)
T KOG0716|consen   25 SEDVIRLDLYDVLGLPKTATKDEIKKAYRKLALKYHPDKNGDNPEATDKFKEINTAYAILSDPTKRNVYDEYGELGLKLA  104 (279)
T ss_pred             ccccchhHHHHHhCCCcccchHHHHHHHHHHHHHhCCCcCCCCchhHHHHHHHHHHHHHhcChhhhhhHHHhhhHHHHHH
Confidence            34445789999999999999999999999999999999999999999999999999999999999999999999888888


Q ss_pred             CCCCCCCCCCCccccccccc-----------cC-CCCcccCCCCcccccccCCceEEccCCCCHHHHHHHHHcCCcccee
Q 019486          144 NPFLDDSCPKDHVFVDEFSC-----------IG-CKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIH  211 (340)
Q Consensus       144 dp~~~~~~p~~~vfvDe~~C-----------iG-Cg~C~~v~P~~F~iedd~G~a~vv~q~g~~E~v~eAv~~CPv~cI~  211 (340)
                      +.+.++..+...+|.+.+.|           .+ |-.|. .|..-+-..      +..-+.+.++.+++++..|      
T Consensus       105 e~fg~d~~~~~~v~~~~~~~~~~a~~dll~g~~~c~~c~-~cc~~~~~~------~~c~~~~~P~~~~~~~~~~------  171 (279)
T KOG0716|consen  105 EQFGEDSKIIYFVFSSPWIKATAACFDLLTGQRHCLCCR-ACCCCCCCN------RFCCGKAKPEVSEQHDYYC------  171 (279)
T ss_pred             HhhcccCcceEEEecchhhhHHhhhhhhhhcchhhhhHH-hHhhhhcch------HHHhhccCCccccchhhHH------
Confidence            88877766665555543333           22 22221 122222221      1111123334445555555      


Q ss_pred             cccccchhhhHHHHHHHhhhhhhhhc-cCCCCCchHHHHHHHHHHHHHHHHHHHHHHHHhhcccccCccccccccccCCC
Q 019486          212 RTSAQQLSLLEDEMRRVERVNVAMML-SGMGSGSADVFRMASSRWERRQAKVLEQAKIRMMNREKDSDKTVSYWSNIWGK  290 (340)
Q Consensus       212 ~~~~~~l~~Le~~~~~~~~~~~~~~~-~g~~~~~~~~~~~a~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  290 (340)
                        ....+..|++++..+.++.+.-.. .+......+.|--+-.-   +  +..-+.+..+.- +...++.-++|-    +
T Consensus       172 --~~s~i~~~~~l~~~~~~~~~~~~~ed~~i~~vs~~~~~v~~~---~--~~~~S~r~~~v~-~~v~~~p~~~~~----~  239 (279)
T KOG0716|consen  172 --HRSRIALLNFLQSNNKRVCLSHLLEDVFIDLVSNGAYDVGFS---E--RVLYSKREVIVG-QPVFDMPISLWI----K  239 (279)
T ss_pred             --hhchhhhhhhhhhccccccccccchhhhhhhhhhhhcccccc---c--ccccCccchhhC-ceeeccCccccc----c
Confidence              334445566666655555543221 00000001111000000   0  333333444443 344555556664    4


Q ss_pred             CCCCC-CcHHHHHHHHHHHHHHHHHHHHhhhcCCCCCCCccCCccccCC
Q 019486          291 PKDYR-NSEEEVKERSKRAAAAARRWREYSRRGADQPPTFKLPEATTSK  338 (340)
Q Consensus       291 ~~~~~-~~~~~~~~~a~~~a~~~r~~~~~~~~~~~~~~~~~~~~~~~~~  338 (340)
                      |.... ...+...||+...+..+|+|++           +|+|+.++.+
T Consensus       240 ~~~~~~~~~~~~~er~~~i~~~~~~~~~-----------~k~~D~~sr~  277 (279)
T KOG0716|consen  240 PHSFRTWSSGNATERTQLIAPLIRSYYY-----------TKLPDSFSRL  277 (279)
T ss_pred             ccCcccccccccccchhhcCCcccchhh-----------hcCCchhhhc
Confidence            43332 3456788999999999999998           8888877654

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG1141 Fer Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF13459 Fer4_15: 4Fe-4S single cluster domain Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PF06902 Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro: IPR010693 This entry represents bacterial ferredoxins such Ferredoxin-1, -2 and -soy from Streptomyces griseolus and Ferredoxin fas2 from Rhodococcus fascians, plus several bacterial hypothetical proteins that contain three highly conserved cysteine residues Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PLN00071 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PRK00783 DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>COG3592 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>TIGR00273 iron-sulfur cluster-binding protein Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 5e-09
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 5e-07
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 5e-07
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 3e-06
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 2e-05
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 3e-05
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 3e-05
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 4e-05
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 5e-05
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 7e-05
1fxr_A64 Crystal Structure Of The Ferredoxin I From Desulfov 7e-05
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-04
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 1e-04
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 4e-04
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 29/63 (46%), Positives = 39/63 (61%)
Query: 71  DYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRM 130
           DYY +LG+  +A+ ++IKKAYY   K  HPD + DDP+       + E Y VLSD V+R 
Sbjct: 8   DYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRK 67
Query: 131 VYD 133
            YD
Sbjct: 68  QYD 70
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1FXR|A Chain A, Crystal Structure Of The Ferredoxin I From Desulfovibrio Africanus At 2.3 Angstroms Resolution Length = 64 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query340
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 1e-27
1dax_A64 Ferredoxin I; electron transport, electron-transfe 1e-23
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 2e-22
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 1e-18
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 5e-15
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 9e-15
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-14
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-14
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 2e-14
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 3e-14
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 3e-14
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 4e-14
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 5e-14
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 1e-13
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 2e-13
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-13
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 3e-13
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 4e-13
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 6e-13
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 7e-13
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-12
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-12
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-12
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-12
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 3e-12
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-11
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-11
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 6e-11
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-10
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-10
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 7e-10
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-09
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 8e-09
2guz_A71 Mitochondrial import inner membrane translocase su 4e-08
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 6e-08
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 6e-08
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 6e-06
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Length = 59 Back     alignment and structure
 Score =  101 bits (254), Expect = 1e-27
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 156 VFVDEFSCIGCKNCNNVAPEVFKIEEDFGRARVYNQCGINEFVQQAIESCPVDCIH 211
           + +D   CIGC++C  + PEVF + +   +A V       E  Q AI++CPV+ I 
Sbjct: 2   IVIDHEECIGCESCVELCPEVFAMIDGEEKAMVTAPDSTAECAQDAIDACPVEAIS 57
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Length = 64 Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Length = 58 Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Length = 60 Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Length = 66 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Length = 81 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.82
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.8
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.8
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.8
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.8
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.79
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.78
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.78
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.78
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.78
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.77
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.77
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.76
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.76
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.75
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.75
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.71
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.7
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.69
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.67
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.67
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.64
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.64
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.62
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.62
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.62
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.61
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.6
2guz_A71 Mitochondrial import inner membrane translocase su 99.58
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.55
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.54
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.52
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.48
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.86
2guz_B65 Mitochondrial import inner membrane translocase su 98.84
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 98.49
1dax_A64 Ferredoxin I; electron transport, electron-transfe 98.31
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 98.25
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 98.15
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 98.12
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 98.07
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 97.53
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 97.52
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 97.42
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 97.34
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 97.18
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; 96.99
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 96.92
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 96.75
1h98_A78 Ferredoxin; electron transport, thermophilic, iron 96.71
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 96.67
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.63
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.6
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 96.28
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 96.11
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 96.05
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg 95.89
1kqf_B294 FDH-N beta S, formate dehydrogenase, nitrate-induc 95.72
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 95.42
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 95.18
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 95.01
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 94.86
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 94.14
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 93.9
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 93.79
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 93.02
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 92.22
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 92.13
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 90.5
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 89.31
1kqf_B294 FDH-N beta S, formate dehydrogenase, nitrate-induc 87.89
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 87.87
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 86.85
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 81.97
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.82  E-value=1.9e-20  Score=144.20  Aligned_cols=71  Identities=41%  Similarity=0.677  Sum_probs=66.5

Q ss_pred             CCCCCCchhhcCCCCCCCHHHHHHHHHHHHHhcCCCCCCCChHHHHHHHHHHHHHHHhcChhhhhhhcccc
Q 019486           66 DAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIH  136 (340)
Q Consensus        66 ~~~~~d~Y~vLgv~~~as~~eIk~AYr~la~~~HPD~~~~~~~~~~~f~~i~~Ay~vLsdp~~R~~YD~~~  136 (340)
                      .....|||+||||+++++.++||++||+|++++|||++++++.+.+.|+.|++||+||+||.+|..||.++
T Consensus         3 ~~~~~~~y~iLgv~~~a~~~~Ik~ayr~l~~~~HPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~g   73 (79)
T 2dn9_A            3 SGSSGDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYG   73 (79)
T ss_dssp             SSCCSCHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCSSCTTHHHHHHHHHHHHHHHHSHHHHHHHHHSC
T ss_pred             CCCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHhcc
Confidence            34567999999999999999999999999999999999877788999999999999999999999999875
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 340
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 8e-15
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 1e-14
d1fxda_58 d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [T 4e-14
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-13
d1fxra_64 d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacte 2e-12
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 4e-12
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 5e-12
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 6e-12
d1iqza_81 d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyt 2e-10
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 7e-10
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-08
d1sj1a_66 d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus 6e-08
d1vjwa_59 d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [T 1e-07
d1hfel285 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subun 0.001
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 67.0 bits (163), Expect = 8e-15
 Identities = 18/79 (22%), Positives = 32/79 (40%), Gaps = 6/79 (7%)

Query: 62  SASTDAIADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDD------PETTNFCMF 115
            A    +  D+Y++LG  P A    +K+ Y   +   HPD    D       E     + 
Sbjct: 8   MALEQTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIE 67

Query: 116 INEVYAVLSDPVQRMVYDE 134
           I++ + +L +   +  YD 
Sbjct: 68  IDQAWKILGNEETKKKYDL 86
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Length = 58 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Length = 64 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Length = 81 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Length = 66 Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Length = 59 Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query340
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.86
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.78
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.75
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.67
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.65
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.59
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.56
d1fxra_64 Ferredoxin I {Sulfate-reducing bacteria (Desulfovi 99.28
d1iqza_81 Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 98.99
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 98.95
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 98.93
d1sj1a_66 Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI 98.88
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 97.61
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 97.42
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 97.4
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 97.39
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 97.39
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 97.36
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 97.2
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 97.19
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 97.12
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 97.1
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 97.08
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 96.78
d1jnrb_149 Adenylylsulfate reductase B subunit {Archaeon Arch 96.65
d2fug34151 NADH-quinone oxidoreductase chain 3, Nqo3, domain 96.18
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 96.13
d1kqfb1244 Formate dehydrogenase N, iron-sulfur (beta) subuni 96.11
d1vlfn2195 Transhydroxylase beta subunit, BthL, N-terminal do 95.66
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 94.78
d1y5ib1 509 Respiratory nitrate reductase 1 beta chain {Escher 92.79
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 90.51
d1h0hb_214 Tungsten containing formate dehydrogenase, small s 89.96
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 86.79
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 85.29
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 84.49
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 83.59
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 83.26
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 83.11
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.86  E-value=3.5e-22  Score=151.32  Aligned_cols=69  Identities=35%  Similarity=0.537  Sum_probs=65.3

Q ss_pred             CCCchhhcCCCCCCCHHHHHHHHHHHHHhcCCCCCCCChHHHHHHHHHHHHHHHhcChhhhhhhccccc
Q 019486           69 ADDYYAVLGLLPDATPEQIKKAYYNCMKACHPDLSGDDPETTNFCMFINEVYAVLSDPVQRMVYDEIHG  137 (340)
Q Consensus        69 ~~d~Y~vLgv~~~as~~eIk~AYr~la~~~HPD~~~~~~~~~~~f~~i~~Ay~vLsdp~~R~~YD~~~~  137 (340)
                      ..|||+||||+++||.++||+|||++++++|||++++++..++.|..|++||+||+||.+|..||.+|.
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~   70 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGH   70 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTT
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCc
Confidence            469999999999999999999999999999999998878888999999999999999999999999753
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure