Citrus Sinensis ID: 019517
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 340 | ||||||
| 255581321 | 368 | mutt domain protein, putative [Ricinus c | 0.985 | 0.910 | 0.641 | 1e-130 | |
| 357476761 | 357 | Nudix hydrolase [Medicago truncatula] gi | 0.979 | 0.932 | 0.627 | 1e-128 | |
| 224138688 | 372 | predicted protein [Populus trichocarpa] | 0.988 | 0.903 | 0.639 | 1e-127 | |
| 359806679 | 367 | uncharacterized protein LOC100815507 [Gl | 0.982 | 0.910 | 0.628 | 1e-125 | |
| 356540550 | 363 | PREDICTED: nudix hydrolase 8-like [Glyci | 0.970 | 0.909 | 0.611 | 1e-120 | |
| 356513760 | 298 | PREDICTED: nudix hydrolase 8-like [Glyci | 0.85 | 0.969 | 0.693 | 1e-119 | |
| 224074201 | 267 | predicted protein [Populus trichocarpa] | 0.785 | 1.0 | 0.752 | 1e-116 | |
| 449458978 | 355 | PREDICTED: nudix hydrolase 8-like [Cucum | 0.911 | 0.873 | 0.616 | 1e-115 | |
| 18422772 | 369 | nudix hydrolase 8 [Arabidopsis thaliana] | 0.802 | 0.739 | 0.7 | 1e-112 | |
| 21593371 | 371 | mutT domain protein-like [Arabidopsis th | 0.802 | 0.735 | 0.7 | 1e-112 |
| >gi|255581321|ref|XP_002531471.1| mutt domain protein, putative [Ricinus communis] gi|223528925|gb|EEF30921.1| mutt domain protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 471 bits (1213), Expect = e-130, Method: Compositional matrix adjust.
Identities = 236/368 (64%), Positives = 272/368 (73%), Gaps = 33/368 (8%)
Query: 6 MELKLLGSKSVSASSIFQNGGTTSS---SFRHGVSIRFSPQ-LCSCRGVFPRVS-----E 56
MELK L SKSVS+S I T SS S RH +R SP+ + SCRGVF +VS
Sbjct: 1 MELKFLDSKSVSSSEIALMATTRSSPCPSLRHVGGVRLSPEFIWSCRGVFLKVSCSSSSN 60
Query: 57 NSYLCK------------------------IGSSIFSRNLRVLDFFDDEYDGVVVDPKRL 92
+YL K S++FS N ++LD FDDEY GVVVD RL
Sbjct: 61 GTYLSKKHISAGQENIVAENYLYRTNGTNGANSTLFSGNAKILDAFDDEYGGVVVDSNRL 120
Query: 93 PSDPDAFASILRFSLIHWRRMNKKGIWLKLPLENAELVPIAVKEGFKYHHAEPEYLMLTY 152
P + D FAS L SL HW+ KKGIWLKLPLE +ELVPIAVKEGF+YHHAEP Y+MLTY
Sbjct: 121 PKNSDDFASSLHLSLSHWKITGKKGIWLKLPLERSELVPIAVKEGFQYHHAEPGYVMLTY 180
Query: 153 WIPDGPCVLPGNATHQVGVGGFVINDNNEVLVVQEKYCNPAFAGLWKLPTGFIDESEEIF 212
W+P+GPC+LP NATHQVGVGGFVIND NEVLVVQE +C P+F GLWK+PTGFI ESEEI+
Sbjct: 181 WLPEGPCMLPANATHQVGVGGFVINDKNEVLVVQETFCAPSFLGLWKIPTGFIHESEEIY 240
Query: 213 KGAVREVKEETGVDTEFVEVIAFRHAHNVAFQKSDLFFICMLKPLSTEIKVDDLEIKGAK 272
GA+REVKEETG+DTEF+EV+AFRHAHN+AF KSDLFF+CMLKPLST+I VDDLEI+ AK
Sbjct: 241 TGAMREVKEETGIDTEFLEVVAFRHAHNLAFDKSDLFFVCMLKPLSTQIIVDDLEIQAAK 300
Query: 273 WMPFMEFVKQPLIQGDCMFKKVIDICIARLRKRYCGLYPHQLVSAFDGQTSSLYYNDSDT 332
WMP +EFVKQPLIQGD MFKK+IDICIARL KRYCGL H+LVS FDG+ S LYYN D
Sbjct: 301 WMPLVEFVKQPLIQGDSMFKKIIDICIARLGKRYCGLSAHKLVSKFDGRLSCLYYNVVDN 360
Query: 333 QDTNCIGN 340
++ NC N
Sbjct: 361 ENINCTVN 368
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357476761|ref|XP_003608666.1| Nudix hydrolase [Medicago truncatula] gi|355509721|gb|AES90863.1| Nudix hydrolase [Medicago truncatula] gi|388508944|gb|AFK42538.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224138688|ref|XP_002326665.1| predicted protein [Populus trichocarpa] gi|222833987|gb|EEE72464.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359806679|ref|NP_001241031.1| uncharacterized protein LOC100815507 [Glycine max] gi|255639984|gb|ACU20284.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356540550|ref|XP_003538751.1| PREDICTED: nudix hydrolase 8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356513760|ref|XP_003525578.1| PREDICTED: nudix hydrolase 8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224074201|ref|XP_002304298.1| predicted protein [Populus trichocarpa] gi|222841730|gb|EEE79277.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449458978|ref|XP_004147223.1| PREDICTED: nudix hydrolase 8-like [Cucumis sativus] gi|449514676|ref|XP_004164447.1| PREDICTED: nudix hydrolase 8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|18422772|ref|NP_568680.1| nudix hydrolase 8 [Arabidopsis thaliana] gi|68565908|sp|Q8L7W2.2|NUDT8_ARATH RecName: Full=Nudix hydrolase 8; Short=AtNUDT8 gi|332008107|gb|AED95490.1| nudix hydrolase 8 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21593371|gb|AAM65320.1| mutT domain protein-like [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 340 | ||||||
| TAIR|locus:2171544 | 369 | NUDT8 "nudix hydrolase homolog | 0.802 | 0.739 | 0.7 | 4.1e-104 | |
| TAIR|locus:2168993 | 278 | NUDT2 "nudix hydrolase homolog | 0.764 | 0.935 | 0.505 | 4.5e-66 | |
| TAIR|locus:2058364 | 302 | NUDT5 "nudix hydrolase homolog | 0.723 | 0.814 | 0.472 | 9.6e-57 | |
| TAIR|locus:2058334 | 283 | NUDT6 "nudix hydrolase homolog | 0.720 | 0.865 | 0.476 | 2.4e-53 | |
| DICTYBASE|DDB_G0281219 | 376 | DDB_G0281219 "Nucleoside dipho | 0.744 | 0.672 | 0.383 | 7.1e-45 | |
| FB|FBgn0030668 | 330 | CG8128 [Drosophila melanogaste | 0.6 | 0.618 | 0.367 | 4e-35 | |
| UNIPROTKB|F1NLN3 | 297 | F1NLN3 "Uncharacterized protei | 0.594 | 0.680 | 0.382 | 4.7e-32 | |
| UNIPROTKB|F1RQN4 | 314 | NUDT6 "Uncharacterized protein | 0.585 | 0.633 | 0.388 | 4.7e-32 | |
| UNIPROTKB|E2RC30 | 316 | NUDT6 "Uncharacterized protein | 0.585 | 0.629 | 0.377 | 9.8e-32 | |
| UNIPROTKB|A7YY29 | 257 | NUDT6 "NUDT6 protein" [Bos tau | 0.497 | 0.657 | 0.411 | 2.6e-31 |
| TAIR|locus:2171544 NUDT8 "nudix hydrolase homolog 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1031 (368.0 bits), Expect = 4.1e-104, P = 4.1e-104
Identities = 196/280 (70%), Positives = 230/280 (82%)
Query: 63 IGSSIFSRNLRVLDFFDDEYDGVVVDPKRLPSDPDAFASILRFSLIHWRRMNKKGIWLKL 122
+ S++ R+L LD +DDEY GV+VD +LPS+P AFAS+LR SL WRR KKG+WLKL
Sbjct: 86 MSSAVKERSL--LDAYDDEYGGVIVDHGKLPSNPYAFASMLRASLSDWRRKGKKGVWLKL 143
Query: 123 PLENAELVPIAVKEGFKYHHAEPEYLMLTYWIPDG-PCVLPGNATHQVGVGGFVINDNNE 181
P+E +ELVPIA+KEGF+YHHAE Y+MLTYWIP+ P +LP NA+HQVGVGGFV+N + E
Sbjct: 144 PVEQSELVPIAIKEGFEYHHAEKGYVMLTYWIPEEEPSMLPANASHQVGVGGFVLNQHKE 203
Query: 182 VLVVQEKYCNPAFAGLWKLPTGFIDESEEIFKGAVREVKEETGVDTEFVEVIAFRHAHNV 241
VLVVQEKYC P+ GLWKLPTGFI+ESEEIF GAVREVKEETGVDTEF EVIAFRHAHNV
Sbjct: 204 VLVVQEKYCAPSITGLWKLPTGFINESEEIFSGAVREVKEETGVDTEFSEVIAFRHAHNV 263
Query: 242 AFQKSDLFFICMLKPLSTEIKVDDLEIKGAKWMPFMEFVKQPLIQGDCMFKKVIDICIAR 301
AF+KSDLFFICML+PLS +I +D LEIK AKWMP EFV+QP+I+GD MFK+VI+IC AR
Sbjct: 264 AFEKSDLFFICMLRPLSDKIIIDALEIKAAKWMPLAEFVEQPMIRGDKMFKRVIEICEAR 323
Query: 302 LRKRYCGLYPHQLVSAFDGQTSSLYYN----DSDTQDTNC 337
L RYCGL PH+LVS FDG+ SSLYYN D D +NC
Sbjct: 324 LSHRYCGLSPHRLVSTFDGKPSSLYYNVVDDDHDPSHSNC 363
|
|
| TAIR|locus:2168993 NUDT2 "nudix hydrolase homolog 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058364 NUDT5 "nudix hydrolase homolog 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058334 NUDT6 "nudix hydrolase homolog 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281219 DDB_G0281219 "Nucleoside diphosphate-linked moiety X motif 6" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030668 CG8128 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLN3 F1NLN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQN4 NUDT6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RC30 NUDT6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7YY29 NUDT6 "NUDT6 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00009534001 | SubName- Full=Chromosome undetermined scaffold_237, whole genome shotgun sequence; (269 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 340 | |||
| cd04670 | 127 | cd04670, Nudix_Hydrolase_12, Members of the Nudix | 2e-67 | |
| pfam00293 | 133 | pfam00293, NUDIX, NUDIX domain | 4e-22 | |
| cd02883 | 123 | cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup | 8e-17 | |
| COG1051 | 145 | COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl | 5e-14 | |
| cd04676 | 129 | cd04676, Nudix_Hydrolase_17, Members of the Nudix | 2e-12 | |
| cd04672 | 123 | cd04672, Nudix_Hydrolase_14, Members of the Nudix | 4e-12 | |
| cd04680 | 120 | cd04680, Nudix_Hydrolase_21, Members of the Nudix | 5e-12 | |
| cd04673 | 122 | cd04673, Nudix_Hydrolase_15, Members of the Nudix | 6e-12 | |
| cd04681 | 130 | cd04681, Nudix_Hydrolase_22, Members of the Nudix | 5e-11 | |
| cd04699 | 129 | cd04699, Nudix_Hydrolase_39, Members of the Nudix | 5e-11 | |
| cd04671 | 123 | cd04671, Nudix_Hydrolase_13, Members of the Nudix | 2e-10 | |
| cd03673 | 131 | cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate | 3e-10 | |
| cd04678 | 129 | cd04678, Nudix_Hydrolase_19, Members of the Nudix | 9e-10 | |
| cd03671 | 147 | cd03671, Ap4A_hydrolase_plant_like, Diadenosine te | 2e-09 | |
| cd04677 | 132 | cd04677, Nudix_Hydrolase_18, Members of the Nudix | 2e-08 | |
| cd03428 | 130 | cd03428, Ap4A_hydrolase_human_like, Diadenosine te | 4e-08 | |
| cd04700 | 142 | cd04700, DR1025_like, DR1025 from Deinococcus radi | 8e-08 | |
| cd04684 | 128 | cd04684, Nudix_Hydrolase_25, Contains a crystal st | 1e-07 | |
| cd03425 | 124 | cd03425, MutT_pyrophosphohydrolase, The MutT pyrop | 3e-07 | |
| cd04679 | 125 | cd04679, Nudix_Hydrolase_20, Members of the Nudix | 9e-07 | |
| cd04664 | 129 | cd04664, Nudix_Hydrolase_7, Members of the Nudix h | 6e-06 | |
| COG0494 | 161 | COG0494, MutT, NTP pyrophosphohydrolases including | 9e-06 | |
| PRK00714 | 156 | PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi | 1e-05 | |
| cd04511 | 130 | cd04511, Nudix_Hydrolase_4, Members of the Nudix h | 3e-05 | |
| PRK05379 | 340 | PRK05379, PRK05379, bifunctional nicotinamide mono | 3e-05 | |
| cd03429 | 131 | cd03429, NADH_pyrophosphatase, NADH pyrophosphatas | 3e-05 | |
| cd04686 | 131 | cd04686, Nudix_Hydrolase_27, Members of the Nudix | 3e-05 | |
| cd03424 | 137 | cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase | 4e-05 | |
| cd03675 | 134 | cd03675, Nudix_Hydrolase_2, Contains a crystal str | 4e-05 | |
| cd03427 | 137 | cd03427, MTH1, MutT homolog-1 (MTH1) is a member o | 5e-05 | |
| cd04683 | 120 | cd04683, Nudix_Hydrolase_24, Members of the Nudix | 6e-05 | |
| cd04674 | 118 | cd04674, Nudix_Hydrolase_16, Members of the Nudix | 6e-05 | |
| cd04696 | 125 | cd04696, Nudix_Hydrolase_37, Members of the Nudix | 1e-04 | |
| COG2816 | 279 | COG2816, NPY1, NTP pyrophosphohydrolases containin | 1e-04 | |
| cd03674 | 138 | cd03674, Nudix_Hydrolase_1, Members of the Nudix h | 2e-04 | |
| PRK09438 | 148 | PRK09438, nudB, dihydroneopterin triphosphate pyro | 3e-04 | |
| cd04682 | 122 | cd04682, Nudix_Hydrolase_23, Members of the Nudix | 4e-04 | |
| cd04669 | 121 | cd04669, Nudix_Hydrolase_11, Members of the Nudix | 4e-04 | |
| cd03672 | 145 | cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), t | 7e-04 | |
| TIGR00586 | 128 | TIGR00586, mutt, mutator mutT protein | 0.001 | |
| cd04694 | 143 | cd04694, Nudix_Hydrolase_35, Members of the Nudix | 0.001 | |
| cd04687 | 128 | cd04687, Nudix_Hydrolase_28, Members of the Nudix | 0.001 |
| >gnl|CDD|240027 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
Score = 207 bits (528), Expect = 2e-67
Identities = 76/132 (57%), Positives = 92/132 (69%), Gaps = 5/132 (3%)
Query: 167 HQVGVGGFVINDNNEVLVVQEKYCNPAFAGLWKLPTGFIDESEEIFKGAVREVKEETGVD 226
H VGVGG V+N+ NEVLVVQE+ P WKLP G +D E+IF GAVREV EETG+D
Sbjct: 1 HTVGVGGLVLNEKNEVLVVQERNKTP---NGWKLPGGLVDPGEDIFDGAVREVLEETGID 57
Query: 227 TEFVEVIAFRHAHNVAFQKSDLFFICMLKPLSTEIKVDDLEIKGAKWMPFMEFVKQPLIQ 286
TEFV V+ FRHAH AF KSDL+FIC LKPLS +I D EI AKWMP E++ QP+
Sbjct: 58 TEFVSVVGFRHAHPGAFGKSDLYFICRLKPLSFDINFDTSEIAAAKWMPLEEYISQPITS 117
Query: 287 GDCMFKKVIDIC 298
+ + ++DIC
Sbjct: 118 E--VNRLILDIC 127
|
Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required. Length = 127 |
| >gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain | Back alignment and domain information |
|---|
| >gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240029 cd04672, Nudix_Hydrolase_14, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240036 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240037 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240054 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240028 cd04671, Nudix_Hydrolase_13, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240034 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240033 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240055 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >gnl|CDD|240040 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|239517 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >gnl|CDD|240035 cd04679, Nudix_Hydrolase_20, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240022 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239948 cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|235436 PRK05379, PRK05379, bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239521 cd03429, NADH_pyrophosphatase, NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >gnl|CDD|240042 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >gnl|CDD|239647 cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240039 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240031 cd04674, Nudix_Hydrolase_16, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240052 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|225373 COG2816, NPY1, NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|239646 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|236516 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240038 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240026 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|239644 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >gnl|CDD|200031 TIGR00586, mutt, mutator mutT protein | Back alignment and domain information |
|---|
| >gnl|CDD|240050 cd04694, Nudix_Hydrolase_35, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >gnl|CDD|240043 cd04687, Nudix_Hydrolase_28, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| KOG0648 | 295 | consensus Predicted NUDIX hydrolase FGF-2 and rela | 100.0 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.88 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.83 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.82 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.82 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.81 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.8 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.8 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.8 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.8 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.8 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.8 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.8 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.79 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.79 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.79 | |
| PLN02325 | 144 | nudix hydrolase | 99.78 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.78 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.78 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.78 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.78 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.78 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.78 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.78 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.78 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.78 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.78 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.77 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.77 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.77 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.77 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.77 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.77 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.76 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.75 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.75 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.75 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.75 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.75 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 99.75 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.74 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.74 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.74 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.74 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.73 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.73 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.73 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.73 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.73 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.73 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.72 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.71 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.71 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.7 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.7 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.69 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.69 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.69 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 99.69 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.69 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.69 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 99.67 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.67 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 99.66 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.66 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.65 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.65 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.64 | |
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 99.62 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 99.6 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.59 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 99.58 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 99.55 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 99.54 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 99.53 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.51 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 99.5 | |
| PLN02709 | 222 | nudix hydrolase | 99.5 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 99.48 | |
| KOG3084 | 345 | consensus NADH pyrophosphatase I of the Nudix fami | 99.46 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.44 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 99.42 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 99.32 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 99.29 | |
| KOG2839 | 145 | consensus Diadenosine and diphosphoinositol polyph | 99.25 | |
| KOG3041 | 225 | consensus Nucleoside diphosphate-sugar hydrolase o | 99.09 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 99.07 | |
| KOG3069 | 246 | consensus Peroxisomal NUDIX hydrolase [Replication | 98.97 | |
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 98.87 | |
| PLN02839 | 372 | nudix hydrolase | 98.7 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 98.67 | |
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 98.55 | |
| KOG0142 | 225 | consensus Isopentenyl pyrophosphate:dimethylallyl | 97.85 | |
| KOG4195 | 275 | consensus Transient receptor potential-related cha | 97.54 | |
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 97.47 | |
| KOG2937 | 348 | consensus Decapping enzyme complex, predicted pyro | 97.15 | |
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 96.85 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 96.38 | |
| KOG4432 | 405 | consensus Uncharacterized NUDIX family hydrolase [ | 95.24 | |
| KOG4313 | 306 | consensus Thiamine pyrophosphokinase [Nucleotide t | 95.13 | |
| COG4111 | 322 | Uncharacterized conserved protein [General functio | 94.68 | |
| PRK13910 | 289 | DNA glycosylase MutY; Provisional | 92.8 | |
| PF13869 | 188 | NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B | 92.77 | |
| KOG1689 | 221 | consensus mRNA cleavage factor I subunit [RNA proc | 91.42 | |
| COG1194 | 342 | MutY A/G-specific DNA glycosylase [DNA replication | 90.06 | |
| KOG4548 | 263 | consensus Mitochondrial ribosomal protein L17 [Tra | 85.42 | |
| TIGR01084 | 275 | mutY A/G-specific adenine glycosylase. This equiva | 80.66 |
| >KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-44 Score=330.44 Aligned_cols=267 Identities=51% Similarity=0.836 Sum_probs=251.3
Q ss_pred eecccceeecccCCCCcEEEcCCCCCCChhHHHHHHHHHHHHHHhcCceeEEEecCCccccchHHHHhccccccccCccc
Q 019517 68 FSRNLRVLDFFDDEYDGVVVDPKRLPSDPDAFASILRFSLIHWRRMNKKGIWLKLPLENAELVPIAVKEGFKYHHAEPEY 147 (340)
Q Consensus 68 ~~~~~~~~~~~~d~~~g~~v~~~~~~~~~~~f~~~l~~~l~~w~~~~~~~vW~~l~~~~~~l~~~a~~~~f~~h~~~~~y 147 (340)
...+..++.|..|+|||++++.-..+.|+..|.+.|+.|+..|+..|++++|++++...+++++.|++.||.|||++.+|
T Consensus 15 ~~~~~~~l~~~~D~~ggv~v~~~~~~~d~~~f~~~l~~Sl~~W~~~Gr~~iwl~l~~~~~~lV~~a~~~gf~~hHae~~~ 94 (295)
T KOG0648|consen 15 MSVGSSLLAGLSDRYGGVVVDIVPEPMDEKLFIEELRASLQKWYLQGRKGIWLKLPEELARLVEEAAKYGFDYHHAESLY 94 (295)
T ss_pred cccchhhhcccccccCCEEeecccCCCCHHHHHHHHHHHHHHHHHccCcccceechHHHHhHHHHHHhcCcEEecccccc
Confidence 34556899999999999999997666699999999999999999999999999999999999999999999999999999
Q ss_pred ccccccccCCCCCCCCCCcceeEEEEEEEeCCceEEEEEeccCCCCCCCceEcceeeecCCCCHHHHHHHHHHHHhCCcc
Q 019517 148 LMLTYWIPDGPCVLPGNATHQVGVGGFVINDNNEVLVVQEKYCNPAFAGLWKLPTGFIDESEEIFKGAVREVKEETGVDT 227 (340)
Q Consensus 148 ~~l~~w~~~~~~~lp~~~~~~v~V~~lv~~~~~~VLLvqr~~~~~~~~g~W~lPGG~ve~GEs~~eAAiREv~EETGi~~ 227 (340)
+|++.|+++.+.++|.++.|+++++++|+|.+++|||++..++.....|.|++|+|.|++||++.++|+||++||||++.
T Consensus 95 ~~l~~Wl~e~~~~lP~~Ash~vgvg~~V~n~~~eVlVv~e~d~~~~~~~~wK~ptG~v~~~e~i~~gavrEvkeetgid~ 174 (295)
T KOG0648|consen 95 VMLTSWLREAPSTLPANASHRVGVGAFVLNKKKEVLVVQEKDGAVKIRGGWKLPTGRVEEGEDIWHGAVREVKEETGIDT 174 (295)
T ss_pred eeeeeeeccccccCCCchhhheeeeeeEecCCceeEEEEecccceeecccccccceEecccccchhhhhhhhHHHhCcch
Confidence 99999999999999999999999999999988999999998777788999999999999999999999999999999999
Q ss_pred eeeEEEEEEeeccCCCc--eEEEEEEEEEecCCCcccCCcCceeeEEEEeccccccCCCCCCCchHHHHHHHHHHHHhcc
Q 019517 228 EFVEVIAFRHAHNVAFQ--KSDLFFICMLKPLSTEIKVDDLEIKGAKWMPFMEFVKQPLIQGDCMFKKVIDICIARLRKR 305 (340)
Q Consensus 228 ~~~~~l~~~~~~~~~~~--~~~~~f~~~~~~~~~~~~~~~~E~~~~~Wv~leel~~~~~~~~~~~~~~il~~~l~~l~~~ 305 (340)
++.+.+.+++.|...+. +.++||+|.+++.+-+++.+..|+..++|||++|+..++..+...+++.+...|++++...
T Consensus 175 ef~eVla~r~~H~~~~~~~ksd~f~~c~L~p~s~~i~~~~~ei~~~~Wmp~~e~v~qp~~~~~~m~~~~~~Ic~~~~~~~ 254 (295)
T KOG0648|consen 175 EFVEVLAFRRAHNATFGLIKSDMFFTCELRPRSLDITKCKREIEAAAWMPIEEYVSQPLVHPKGMFRLAAGICLNRLEEF 254 (295)
T ss_pred hhhhHHHHHhhhcchhhcccccceeEEEeeccccccchhHHHHHHHhcccHHHhhcccccccchhhHHHhhhhHHHHhhh
Confidence 99999999999988877 8999999999999999999999999999999999999999888778888999999999999
Q ss_pred cCCCCCCcCcccchhhhhhhhhhhcCCCC
Q 019517 306 YCGLYPHQLVSAFDGQTSSLYYNDSDTQD 334 (340)
Q Consensus 306 y~g~~~~~l~~~f~~~~~~ly~~~~~~~~ 334 (340)
|.|+....+++++.++..+||+|..+...
T Consensus 255 ~~~~~~~~l~~~~~~k~~~ly~~~~~~~~ 283 (295)
T KOG0648|consen 255 YLGLTAIVLTTTYTGKESYLYYNEDHANM 283 (295)
T ss_pred cCCccceeccccccCcccccccccchhhh
Confidence 99999999999999999999999877543
|
|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG4111 Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13910 DNA glycosylase MutY; Provisional | Back alignment and domain information |
|---|
| >PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A | Back alignment and domain information |
|---|
| >KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01084 mutY A/G-specific adenine glycosylase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 340 | ||||
| 3h95_A | 199 | Crystal Structure Of The Nudix Domain Of Nudt6 Leng | 4e-16 | ||
| 3fxt_A | 113 | Crystal Structure Of The N-Terminal Domain Of Human | 5e-08 | ||
| 3o8s_A | 206 | Crystal Structure Of An Adp-Ribose Pyrophosphatase | 2e-05 | ||
| 1sjy_A | 159 | Crystal Structure Of Nudix Hydrolase Dr1025 From De | 2e-05 | ||
| 1vc8_A | 126 | Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydr | 8e-05 | ||
| 3gz5_A | 240 | Crystal Structure Of Shewanella Oneidensis Nrtr Len | 1e-04 | ||
| 3gz8_A | 162 | Cocrystal Structure Of Nudix Domain Of Shewanella O | 1e-04 | ||
| 1vc9_A | 126 | Crystal Structure Of A T.thermophilus Hb8 Ap6a Hydr | 2e-04 | ||
| 3hhj_A | 158 | Crystal Structure Of Mutator Mutt From Bartonella H | 8e-04 |
| >pdb|3H95|A Chain A, Crystal Structure Of The Nudix Domain Of Nudt6 Length = 199 | Back alignment and structure |
|
| >pdb|3FXT|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Nudt6 Length = 113 | Back alignment and structure |
| >pdb|3O8S|A Chain A, Crystal Structure Of An Adp-Ribose Pyrophosphatase (Ssu98_1448) From Streptococcus Suis 89-1591 At 2.27 A Resolution Length = 206 | Back alignment and structure |
| >pdb|1SJY|A Chain A, Crystal Structure Of Nudix Hydrolase Dr1025 From Deinococcus Radiodurans Length = 159 | Back alignment and structure |
| >pdb|1VC8|A Chain A, Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydrolase Ndx1-Ap6a Complex Length = 126 | Back alignment and structure |
| >pdb|3GZ5|A Chain A, Crystal Structure Of Shewanella Oneidensis Nrtr Length = 240 | Back alignment and structure |
| >pdb|3GZ8|A Chain A, Cocrystal Structure Of Nudix Domain Of Shewanella Oneidensis Nrtr Complexed With Adp Ribose Length = 162 | Back alignment and structure |
| >pdb|1VC9|A Chain A, Crystal Structure Of A T.thermophilus Hb8 Ap6a Hydrolase E50q Mutant- Mg2+-atp Complex Length = 126 | Back alignment and structure |
| >pdb|3HHJ|A Chain A, Crystal Structure Of Mutator Mutt From Bartonella Henselae Length = 158 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 340 | |||
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 5e-52 | |
| 3fxt_A | 113 | Nucleoside diphosphate-linked moiety X motif 6; nu | 6e-36 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 1e-26 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 1e-24 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 5e-24 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 7e-23 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 1e-22 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 2e-19 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 3e-19 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 5e-19 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 6e-18 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 9e-18 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 2e-17 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 2e-17 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 2e-17 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 2e-16 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 9e-16 | |
| 1xsa_A | 153 | BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, | 1e-15 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 1e-14 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 2e-13 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 7e-13 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 9e-13 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 1e-12 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 2e-12 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 2e-12 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 3e-12 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 3e-12 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 3e-12 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 1e-11 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 1e-11 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 4e-11 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 1e-10 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 2e-10 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 4e-10 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 5e-10 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 6e-10 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 9e-10 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 3e-09 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 1e-08 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 4e-08 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 8e-08 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 9e-08 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 1e-07 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 3e-07 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 6e-07 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 6e-07 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 9e-07 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 9e-07 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 1e-06 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 1e-06 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 1e-06 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 3e-06 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 5e-06 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 6e-06 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 9e-06 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 1e-05 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 1e-05 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 3e-05 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 3e-05 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 5e-05 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 1e-04 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 3e-04 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 5e-04 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 5e-04 |
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 | Back alignment and structure |
|---|
Score = 170 bits (431), Expect = 5e-52
Identities = 54/195 (27%), Positives = 86/195 (44%), Gaps = 15/195 (7%)
Query: 137 GFKYHHAEPEYLMLTYWIPDGPCVLPGNATHQVGVGGFVINDNNEVLVVQEKYCNPAFAG 196
+HH+ L + + +HQVGV G V +++ ++V +
Sbjct: 2 HHHHHHSSGVDL-------GTENLYFQSMSHQVGVAGAVFDESTRKILVVQDRNKLK--N 52
Query: 197 LWKLPTGFIDESEEIFKGAVREVKEETGVDTEFVEVIAFRHAHNV--AFQKSDLFFICML 254
+WK P G + E+I AVREV EETG+ +EF V++ R H AF KSD++ IC L
Sbjct: 53 MWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQQHTNPGAFGKSDMYIICRL 112
Query: 255 KPLSTEIKVDDLEIKGAKWMPFMEFVKQPLIQGDCMFKKVIDICIARLRKRY--CGLYPH 312
KP S I E +WM + K + +V + + R+ + L
Sbjct: 113 KPYSFTINFCQEECLRCEWMDLNDLAKTENTTP--ITSRVARLLLYGYREGFDKIDLTVE 170
Query: 313 QLVSAFDGQTSSLYY 327
+L + + G LY+
Sbjct: 171 ELPAVYTGLFYKLYH 185
|
| >3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 | Back alignment and structure |
|---|
| >1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206 | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187 | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273 | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139 | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Length = 240 | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Length = 300 | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Length = 226 | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Length = 269 | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Length = 217 | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Length = 292 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Length = 212 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.91 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.9 | |
| 3fxt_A | 113 | Nucleoside diphosphate-linked moiety X motif 6; nu | 99.9 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.86 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.85 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.85 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.85 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.84 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.83 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.82 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.82 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.82 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.82 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.82 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.82 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.82 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.82 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.81 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.81 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.81 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.81 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.81 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.81 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.81 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.81 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.81 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.81 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.8 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.8 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.8 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.8 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.8 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.8 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.79 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 99.79 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.79 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.79 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.78 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.78 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.78 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.78 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.78 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.78 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.77 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.77 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.77 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.76 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.76 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.76 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.76 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.76 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.76 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 99.75 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.75 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.75 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.75 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.74 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.74 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.74 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.74 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.73 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 99.72 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.7 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.68 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.68 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.66 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.64 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.6 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 99.6 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 99.6 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.54 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 99.51 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 99.51 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 99.36 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 99.35 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 99.24 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 98.89 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 98.8 |
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
Probab=99.91 E-value=7.9e-24 Score=192.29 Aligned_cols=165 Identities=17% Similarity=0.257 Sum_probs=130.3
Q ss_pred CCCCCcceeEEEEEEE---eCCceEEEEEeccCCCCCCCceEcceeeecCCCCHHHHHHHHHHHHhCCcceeeEEEEEEe
Q 019517 161 LPGNATHQVGVGGFVI---NDNNEVLVVQEKYCNPAFAGLWKLPTGFIDESEEIFKGAVREVKEETGVDTEFVEVIAFRH 237 (340)
Q Consensus 161 lp~~~~~~v~V~~lv~---~~~~~VLLvqr~~~~~~~~g~W~lPGG~ve~GEs~~eAAiREv~EETGi~~~~~~~l~~~~ 237 (340)
.+.++.+.++|+++|+ +++++|||++|.. .+..|.|.+|||++++||++.+||+||++||||+.+..++.++.+.
T Consensus 6 ~~~~~~p~v~v~~vi~~~~~~~~~vLLv~r~~--~~~~g~w~lPGG~ve~gEs~~~Aa~REl~EEtGl~~~~~~~l~~~~ 83 (226)
T 2fb1_A 6 YSSNPTFYLGIDCIIFGFNEGEISLLLLKRNF--EPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFG 83 (226)
T ss_dssp TTTSCCEEEEEEEEEEEEETTEEEEEEEECSS--SSSTTCEECEEEECCTTSCHHHHHHHHHHHHHCCCSCEEEEEEEEC
T ss_pred cccCCCCeEEEEEEEEEEeCCCCEEEEEECcC--CCCCCCEECCeeccCCCCCHHHHHHHHHHHHHCCCCCceEEEEEeC
Confidence 4556667788998888 4568999999964 2457899999999999999999999999999999999888887665
Q ss_pred ecc-CCCc-eEEEEEEEEEecCCCcccCCcCceeeEEEEeccccccCCCCCCCchHHHHHHHHHHHHhcc--cCCCCCCc
Q 019517 238 AHN-VAFQ-KSDLFFICMLKPLSTEIKVDDLEIKGAKWMPFMEFVKQPLIQGDCMFKKVIDICIARLRKR--YCGLYPHQ 313 (340)
Q Consensus 238 ~~~-~~~~-~~~~~f~~~~~~~~~~~~~~~~E~~~~~Wv~leel~~~~~~~~~~~~~~il~~~l~~l~~~--y~g~~~~~ 313 (340)
... ...+ ...++|++... ......+++|+.+++|++++++.++.+. + +.+++.++++++.+ |.++.+..
T Consensus 84 ~~~r~~~~~~v~~~y~a~~~--~~~~~~~~~e~~~~~W~~~~el~~l~~d---h--~~il~~a~~rlr~~~~y~~i~~~l 156 (226)
T 2fb1_A 84 AIDRDPGERVVSIAYYALIN--INEYDRELVQKHNAYWVNINELPALIFD---H--PEMVDKAREMMKQKASVEPIGFNL 156 (226)
T ss_dssp CTTSSSSSCEEEEEEEEECC--TTSSCHHHHHHTTEEEEETTSCCCBSTT---H--HHHHHHHHHHHHHHHHHSGGGGGG
T ss_pred CCCcCCCceEEEEEEEEEec--CcccccCCccccceEEEEHHHhhhccCC---H--HHHHHHHHHHHHhhcccCchHHHh
Confidence 332 2222 33445666643 2222234578889999999999987653 3 68899999988876 89999999
Q ss_pred Ccccc-hhhhhhhhhhhcCCCC
Q 019517 314 LVSAF-DGQTSSLYYNDSDTQD 334 (340)
Q Consensus 314 l~~~f-~~~~~~ly~~~~~~~~ 334 (340)
+|.+| ..+++.+|+.+++.+.
T Consensus 157 lp~~ftl~~l~~~ye~~~~~~~ 178 (226)
T 2fb1_A 157 LPKLFTLSQLQSLYEAIYGEPM 178 (226)
T ss_dssp SCSEEEHHHHHHHHHHHHTSCC
T ss_pred CCccccHHHHHHHHHHHhCCCC
Confidence 99999 9999999999998765
|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >3fxt_A Nucleoside diphosphate-linked moiety X motif 6; nudix, NUDT6, GFG, FGF2AS, antisense basic fibroblast growth FGF-2 regulation, hydrolase; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 340 | ||||
| d1sjya_ | 158 | d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc | 1e-20 | |
| d1vcda1 | 126 | d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t | 9e-18 | |
| d2b0va1 | 146 | d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N | 2e-17 | |
| d2a6ta2 | 151 | d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c | 3e-15 | |
| d1k2ea_ | 152 | d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa | 2e-14 | |
| d1ryaa_ | 160 | d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD | 1e-13 | |
| d2azwa1 | 147 | d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E | 3e-13 | |
| d1irya_ | 156 | d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha | 1e-12 | |
| d2fvva1 | 135 | d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat | 2e-12 | |
| d1xsba_ | 153 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 4e-12 | |
| d1vk6a2 | 131 | d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher | 8e-12 | |
| d2fmla2 | 202 | d.113.1.6 (A:3-204) Hypothetical protein EF2700, N | 2e-11 | |
| d2b06a1 | 155 | d.113.1.1 (A:1-155) Hypothetical protein SP1235 (s | 3e-11 | |
| d1v8ya_ | 158 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus | 4e-10 | |
| d1puna_ | 129 | d.113.1.1 (A:) Nucleoside triphosphate pyrophospho | 6e-10 | |
| d1nqza_ | 187 | d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinoco | 8e-10 | |
| d1hzta_ | 153 | d.113.1.2 (A:) Isopentenyl diphosphate isomerase { | 6e-09 | |
| d2fb1a2 | 147 | d.113.1.6 (A:3-149) Hypothetical protein BT0354, N | 2e-08 | |
| d1jkna_ | 165 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 4e-08 | |
| d1u20a1 | 196 | d.113.1.1 (A:14-209) U8 snorna-binding protein x29 | 6e-08 | |
| d2fkba1 | 161 | d.113.1.2 (A:8-168) Hypothetical protein YfcD {Esc | 2e-07 | |
| d2o5fa1 | 162 | d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D | 2e-07 | |
| d1q33a_ | 292 | d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr | 3e-07 | |
| d1mqea_ | 202 | d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobac | 7e-07 | |
| d1ktga_ | 137 | d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas | 2e-05 |
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: MutT-like domain: Hypothetical protein DR1025 species: Deinococcus radiodurans [TaxId: 1299]
Score = 84.8 bits (209), Expect = 1e-20
Identities = 33/144 (22%), Positives = 60/144 (41%), Gaps = 3/144 (2%)
Query: 166 THQVGVGGFVINDNNEVLVVQEKY--CNPAFAGLWKLPTGFIDESEEIFKGAVREVKEET 223
G ++N+ ++L+VQEK +P AGLW +P+G +++ E AVRE EET
Sbjct: 10 VELRAAGVVLLNERGDILLVQEKGIPGHPEKAGLWHIPSGAVEDGENPQDAAVREACEET 69
Query: 224 GVDTEFVEVIA-FRHAHNVAFQKSDLFFICMLKPLSTEIKVDDLEIKGAKWMPFMEFVKQ 282
G+ V+ + + ++ +P T EI A ++ +F +
Sbjct: 70 GLRVRPVKFLGAYLGRFPDGVLILRHVWLAEPEPGQTLAPAFTDEIAEASFVSREDFAQL 129
Query: 283 PLIQGDCMFKKVIDICIARLRKRY 306
M++ + A K +
Sbjct: 130 YAAGQIRMYQTKLFYADALREKGF 153
|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146 | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152 | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131 | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202 | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Length = 155 | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Length = 129 | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Length = 187 | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196 | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 202 | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Length = 137 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 340 | |||
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.87 | |
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.87 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.86 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.85 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.85 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.83 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 99.83 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.82 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 99.81 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.81 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.81 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.81 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.81 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.8 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.78 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.78 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.78 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.78 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.78 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.78 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.76 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.75 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.75 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.75 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 99.68 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.65 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 99.59 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 99.45 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 99.31 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 99.3 |
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Nudix superfamily: Nudix family: BT0354 N-terminal domain-like domain: Hypothetical protein BT0354, N-terminal domain species: Bacteroides thetaiotaomicron [TaxId: 818]
Probab=99.87 E-value=4.6e-22 Score=167.07 Aligned_cols=134 Identities=17% Similarity=0.345 Sum_probs=100.8
Q ss_pred CCCcceeEEEEEEEe--C-CceEEEEEeccCCCCCCCceEcceeeecCCCCHHHHHHHHHHHHhCCcceeeEEEEEEeec
Q 019517 163 GNATHQVGVGGFVIN--D-NNEVLVVQEKYCNPAFAGLWKLPTGFIDESEEIFKGAVREVKEETGVDTEFVEVIAFRHAH 239 (340)
Q Consensus 163 ~~~~~~v~V~~lv~~--~-~~~VLLvqr~~~~~~~~g~W~lPGG~ve~GEs~~eAAiREv~EETGi~~~~~~~l~~~~~~ 239 (340)
.++...++|.++|+. + +.+|||++|+.. +..|.|.+|||++++||++.+||+||++||||+++....+++.+...
T Consensus 5 ~~p~~~v~Vd~Vi~~~~~~~~~vLLv~R~~~--p~~g~W~lPGG~ie~~Es~~~aa~REl~EEtGl~~~~~~~~~~~~~~ 82 (147)
T d2fb1a2 5 SNPTFYLGIDCIIFGFNEGEISLLLLKRNFE--PAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAI 82 (147)
T ss_dssp TSCCEEEEEEEEEEEEETTEEEEEEEECSSS--SSTTCEECEEEECCTTSCHHHHHHHHHHHHHCCCSCEEEEEEEECCT
T ss_pred CCCCcceEEEEEEEEEeCCcCEEEEEEccCC--CCCCcEeCcEeeecCCCCHHHHHHHHHHHHhCCcccceeeeeEecCC
Confidence 345567888888763 3 347999998643 46799999999999999999999999999999999888888876543
Q ss_pred cCCC-c-eEEEEEEEEEecCCCcccCCcCceeeEEEEeccccccCCCCCCCchHHHHHHHHHHHHhcc
Q 019517 240 NVAF-Q-KSDLFFICMLKPLSTEIKVDDLEIKGAKWMPFMEFVKQPLIQGDCMFKKVIDICIARLRKR 305 (340)
Q Consensus 240 ~~~~-~-~~~~~f~~~~~~~~~~~~~~~~E~~~~~Wv~leel~~~~~~~~~~~~~~il~~~l~~l~~~ 305 (340)
.... . ...++|+|.... .......+|..+++|+++++++.+++ +| ++|++.++++++.+
T Consensus 83 ~~~~~~~~v~~~~~~~~~~--~~~~~~~~e~~~~~W~~~~~lp~laf---DH--~~ii~~a~~~lr~k 143 (147)
T d2fb1a2 83 DRDPGERVVSIAYYALINI--NEYDRELVQKHNAYWVNINELPALIF---DH--PEMVDKAREMMKQK 143 (147)
T ss_dssp TSSSSSCEEEEEEEEECCT--TSSCHHHHHHTTEEEEETTSCCCBST---TH--HHHHHHHHHHHHHH
T ss_pred cccCCCceEEEEEEEEecC--CcccCCCcchhheEEecHHhchhccc---CH--HHHHHHHHHHHHHH
Confidence 3222 2 334566666533 23333456788999999999998776 44 78999999988765
|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|