Citrus Sinensis ID: 019584


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MGLSLTFFTFRHLVLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGPLSKKCNNSEASPPEEDPHSESVFTFGWKTVVIGYASGTIIGVILGHIFSTRKYEWLAKTFRLQPKADARTRRVRGHRQRM
ccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEccccccEEEEEccccccEEEEccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccHHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccEEEEEEEccHHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHcccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccccEEEEEEEccccccccccccccHccccccEEEEccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccHHHHHHcccccccccHHHHcccHHHHHEEEEHHHHccccHHHHHHHHcHccccccccHHHHHHcccc
MGLSLTFFTFRHLVLFSFLIFHLAIAHFisstqplchdrERSALLNFKESLVINQTassysstypkvatwkpdeknkdccswdgvkcnedtghVVELDLAssclygsinstSSLFQLVHLQrlslfdnnfnfseipsaILNFSRLTHlnlsqsyfsgqipaellelsnlevldlsysnfDTFYLKLQKPGLANLAENLTNLKALDLINVHISstvphtlanlsslrfsslsgcrlqgefpqeifqlpnlqflglcggplskkcnnseasppeedphsesvftfgWKTVVIGYASGTIIGVILGHIFSTRKYEWLAKTFRlqpkadartrrvrghrqrm
MGLSLTFFTFRHLVLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVinqtassysstypkvatwkpdekNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGPLSKKCNNSEASPPEEDPHSESVFTFGWKTVVIGYASGTIIGVILGHIFSTRKYEWLAKtfrlqpkadartrrvrghrqrm
MGLSLTFFTFRHLVLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAellelsnlevldlSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGPLSKKCNNSEASPPEEDPHSESVFTFGWKTVVIGYASGTIIGVILGHIFSTRKYEWLAKTFRLQPKADARTRRVRGHRQRM
***SLTFFTFRHLVLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGP*********************VFTFGWKTVVIGYASGTIIGVILGHIFSTRKYEWLAKTFRL******************
*****TF*TFRHLVLFSFLIFHLAIAHFISST*****DRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGPL*************************WKTVVIGYASGTIIGVILGHIFSTRKYEWLAKTFRLQPKADA************
MGLSLTFFTFRHLVLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGPLSKK***************ESVFTFGWKTVVIGYASGTIIGVILGHIFSTRKYEWLAKTFRLQPK***************
*GLSLTFFTFRHLVLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGPLSKKCNNSEASPPEEDPHSESVFTFGWKTVVIGYASGTIIGVILGHIFSTRKYEWLAKTFRLQPK***RT**********
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLSLTFFTFRHLVLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGPLSKKCNNSEASPPEEDPHSESVFTFGWKTVVIGYASGTIIGVILGHIFSTRKYEWLAKTFRLQPKADARTRRVRGHRQRM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query338 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.674 0.269 0.344 6e-25
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.603 0.203 0.344 6e-17
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.541 0.179 0.318 4e-16
O49545 1003 Leucine-rich repeat recep no no 0.609 0.205 0.327 2e-15
O82318 960 Probably inactive leucine no no 0.576 0.203 0.345 2e-15
Q9SGP2 996 Receptor-like protein kin no no 0.579 0.196 0.284 4e-14
C0LGW6 966 LRR receptor-like serine/ no no 0.668 0.233 0.287 1e-13
C0LGR3 1091 Probable LRR receptor-lik no no 0.600 0.186 0.309 1e-13
Q9ZUI0 980 Putative leucine-rich rep no no 0.562 0.193 0.320 1e-13
Q6XAT2 967 LRR receptor-like serine/ no no 0.665 0.232 0.282 3e-13
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  115 bits (287), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 135/247 (54%), Gaps = 19/247 (7%)

Query: 11  RHLVLFSFLIFHLAI-AHFISSTQP-LCHDRERSALLNFKESLVINQTASSYSSTYPKVA 68
           RH V  S +I  L++  H ++S+ P  C D +R ALL F+    IN       +++  + 
Sbjct: 7   RHWVFSSRIIIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEFPIN-------ASWHIMN 59

Query: 69  TWK-PDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFD 127
            W+ P  K+ DCC W+GV CN+ +G V+ LD+ ++ L   + + SSLF+L +L+ L L +
Sbjct: 60  QWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTN 119

Query: 128 NNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQ 187
            N  + EIPS++ N S LT +NL  + F G+IPA +  L+ L  L L+ +      L  +
Sbjct: 120 CNL-YGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANN-----VLTGE 173

Query: 188 KPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLP 247
            P  ++L  NL+ L  L+L +  +   +P ++ +L  LR  SL+   L GE P  +  L 
Sbjct: 174 IP--SSLG-NLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLS 230

Query: 248 NLQFLGL 254
           NL  L L
Sbjct: 231 NLVHLVL 237




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
224140505 993 predicted protein [Populus trichocarpa] 0.730 0.248 0.587 5e-68
359485822 993 PREDICTED: receptor-like protein 12-like 0.727 0.247 0.586 1e-67
224140517 979 predicted protein [Populus trichocarpa] 0.748 0.258 0.593 1e-66
224140511 894 predicted protein [Populus trichocarpa] 0.736 0.278 0.586 4e-66
359490156 886 PREDICTED: receptor-like protein 12-like 0.656 0.250 0.598 3e-65
224140509 961 predicted protein [Populus trichocarpa] 0.642 0.225 0.617 7e-65
359485824 973 PREDICTED: receptor-like protein 12-like 0.730 0.253 0.568 2e-63
147866761 859 hypothetical protein VITISV_021527 [Viti 0.748 0.294 0.547 5e-63
147804670 1004 hypothetical protein VITISV_022039 [Viti 0.692 0.233 0.572 2e-61
224140513 947 predicted protein [Populus trichocarpa] 0.736 0.262 0.478 2e-59
>gi|224140505|ref|XP_002323623.1| predicted protein [Populus trichocarpa] gi|222868253|gb|EEF05384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  264 bits (674), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 148/252 (58%), Positives = 179/252 (71%), Gaps = 5/252 (1%)

Query: 1   MGLSLTFFTFRHLVLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVINQTASSY 60
           M   + F T R L L    +FHL   +  SS QPLCH+ E  ALL  KESL IN++ASS 
Sbjct: 1   MASPVCFLTIRMLFLVLLSLFHLRACYSSSSMQPLCHEDESYALLQLKESLAINESASSD 60

Query: 61  SSTYPKVATWKPDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHL 120
            S YPKVA+W+ D ++ DCCSWDGV+C+ D+GHV+ LDL+SSCL+GSINS SSLF LV L
Sbjct: 61  PSAYPKVASWRVDGESGDCCSWDGVECDGDSGHVIGLDLSSSCLHGSINSNSSLFHLVQL 120

Query: 121 QRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFD 180
           +RL+L  N+FN S++PS I N SRL  LNLS S FSGQIPAE+LELS L  LDL +++  
Sbjct: 121 RRLNLSGNDFNNSKMPSEIRNLSRLFDLNLSYSNFSGQIPAEILELSKLVSLDLRWNS-- 178

Query: 181 TFYLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFP 240
              LKL+KPGL +L E LTNL+ L L  V IS+ VP  +ANLSSL    LS C LQGEFP
Sbjct: 179 ---LKLRKPGLQHLVEALTNLEVLHLSGVSISAEVPQIMANLSSLSSLFLSYCGLQGEFP 235

Query: 241 QEIFQLPNLQFL 252
             IFQLPNL+FL
Sbjct: 236 MGIFQLPNLRFL 247




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359485822|ref|XP_003633342.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140517|ref|XP_002323629.1| predicted protein [Populus trichocarpa] gi|222868259|gb|EEF05390.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140511|ref|XP_002323626.1| predicted protein [Populus trichocarpa] gi|222868256|gb|EEF05387.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140509|ref|XP_002323625.1| predicted protein [Populus trichocarpa] gi|222868255|gb|EEF05386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147866761|emb|CAN80989.1| hypothetical protein VITISV_021527 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140513|ref|XP_002323627.1| predicted protein [Populus trichocarpa] gi|222868257|gb|EEF05388.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
TAIR|locus:2205005 1019 RLP7 "AT1G47890" [Arabidopsis 0.677 0.224 0.42 9e-39
TAIR|locus:2825762 994 RLP6 "AT1G45616" [Arabidopsis 0.721 0.245 0.389 3.2e-36
TAIR|locus:2119535 725 RLP48 "receptor like protein 4 0.547 0.255 0.351 3.5e-34
TAIR|locus:2078112 868 RLP32 "receptor like protein 3 0.701 0.273 0.341 3.4e-28
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.677 0.242 0.354 1.1e-27
TAIR|locus:2096339 786 RLP30 "receptor like protein 3 0.695 0.298 0.314 2.6e-27
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.671 0.230 0.353 4e-27
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.721 0.254 0.333 5.7e-26
TAIR|locus:2090754 711 RLP43 "receptor like protein 4 0.695 0.330 0.329 1e-24
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.674 0.269 0.331 2.4e-24
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 425 (154.7 bits), Expect = 9.0e-39, P = 9.0e-39
 Identities = 105/250 (42%), Positives = 140/250 (56%)

Query:    14 VLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPD 73
             + F  LI    I  F+S+TQ LCH  ++ ALL+FK    +  + S           W   
Sbjct:    53 ICFLILIPSFLIT-FVSATQHLCHSDQKDALLDFKNEFGMVDSKS-----------WV-- 98

Query:    74 EKNK-DCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNF 132
               NK DCCSWDG+ C+  +G+V+ LDL+S  LYG + S SSLF+L HL+ L+L +NNFN 
Sbjct:    99 --NKSDCCSWDGITCDAKSGNVIGLDLSSIFLYGQLKSNSSLFKLRHLRDLNLANNNFNN 156

Query:   133 SEIPSAILNFSRLTHLNLSQSYFSGQIPAXXXXXXXXXXXXXSYSNF---DTF-YLKLQK 188
             S IP+     + L  L+LSQS  SGQIP              S S+F   ++F YL + K
Sbjct:   157 SPIPAEFDKLTGLERLDLSQSSLSGQIPINLLQLTKLVSLDLSSSDFFGDESFHYLSIDK 216

Query:   189 PGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPN 248
               L  LA NL NL+ LD+  V ISS +P   +N+ SLR  +L+GC L GEFP  I  +PN
Sbjct:   217 SFLPLLARNLRNLRELDMSYVKISSEIPEEFSNIRSLRSLNLNGCNLFGEFPSSILLIPN 276

Query:   249 LQFLGLCGGP 258
             LQ + L   P
Sbjct:   277 LQSIDLGNNP 286


GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC;RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096339 RLP30 "receptor like protein 30" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XVI001173
hypothetical protein (993 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-08
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 75.7 bits (186), Expect = 6e-15
 Identities = 64/243 (26%), Positives = 105/243 (43%), Gaps = 59/243 (24%)

Query: 13  LVLFSFLIFHLAIAHFISSTQPLCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKP 72
            ++F           F++ +  + H  E   LL+FK S+        Y S       W  
Sbjct: 11  YLIFMLFFL------FLNFS--MLHAEELELLLSFKSSI---NDPLKYLSN------WNS 53

Query: 73  DEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNF 132
              + D C W G+ CN ++  VV +DL+   + G I  +S++F+L ++Q ++L +N  + 
Sbjct: 54  ---SADVCLWQGITCN-NSSRVVSIDLSGKNISGKI--SSAIFRLPYIQTINLSNNQLSG 107

Query: 133 SEIPSAILNFS-RLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQKPGL 191
             IP  I   S  L +LNLS + F+G IP                               
Sbjct: 108 -PIPDDIFTTSSSLRYLNLSNNNFTGSIPRG----------------------------- 137

Query: 192 ANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQF 251
                ++ NL+ LDL N  +S  +P+ + + SSL+   L G  L G+ P  +  L +L+F
Sbjct: 138 -----SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEF 192

Query: 252 LGL 254
           L L
Sbjct: 193 LTL 195


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 338
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PLN03150623 hypothetical protein; Provisional 99.86
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.85
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.55
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.55
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.54
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.5
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.5
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.48
PLN03150623 hypothetical protein; Provisional 99.46
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.38
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.35
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.34
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.32
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.3
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.25
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.23
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.22
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.18
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.12
KOG4237498 consensus Extracellular matrix protein slit, conta 99.11
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.0
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.91
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.9
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.77
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.72
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.5
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.49
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.46
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.29
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.27
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.26
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.26
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.2
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.17
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.16
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.0
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.97
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.88
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.87
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.85
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.8
PRK15386 426 type III secretion protein GogB; Provisional 97.8
PRK15386 426 type III secretion protein GogB; Provisional 97.66
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.5
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.42
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.39
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.29
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.77
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.74
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.25
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.75
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.69
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.46
KOG4308478 consensus LRR-containing protein [Function unknown 95.37
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.29
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.19
KOG4308 478 consensus LRR-containing protein [Function unknown 91.36
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.65
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.1
smart0037026 LRR Leucine-rich repeats, outliers. 90.1
smart0037026 LRR Leucine-rich repeats, outliers. 89.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.89
KOG1947482 consensus Leucine rich repeat proteins, some prote 89.69
KOG1947482 consensus Leucine rich repeat proteins, some prote 89.07
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.01
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.38
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.45
KOG4341483 consensus F-box protein containing LRR [General fu 82.51
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 80.46
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.94  E-value=2e-26  Score=241.74  Aligned_cols=210  Identities=34%  Similarity=0.521  Sum_probs=140.4

Q ss_pred             CHHHHHHHHHHHHcCccCCCCCCCCCCCCCCCCCCCCCCCCCCcccceeEEcCCCCcEEEEEeCCCCceeecCCCCcccc
Q 019584           37 HDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCSWDGVKCNEDTGHVVELDLASSCLYGSINSTSSLFQ  116 (338)
Q Consensus        37 ~~~e~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~~l~~L~Ls~n~l~~~~~~~~~l~~  116 (338)
                      .++|+.||++||+.+.++..         .+.+|+   ...+||.|.|+.|+. .++|+.|||++|++.+.++.  .+..
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~---------~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~--~~~~   91 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLK---------YLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISS--AIFR   91 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcc---------cCCCCC---CCCCCCcCcceecCC-CCcEEEEEecCCCccccCCh--HHhC
Confidence            56899999999999864432         567897   567899999999975 36899999999999998877  8889


Q ss_pred             CcCccEEEccCCCCCCCCCchhhh-cCCCCcEEEcccccCccccchhhcCCCCCCEEEccCCCCCccc------------
Q 019584          117 LVHLQRLSLFDNNFNFSEIPSAIL-NFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFY------------  183 (338)
Q Consensus       117 l~~L~~L~L~~n~l~~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~------------  183 (338)
                      +++|+.|+|++|.+++. +|..+. .+++|++|+|++|.+++.+|.  +.+++|++|++++|.+++..            
T Consensus        92 l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~  168 (968)
T PLN00113         92 LPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKV  168 (968)
T ss_pred             CCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCE
Confidence            99999999999999865 776554 777888888877777665553  33555556666555543100            


Q ss_pred             -------ccccCCCcchhhcCCCCCCEEEccCCCCCCCCchhcccCCCCCeeecccccCcccCchhccCCCCCCeeeccC
Q 019584          184 -------LKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCG  256 (338)
Q Consensus       184 -------l~~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~  256 (338)
                             +.   +.+|..+.++++|++|++++|.+.+.+|..++++++|++|+|++|.+++.+|..+..+++|++|++++
T Consensus       169 L~L~~n~l~---~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~  245 (968)
T PLN00113        169 LDLGGNVLV---GKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVY  245 (968)
T ss_pred             EECccCccc---ccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcC
Confidence                   11   23444455555555555555555555555555555555555555555555555555555555555555


Q ss_pred             CCCCCcCCCCC
Q 019584          257 GPLSKKCNNSE  267 (338)
Q Consensus       257 N~l~~~~p~~~  267 (338)
                      |.+++.+|..+
T Consensus       246 n~l~~~~p~~l  256 (968)
T PLN00113        246 NNLTGPIPSSL  256 (968)
T ss_pred             ceeccccChhH
Confidence            55555555433



>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 9e-08
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-05
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Iteration: 1

Score = 54.3 bits (129), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 65/225 (28%), Positives = 93/225 (41%), Gaps = 27/225 (12%) Query: 35 LCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCC--SWDGVKCNEDTG 92 LC+ +++ ALL K+ L T SS W P DCC +W GV C+ DT Sbjct: 2 LCNPQDKQALLQIKKDLGNPTTLSS----------WLP---TTDCCNRTWLGVLCDTDTQ 48 Query: 93 --HVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNL 150 V LDL+ L SSL L +L L + N IP AI ++L +L + Sbjct: 49 TYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYI 108 Query: 151 SQSYFSGQIPAXXXXXXXXXXXXXSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVH 210 + + SG IP SY+ P +++L NL + Sbjct: 109 THTNVSGAIPDFLSQIKTLVTLDFSYNALSGTL----PPSISSLP----NLVGITFDGNR 160 Query: 211 ISSTVPHTLANLSSLRFS-SLSGCRLQGEFPQEIFQLPNLQFLGL 254 IS +P + + S L S ++S RL G+ P L NL F+ L Sbjct: 161 ISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL-NLAFVDL 204
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query338
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-27
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-27
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-25
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-19
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-18
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-12
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 9e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  144 bits (366), Expect = 1e-38
 Identities = 53/279 (18%), Positives = 97/279 (34%), Gaps = 79/279 (28%)

Query: 29  ISSTQPLCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCSWDGVKCN 88
             ++      RE   L++FK+ L                  W  ++   + C++DGV C 
Sbjct: 2   FQASPSQSLYREIHQLISFKDVLPDKNLLPD----------WSSNK---NPCTFDGVTC- 47

Query: 89  EDTGHVVE--------------------------------------------------LD 98
                V                                                    LD
Sbjct: 48  -RDDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLD 106

Query: 99  LASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLNLSQSYFSGQ 158
           L+ + L G + + +SL     L+ L++  N  +F    S  L  + L  L+LS +  SG 
Sbjct: 107 LSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGA 166

Query: 159 IPAELLE---LSNLEVLDLSYSNFDTFYLKLQKPGLANLAENLTNLKALDLINVHISSTV 215
                +       L+ L +S +            G  +++    NL+ LD+ + + S+ +
Sbjct: 167 NVVGWVLSDGCGELKHLAISGNKIS---------GDVDVS-RCVNLEFLDVSSNNFSTGI 216

Query: 216 PHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGL 254
           P  L + S+L+   +SG +L G+F + I     L+ L +
Sbjct: 217 P-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNI 254


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.95
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.86
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.84
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.82
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.81
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.81
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.81
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.81
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.81
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.8
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.8
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.8
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.79
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.79
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.78
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.78
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.78
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.77
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.77
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.77
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.76
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.76
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.76
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.75
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.75
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.74
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.74
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.73
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.72
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.7
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.69
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.66
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.66
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.64
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.63
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.63
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.62
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.55
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.54
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.53
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.51
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.5
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.43
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.37
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.21
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.2
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.18
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.9
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.53
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.41
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.76
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.74
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.46
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.23
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.97
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.88
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.4
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.97  E-value=1.1e-31  Score=245.61  Aligned_cols=209  Identities=31%  Similarity=0.477  Sum_probs=178.5

Q ss_pred             CCCHHHHHHHHHHHHcCccCCCCCCCCCCCCCCCCCCCCCCCCCCcc--cceeEEcCCC--CcEEEEEeCCCCcee--ec
Q 019584           35 LCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCCS--WDGVKCNEDT--GHVVELDLASSCLYG--SI  108 (338)
Q Consensus        35 ~~~~~e~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~c~--w~gv~c~~~~--~~l~~L~Ls~n~l~~--~~  108 (338)
                      .|.++|++||++||+++.++.          .+.+|.   .+.+||.  |.||.|+...  ++|+.|+|++|.+.+  .+
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~----------~l~~W~---~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~   68 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT----------TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPI   68 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG----------GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEEC
T ss_pred             CCCHHHHHHHHHHHHhcCCcc----------cccCCC---CCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCccc
Confidence            599999999999999996432          568897   4568898  9999998654  799999999999998  78


Q ss_pred             CCCCccccCcCccEEEccC-CCCCCCCCchhhhcCCCCcEEEcccccCccccchhhcCCCCCCEEEccCCCCCccccccc
Q 019584          109 NSTSSLFQLVHLQRLSLFD-NNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAELLELSNLEVLDLSYSNFDTFYLKLQ  187 (338)
Q Consensus       109 ~~~~~l~~l~~L~~L~L~~-n~l~~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~l~~~  187 (338)
                      +.  .+.++++|++|++++ |.+.+. +|..+.++++|++|++++|.+++.+|..+..+++|++|++++|.++       
T Consensus        69 ~~--~l~~l~~L~~L~L~~~n~l~~~-~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~-------  138 (313)
T 1ogq_A           69 PS--SLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALS-------  138 (313)
T ss_dssp             CG--GGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEE-------
T ss_pred             Ch--hHhCCCCCCeeeCCCCCccccc-CChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccC-------
Confidence            87  999999999999995 888876 8999999999999999999999999999999999999999999954       


Q ss_pred             CCCcchhhcCCCCCCEEEccCCCCCCCCchhcccCC-CCCeeecccccCcccCchhccCCCCCCeeeccCCCCCCcCCCC
Q 019584          188 KPGLANLAENLTNLKALDLINVHISSTVPHTLANLS-SLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGPLSKKCNNS  266 (338)
Q Consensus       188 ~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~-~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~N~l~~~~p~~  266 (338)
                       +.+|..+..+++|++|++++|.+++.+|..++.++ +|++|++++|++++.+|..+..++ |++|++++|.+++..|..
T Consensus       139 -~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~  216 (313)
T 1ogq_A          139 -GTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVL  216 (313)
T ss_dssp             -SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGG
T ss_pred             -CcCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHH
Confidence             56788888889999999999998888888888887 888888888888877777777765 777777777777666554


Q ss_pred             CC
Q 019584          267 EA  268 (338)
Q Consensus       267 ~~  268 (338)
                      +.
T Consensus       217 ~~  218 (313)
T 1ogq_A          217 FG  218 (313)
T ss_dssp             CC
T ss_pred             Hh
Confidence            43



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 338
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 67.5 bits (163), Expect = 3e-13
 Identities = 37/126 (29%), Positives = 55/126 (43%), Gaps = 19/126 (15%)

Query: 35  LCHDRERSALLNFKESLVINQTASSYSSTYPKV-ATWKPDEKNKDCC--SWDGVKCNEDT 91
           LC+ +++ ALL  K+ L             P   ++W P     DCC  +W GV C+ DT
Sbjct: 2   LCNPQDKQALLQIKKDL-----------GNPTTLSSWLPTT---DCCNRTWLGVLCDTDT 47

Query: 92  G--HVVELDLASSCLYGSINSTSSLFQLVHLQRLSLFDNNFNFSEIPSAILNFSRLTHLN 149
               V  LDL+   L       SSL  L +L  L +   N     IP AI   ++L +L 
Sbjct: 48  QTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLY 107

Query: 150 LSQSYF 155
           ++ +  
Sbjct: 108 ITHTNV 113


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.6
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.6
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.52
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.52
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.51
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.24
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.19
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.1
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.07
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.0
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.91
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.82
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.78
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.41
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.2
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.79
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=9e-33  Score=250.31  Aligned_cols=215  Identities=27%  Similarity=0.374  Sum_probs=166.6

Q ss_pred             CCCHHHHHHHHHHHHcCccCCCCCCCCCCCCCCCCCCCCCCCCCCc--ccceeEEcCCC--CcEEEEEeCCCCceee--c
Q 019584           35 LCHDRERSALLNFKESLVINQTASSYSSTYPKVATWKPDEKNKDCC--SWDGVKCNEDT--GHVVELDLASSCLYGS--I  108 (338)
Q Consensus        35 ~~~~~e~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~c--~w~gv~c~~~~--~~l~~L~Ls~n~l~~~--~  108 (338)
                      -|.++|++||++||+.+.++.          .+.+|.   .++|||  .|+||+|+...  .+|++|||+++++.|.  +
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~----------~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~l   68 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT----------TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPI   68 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG----------GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEEC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC----------cCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCC
Confidence            599999999999999997643          678998   667899  59999998643  4899999999999874  5


Q ss_pred             CCCCccccCcCccEEEccC-CCCCCCCCchhhhcCCCCcEEEcccccCccccchh------------------------h
Q 019584          109 NSTSSLFQLVHLQRLSLFD-NNFNFSEIPSAILNFSRLTHLNLSQSYFSGQIPAE------------------------L  163 (338)
Q Consensus       109 ~~~~~l~~l~~L~~L~L~~-n~l~~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~------------------------l  163 (338)
                      |.  .++++++|++|+|++ |.+++. +|..+.++++|++|+|++|++.+..+..                        +
T Consensus        69 p~--~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l  145 (313)
T d1ogqa_          69 PS--SLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSI  145 (313)
T ss_dssp             CG--GGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGG
T ss_pred             Ch--HHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhh
Confidence            56  999999999999997 888876 9999999999999999999887654444                        4


Q ss_pred             cCCCCCCEEEccCCCCCcc-c------------ccc---------------------------cCCCcchhhcCCCCCCE
Q 019584          164 LELSNLEVLDLSYSNFDTF-Y------------LKL---------------------------QKPGLANLAENLTNLKA  203 (338)
Q Consensus       164 ~~l~~L~~L~Ls~N~l~~~-~------------l~~---------------------------~~~~~~~~~~~l~~L~~  203 (338)
                      ..++.|+++++++|.+++. +            +..                           ..+.+|..+..+++|+.
T Consensus       146 ~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~  225 (313)
T d1ogqa_         146 SSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQK  225 (313)
T ss_dssp             GGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSE
T ss_pred             ccCcccceeecccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            4455555555555554311 0            000                           00123444556667777


Q ss_pred             EEccCCCCCCCCchhcccCCCCCeeecccccCcccCchhccCCCCCCeeeccCCCCCCcCCCC
Q 019584          204 LDLINVHISSTVPHTLANLSSLRFSSLSGCRLQGEFPQEIFQLPNLQFLGLCGGPLSKKCNNS  266 (338)
Q Consensus       204 L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~N~l~~~~p~~  266 (338)
                      +++++|.+.+.+ +.++.+++|++|+|++|+++|.+|+.+.++++|++|+|++|.++|.+|+.
T Consensus       226 l~~~~~~l~~~~-~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~  287 (313)
T d1ogqa_         226 IHLAKNSLAFDL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG  287 (313)
T ss_dssp             EECCSSEECCBG-GGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS
T ss_pred             cccccccccccc-cccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc
Confidence            777777777644 35677889999999999999999999999999999999999999998853



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure