Citrus Sinensis ID: 019640

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINITEGYTAPSTVSEIMEIDGPSPAGNFIKSSSPVPGATTRKSSSQVERQNSEISYFADDEDGNHKKYSRRGPLRHKFLRALLPFWSSALPTLPVTAPPRKDASNADDATDGRLRHSRPSRTDPRKILLLIAIMACMATMGILYYRLSQRALGERLPDDEEQ
cccccccccccccEEEEEcccccccccccccccEEEEccccccccccccccccccccHHHHcccccccEEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
cccEEEEEcccEEEEEEEccccccEEEccccccEEEHHHHHHHHccccccccccEcccccccccccccEEEEEEEEHccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccHcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
mvvckcrkatklycfvhkvpvcgecicfpehqicvvrTYSEwvidgeydwppkccqcqavleeesgsettrlgCLHVIHTSCLvshiksfpphtapagyvcplcsttiwppknvkdsgSRLHSLLKEAIMLTGLeknlfgnhpvslavaesrgpppafasdpivnvnassspskdginitegytapstvseimeidgpspagnfikssspvpgattrksssqverqnseisyfaddedgnhkkysrrgplrHKFLRALLPfwssalptlpvtapprkdasnaddatdgrlrhsrpsrtdpRKILLLIAIMACMATMGILYYRLSQRalgerlpddeeq
mvvckcrkatklycfvhkVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNassspskdginiTEGYTAPSTVSEIMEIDGPSPAGNFIKSSSPVPgattrksssqverqnseisyfaddedgnhkkysrrgpLRHKFLRALLPFWSSALptlpvtapprkdasnaddatdgrlrhsrpsrtdprkILLLIAIMACMATMGILYYRLSQRALgerlpddeeq
MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINITEGYTAPSTVSEIMEIDGPSPAGNFIKSSSPVPGATTRKSSSQVERQNSEISYFADDEDGNHKKYSRRGPLRHKFLRALLPFWSSALPTLPVTAPPRKDASNADDATDGRLRHSRPSRTDPRKILLLIAIMACMATMGILYYRLSQRALGERLPDDEEQ
*VVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLA******************************************************************************************************LRHKFLRALLPFWSSALPTL********************************KILLLIAIMACMATMGILYYRLSQ*************
*VVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWP********************************************************************************************************************************************RHKFLRALLP******************************************ILLLIAIMACMATMGILYYRL***************
MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVL*********RLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINITEGYTAPSTVSEIMEIDGPSPAGNFIKSS******************NSEISYFADDEDGNHKKYSRRGPLRHKFLRALLPFWSSALPTLPVTAPPRKDASNADDATDGRLRHSRPSRTDPRKILLLIAIMACMATMGILYYRLSQRAL**********
*VVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVS***************************************************************************************FADDEDGNHKKYSRRGPLRHKFLRALLPFWSSALPTLPVT************************RTDPRKILLLIAIMACMATMGILYYRLSQR************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINITEGYTAPSTVSEIMEIDGPSPAGNFIKSSSPVPGATTRKSSSQVERQNSEISYFADDEDGNHKKYSRRGPLRHKFLRALLPFWSSALPTLPVTAPPRKDASNADDATDGRLRHSRPSRTDPRKILLLIAIMACMATMGILYYRLSQRALGERLPDDEEQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query338 2.2.26 [Sep-21-2011]
A8X2R2319 Zinc finger protein-like N/A no 0.671 0.711 0.322 1e-23
Q9N4Y9309 Zinc finger protein-like yes no 0.482 0.527 0.371 6e-21
Q0VFM0320 Zinc finger protein-like yes no 0.319 0.337 0.431 2e-20
A1L2S8320 Zinc finger protein-like N/A no 0.319 0.337 0.431 3e-20
Q2YDD3312 Zinc finger protein-like yes no 0.535 0.580 0.329 8e-20
O95159310 Zinc finger protein-like yes no 0.494 0.538 0.346 2e-19
Q9DB43310 Zinc finger protein-like yes no 0.319 0.348 0.413 8e-19
A7S7Z9252 Zinc finger protein-like N/A no 0.319 0.428 0.405 4e-18
P62447317 Zinc finger protein-like yes no 0.355 0.378 0.366 2e-17
Q16N38290 Zinc finger protein-like N/A no 0.710 0.827 0.282 8e-17
>sp|A8X2R2|ZFPL1_CAEBR Zinc finger protein-like 1 homolog OS=Caenorhabditis briggsae GN=CBG06644 PE=3 SV=1 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 119/257 (46%), Gaps = 30/257 (11%)

Query: 1   MVVCKC--RKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQ 58
           M +CKC  RK T L+C+ H+V VC  C+    H  CVV++Y  W+ D +YD  P C  C 
Sbjct: 1   MGLCKCPKRKVTNLFCYEHRVNVCEFCL-VDNHPNCVVQSYLNWLTDQDYD--PNCSLCH 57

Query: 59  AVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSG 118
             L +    ET RL CLH++H  C      SFPP TAPAGY CP CS  ++PP N     
Sbjct: 58  TTLTQ---GETIRLNCLHLLHWRCFDDWAASFPPTTAPAGYRCPCCSQEVFPPIN---EV 111

Query: 119 SRLHSLLKEAIMLTGLEKNLFG-------NHPVSLAVAESRGPPPAFASDPIVNVNASSS 171
           S L   L+E +  +   +N  G       N PV     ++  P P      + +V+   S
Sbjct: 112 SPLIEKLREQLKQSNWARNALGLPVLPELNRPV-----KNIAPIPPPPPPQVKHVSYDDS 166

Query: 172 PSKDGINITEGYT-APSTVSEIMEIDGPSPAGNFIKSSSPVPGATTRKSSSQVERQNSEI 230
           P++  I I    +  P+T  E+ +        ++  S+S V  A  +  +S+       +
Sbjct: 167 PAQKEIPIHHNRSETPATHLEMED------TASYSVSNSDVTFARKKNFASESSSDTRPL 220

Query: 231 SYFADDEDGNHKKYSRR 247
                D D    KY RR
Sbjct: 221 LRQDRDADNEENKYKRR 237

Caenorhabditis briggsae (taxid: 6238)
>sp|Q9N4Y9|ZFPL1_CAEEL Zinc finger protein-like 1 homolog OS=Caenorhabditis elegans GN=Y45G12B.2 PE=3 SV=1 Back     alignment and function description
>sp|Q0VFM0|ZFPL1_XENTR Zinc finger protein-like 1 OS=Xenopus tropicalis GN=zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|A1L2S8|ZFPL1_XENLA Zinc finger protein-like 1 OS=Xenopus laevis GN=zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|Q2YDD3|ZFPL1_BOVIN Zinc finger protein-like 1 OS=Bos taurus GN=ZFPL1 PE=2 SV=1 Back     alignment and function description
>sp|O95159|ZFPL1_HUMAN Zinc finger protein-like 1 OS=Homo sapiens GN=ZFPL1 PE=1 SV=2 Back     alignment and function description
>sp|Q9DB43|ZFPL1_MOUSE Zinc finger protein-like 1 OS=Mus musculus GN=Zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|A7S7Z9|ZFPL1_NEMVE Zinc finger protein-like 1 homolog OS=Nematostella vectensis GN=zfpl1 PE=3 SV=1 Back     alignment and function description
>sp|P62447|ZFPL1_DANRE Zinc finger protein-like 1 OS=Danio rerio GN=zfpl1 PE=2 SV=1 Back     alignment and function description
>sp|Q16N38|ZFPL1_AEDAE Zinc finger protein-like 1 homolog OS=Aedes aegypti GN=AAEL012105 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
225428977359 PREDICTED: zinc finger protein-like 1 [V 1.0 0.941 0.766 1e-155
358248676337 uncharacterized protein LOC100805734 [Gl 0.988 0.991 0.778 1e-153
357444419339 Zinc finger protein-like protein [Medica 0.982 0.979 0.761 1e-151
363808258338 uncharacterized protein LOC100775639 [Gl 0.988 0.988 0.779 1e-150
224103737330 predicted protein [Populus trichocarpa] 0.967 0.990 0.771 1e-149
224060790325 predicted protein [Populus trichocarpa] 0.949 0.987 0.776 1e-146
449438325359 PREDICTED: zinc finger protein-like 1-li 1.0 0.941 0.703 1e-146
297831956343 hypothetical protein ARALYDRAFT_899703 [ 0.991 0.976 0.710 1e-141
18397649343 RING/U-box domain-containing protein [Ar 0.991 0.976 0.702 1e-140
21593620343 unknown [Arabidopsis thaliana] 0.991 0.976 0.702 1e-140
>gi|225428977|ref|XP_002264651.1| PREDICTED: zinc finger protein-like 1 [Vitis vinifera] gi|296083059|emb|CBI22463.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  555 bits (1429), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 275/359 (76%), Positives = 303/359 (84%), Gaps = 21/359 (5%)

Query: 1   MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAV 60
           MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPP CC CQA 
Sbjct: 1   MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPTCCLCQAA 60

Query: 61  LEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSR 120
           L+E + S+TTRLGCLH+IHT+CLVSHIKSFPPHTAPAGY CP CST+IWPPK+V+DSGSR
Sbjct: 61  LQEGTDSQTTRLGCLHIIHTNCLVSHIKSFPPHTAPAGYACPACSTSIWPPKSVRDSGSR 120

Query: 121 LHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNA-SSSPS--KDGI 177
           LHS LKEAIM TG+EKNLFGNHPVSL   ESR PPPAFASDP+++V+A SSSPS  KD  
Sbjct: 121 LHSKLKEAIMQTGMEKNLFGNHPVSLPAVESRSPPPAFASDPLMHVSATSSSPSIAKDET 180

Query: 178 NITEGY-----TAPS--TVSEIMEIDGPSPAG---------NFIKSSSPV-PGATTRKSS 220
           N T+GY     T PS  +VS+I+EIDGPS AG         NF+KS+SP  PGATTRKS 
Sbjct: 181 NFTDGYSSANGTGPSKLSVSDIVEIDGPSSAGNAQISNHETNFMKSTSPSGPGATTRKSG 240

Query: 221 SQVERQNSEISYFA-DDEDGNHKKYSRRGPLRHKFLRALLPFWSSALPTLPVTAPPRKDA 279
             VERQNSEISY+A DDEDG HKKY+RRGP  HKFLRALLPFWSSALPTLPVTAP RKDA
Sbjct: 241 LYVERQNSEISYYADDDEDGTHKKYTRRGPFHHKFLRALLPFWSSALPTLPVTAPSRKDA 300

Query: 280 SNADDATDGRLRHSRPSRTDPRKILLLIAIMACMATMGILYYRLSQRALGERLPDDEEQ 338
           SNADD  + R RH R SR DPRK+LL+IAIMACMATMGILYYRL+QR LG+ +PDDE+Q
Sbjct: 301 SNADDVLESRPRHQRSSRMDPRKVLLIIAIMACMATMGILYYRLAQRGLGKEMPDDEQQ 359

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|358248676|ref|NP_001240177.1| uncharacterized protein LOC100805734 [Glycine max] gi|255634620|gb|ACU17672.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357444419|ref|XP_003592487.1| Zinc finger protein-like protein [Medicago truncatula] gi|355481535|gb|AES62738.1| Zinc finger protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|363808258|ref|NP_001242749.1| uncharacterized protein LOC100775639 [Glycine max] gi|255642399|gb|ACU21463.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224103737|ref|XP_002313174.1| predicted protein [Populus trichocarpa] gi|222849582|gb|EEE87129.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224060790|ref|XP_002300269.1| predicted protein [Populus trichocarpa] gi|222847527|gb|EEE85074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449438325|ref|XP_004136939.1| PREDICTED: zinc finger protein-like 1-like [Cucumis sativus] gi|449478770|ref|XP_004155414.1| PREDICTED: zinc finger protein-like 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297831956|ref|XP_002883860.1| hypothetical protein ARALYDRAFT_899703 [Arabidopsis lyrata subsp. lyrata] gi|297329700|gb|EFH60119.1| hypothetical protein ARALYDRAFT_899703 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18397649|ref|NP_565365.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|42570775|ref|NP_973461.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|15983470|gb|AAL11603.1|AF424609_1 unknown protein [Arabidopsis thaliana] gi|20197262|gb|AAM15000.1| Expressed protein [Arabidopsis thaliana] gi|330251245|gb|AEC06339.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|330251246|gb|AEC06340.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21593620|gb|AAM65587.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query338
TAIR|locus:505006245343 AT2G14835 [Arabidopsis thalian 0.991 0.976 0.702 3e-133
WB|WBGene00021563309 Y45G12B.2 [Caenorhabditis eleg 0.491 0.537 0.388 4.6e-25
UNIPROTKB|E2RS23312 ZFPL1 "Uncharacterized protein 0.526 0.570 0.348 2e-24
UNIPROTKB|F1RQT4312 ZFPL1 "Uncharacterized protein 0.692 0.75 0.328 8.7e-24
UNIPROTKB|E9PNY1207 ZFPL1 "Zinc finger protein-lik 0.526 0.859 0.343 4.8e-23
UNIPROTKB|E9PQ47188 ZFPL1 "Zinc finger protein-lik 0.526 0.946 0.343 4.8e-23
UNIPROTKB|O95159310 ZFPL1 "Zinc finger protein-lik 0.526 0.574 0.343 4.8e-23
UNIPROTKB|G5E5I4312 ZFPL1 "Zinc finger protein-lik 0.535 0.580 0.335 7.8e-23
UNIPROTKB|Q2YDD3312 ZFPL1 "Zinc finger protein-lik 0.535 0.580 0.335 7.8e-23
ZFIN|ZDB-GENE-040426-1255317 zfpl1 "zinc finger protein-lik 0.355 0.378 0.366 1.8e-22
TAIR|locus:505006245 AT2G14835 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1306 (464.8 bits), Expect = 3.0e-133, P = 3.0e-133
 Identities = 243/346 (70%), Positives = 286/346 (82%)

Query:     1 MVVCKCRKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAV 60
             MVVCKC+KAT+LYCFVHK PVCGECICFPEHQ CVVRTYSEWVIDGEYD  PKCCQCQA 
Sbjct:     1 MVVCKCKKATRLYCFVHKAPVCGECICFPEHQTCVVRTYSEWVIDGEYD-QPKCCQCQAT 59

Query:    61 LEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSR 120
              +E +G + TRLGCLH IHTSCLVS IKSFPPHTAPAGYVCP CST IWPP  VKD+GSR
Sbjct:    60 FDEGAGHQVTRLGCLHAIHTSCLVSLIKSFPPHTAPAGYVCPACSTPIWPPMMVKDAGSR 119

Query:   121 LHSLLKEAIMLTGLEKNLFGNHPVSLAVAESRGPPPAFASDPIVNVNASSSPSKDGINIT 180
             LH+LL+E I  TGLEKNL GNHPVS +  ESR PPPAFASD ++N++ SSS +++G N+ 
Sbjct:   120 LHALLREVITQTGLEKNLLGNHPVSRST-ESRSPPPAFASDALINIS-SSSHTQEGNNLP 177

Query:   181 EGYT-------APSTVSEIMEIDGPSPAGNFIKSSSP-VPGATTRKSSSQVERQNSEISY 232
             +GY+       + S VSEI+EID P+ AG+++KSSSP +  A  RK    V+RQNSE  Y
Sbjct:   178 DGYSVAGNGEYSKSAVSEIVEIDVPASAGSYMKSSSPGLAAAAARKGVPAVDRQNSETLY 237

Query:   233 FADDEDGNHKKYSRRGPLRHKFLRALLPFWSSALPTLPVTAPPRKDASNADDATDGRLRH 292
             +ADDEDGN KKYSRRGPLRHKFLRALLPFWSSALPTLPVTAPPRKDA+ ADD ++GR+RH
Sbjct:   238 YADDEDGNRKKYSRRGPLRHKFLRALLPFWSSALPTLPVTAPPRKDAAKADDGSEGRVRH 297

Query:   293 SRPSRTDPRKILLLIAIMACMATMGILYYRLSQRALGERLPDDEEQ 338
              R S+ D RKIL+ IA++ACMATMGILYYRL+ +A+G+ LPD+E++
Sbjct:   298 QRSSKMDIRKILIFIALIACMATMGILYYRLALQAIGQELPDEEQR 343
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0009737 "response to abscisic acid stimulus" evidence=IDA
GO:0007067 "mitosis" evidence=RCA
WB|WBGene00021563 Y45G12B.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2RS23 ZFPL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQT4 ZFPL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E9PNY1 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PQ47 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O95159 ZFPL1 "Zinc finger protein-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5I4 ZFPL1 "Zinc finger protein-like 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2YDD3 ZFPL1 "Zinc finger protein-like 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1255 zfpl1 "zinc finger protein-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 338
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.26
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.18
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.9
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.85
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.83
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.66
PHA02929238 N1R/p28-like protein; Provisional 98.64
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.52
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.52
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.47
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.37
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.36
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.34
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.29
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.27
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.18
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.18
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.13
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.11
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.02
PF1463444 zf-RING_5: zinc-RING finger domain 98.01
PHA02926242 zinc finger-like protein; Provisional 97.92
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.87
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.82
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.81
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.79
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.75
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 97.73
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.66
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.64
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.63
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.53
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.45
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.35
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.32
KOG1940276 consensus Zn-finger protein [General function pred 97.24
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 97.16
KOG1941518 consensus Acetylcholine receptor-associated protei 97.1
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 96.94
KOG4445368 consensus Uncharacterized conserved protein, conta 96.93
COG52191525 Uncharacterized conserved protein, contains RING Z 96.78
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 96.69
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 96.69
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.61
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.45
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.11
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.02
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.74
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.61
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 95.59
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 95.55
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 95.49
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 95.15
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 94.83
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.6
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 94.53
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 94.47
KOG1002791 consensus Nucleotide excision repair protein RAD16 94.27
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 93.76
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 93.62
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 93.35
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 92.8
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.67
KOG2660331 consensus Locus-specific chromosome binding protei 92.43
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 92.19
PHA02825162 LAP/PHD finger-like protein; Provisional 92.12
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 91.83
PF04641260 Rtf2: Rtf2 RING-finger 91.78
PHA02862156 5L protein; Provisional 91.73
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 90.88
KOG03091081 consensus Conserved WD40 repeat-containing protein 90.47
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 89.86
KOG3039303 consensus Uncharacterized conserved protein [Funct 89.81
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 88.9
KOG0297391 consensus TNF receptor-associated factor [Signal t 87.38
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 87.37
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 86.93
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 86.72
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 86.53
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 86.05
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 85.89
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 84.93
COG5152259 Uncharacterized conserved protein, contains RING a 84.68
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 82.5
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 82.23
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 81.96
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 81.74
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=3.3e-64  Score=465.74  Aligned_cols=219  Identities=33%  Similarity=0.648  Sum_probs=173.5

Q ss_pred             Cccccc--cccccceeeeeecCccCcccccCCCcceeeeecccccccCCCCCCCcccccccccccccCCCeEEecCCCcc
Q 019640            1 MVVCKC--RKATKLYCFVHKVPVCGECICFPEHQICVVRTYSEWVIDGEYDWPPKCCQCQAVLEEESGSETTRLGCLHVI   78 (338)
Q Consensus         1 MglCkC--rk~T~~fCf~HrvnVCe~Civ~~~H~~CvVqsYlqWL~Dsdyd~~~~C~ICle~L~~gD~~evvRL~C~HvF   78 (338)
                      ||||||  |||||+|||||||||||+||| .||++||||||+|||+|+||+  ++|.+|...|..||   ++||.|+|+|
T Consensus         1 MGLCKCPKRkVTNlFCfEHRVNVCEhClV-~nHpkCiVQSYLqWL~DsDY~--pNC~LC~t~La~gd---t~RLvCyhlf   74 (299)
T KOG3970|consen    1 MGLCKCPKRKVTNLFCFEHRVNVCEHCLV-ANHPKCIVQSYLQWLQDSDYN--PNCRLCNTPLASGD---TTRLVCYHLF   74 (299)
T ss_pred             CCcccCchhhhhhhhhhhhhhhHHHHHHh-ccCchhhHHHHHHHHhhcCCC--CCCceeCCccccCc---ceeehhhhhH
Confidence            999999  889999999999999999998 999999999999999999999  99999999999996   9999999999


Q ss_pred             CHHHHHHHHhcCCCCCCCCCCCCCCCCCCccCCCCCCCCcchhHHHHHHHhhhhhhhhhhcCCCCCchhhhccC-CCCCC
Q 019640           79 HTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNVKDSGSRLHSLLKEAIMLTGLEKNLFGNHPVSLAVAESR-GPPPA  157 (338)
Q Consensus        79 H~~CLd~WL~~~p~nTaPagy~CP~Cr~~I~P~~~i~d~~Spl~~~Lre~l~q~~WAr~~lG~~l~~~~~~~~~-~~p~a  157 (338)
                      ||+||++|..++|.||||+||+||.|..+|||+-|.+   |||+++|||+++|+||||++||++||++...... ..||.
T Consensus        75 HW~ClneraA~lPanTAPaGyqCP~Cs~eiFPp~Nlv---sPva~aLre~L~qvNWaRagLGLpll~E~~sp~p~p~~p~  151 (299)
T KOG3970|consen   75 HWKCLNERAANLPANTAPAGYQCPCCSQEIFPPINLV---SPVAEALREQLKQVNWARAGLGLPLLPELNSPVPSPAPPQ  151 (299)
T ss_pred             HHHHhhHHHhhCCCcCCCCcccCCCCCCccCCCcccc---chhHHHHHHHHHhhhHHhhccCCccchhhcCCCCCCCChh
Confidence            9999999999999999999999999999999998875   9999999999999999999999999997433322 46788


Q ss_pred             CCCCcceee--ecCCCCCCCCc--ccCCC-ccCCCCCcceeeecCCCCCCcccccCCCC--CCCcccccchhhhhhcccC
Q 019640          158 FASDPIVNV--NASSSPSKDGI--NITEG-YTAPSTVSEIMEIDGPSPAGNFIKSSSPV--PGATTRKSSSQVERQNSEI  230 (338)
Q Consensus       158 fas~pl~~~--~~~~~~~~~~~--n~~~~-~~~~~~~~~i~~~d~p~~~~~f~~s~s~~--~~a~~RK~~~~~er~~~e~  230 (338)
                      ..|+|...-  ..+...++..+  -..++ .+..++-|+|.-|+          .-+|.  ..|.||+--.  -|     
T Consensus       152 ~~s~~~~~n~~~vh~~~S~~~a~~~~~~~~~~~~sp~h~V~~m~----------~~Np~p~s~a~tR~~l~--~R-----  214 (299)
T KOG3970|consen  152 LKSAPVMHNEVPVHNNRSSTPATHLEMEDTASYSSPNHDVTFMR----------KKNPGPESSADTRPLLQ--LR-----  214 (299)
T ss_pred             hccchhhhcCCCccccCCCCcccccccCCCCCCCCCCCceEeec----------cCCCCccccCCcCcccc--cc-----
Confidence            888875432  22222222222  11222 22233335655555          33332  5566665322  12     


Q ss_pred             CCCCCCcccccccccccCch
Q 019640          231 SYFADDEDGNHKKYSRRGPL  250 (338)
Q Consensus       231 ~~~~~d~d~~~kKy~~r~p~  250 (338)
                         +-|-|+|  ||.||.+.
T Consensus       215 ---~gD~ddn--KY~RRp~~  229 (299)
T KOG3970|consen  215 ---DGDNDDN--KYKRRPTM  229 (299)
T ss_pred             ---CCCcccc--hhhcCChH
Confidence               2345678  99999985

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.33
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.29
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.27
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.26
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.26
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.23
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.22
2ect_A78 Ring finger protein 126; metal binding protein, st 99.18
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.07
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.04
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.01
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.0
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.99
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.96
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.94
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.93
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.93
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.92
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.92
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.88
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.88
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.87
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.87
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.87
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.86
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.85
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.85
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.84
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.82
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.81
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.8
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.78
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.78
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.76
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.74
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.73
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.7
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.68
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.67
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.65
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.6
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.6
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.52
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.47
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.39
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.35
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.33
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.33
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.32
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.25
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.2
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.18
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.17
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.14
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.13
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.1
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.09
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.03
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.0
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.97
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 97.95
2ea5_A68 Cell growth regulator with ring finger domain prot 97.66
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.56
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.45
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.3
3nw0_A238 Non-structural maintenance of chromosomes element 97.16
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.15
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.4
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.55
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.81
1afo_A40 Glycophorin A; integral membrane protein, transmem 83.99
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 81.58
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.33  E-value=1.2e-12  Score=97.95  Aligned_cols=53  Identities=25%  Similarity=0.592  Sum_probs=45.7

Q ss_pred             CcccccccccccccCCCeEEecCCCccCHHHHHHHHhcCCCCCCCCCCCCCCCCCCccCCCCC
Q 019640           52 PKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIWPPKNV  114 (338)
Q Consensus        52 ~~C~ICle~L~~gD~~evvRL~C~HvFH~~CLd~WL~~~p~nTaPagy~CP~Cr~~I~P~~~i  114 (338)
                      ..|+||++.|..++  .++.|+|+|+||..||.+|++...        +||+||++|.+...+
T Consensus        16 ~~C~IC~~~~~~~~--~~~~~~C~H~f~~~Ci~~~~~~~~--------~CP~Cr~~~~~~~~~   68 (74)
T 2ep4_A           16 ELCAVCLEDFKPRD--ELGICPCKHAFHRKCLIKWLEVRK--------VCPLCNMPVLQLAQL   68 (74)
T ss_dssp             CBCSSSCCBCCSSS--CEEEETTTEEEEHHHHHHHHHHCS--------BCTTTCCBCSSCCSC
T ss_pred             CCCcCCCcccCCCC--cEEEcCCCCEecHHHHHHHHHcCC--------cCCCcCccccccccc
Confidence            78999999998875  677789999999999999998742        599999999876544
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1afo_A Glycophorin A; integral membrane protein, transmembrane helix interactions, membrane protein folding; NMR {Homo sapiens} SCOP: j.35.1.1 PDB: 2kpf_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 338
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.003
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 33.7 bits (76), Expect = 0.003
 Identities = 13/57 (22%), Positives = 17/57 (29%), Gaps = 6/57 (10%)

Query: 52  PKCCQCQAVLEEESGSETTRLGCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTI 108
           P C  C   L  E        G L  +H SCL + +             C +C    
Sbjct: 7   PVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTISRNTA------CQICGVVY 57

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query338
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.34
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.28
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.25
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.15
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.14
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.04
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.03
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.96
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.77
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.76
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.7
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.65
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.64
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.63
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.53
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.15
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.65
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.26
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 82.91
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 82.9
d1frea_39 Nuclear factor XNF7 {African clawed frog (Xenopus 82.16
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 81.51
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 81.39
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 81.31
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 80.79
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.34  E-value=2.2e-13  Score=98.27  Aligned_cols=48  Identities=35%  Similarity=0.678  Sum_probs=41.4

Q ss_pred             CcccccccccccccCCCeEEe-cCCCccCHHHHHHHHhcCCCCCCCCCCCCCCCCCCcc
Q 019640           52 PKCCQCQAVLEEESGSETTRL-GCLHVIHTSCLVSHIKSFPPHTAPAGYVCPLCSTTIW  109 (338)
Q Consensus        52 ~~C~ICle~L~~gD~~evvRL-~C~HvFH~~CLd~WL~~~p~nTaPagy~CP~Cr~~I~  109 (338)
                      ..|+||+++|.+++  .+++| .|+|+||.+|+.+|++..        .+||+||++|.
T Consensus         6 ~~C~ICl~~~~~~~--~~~~l~~C~H~Fh~~Ci~~Wl~~~--------~~CP~CR~~i~   54 (55)
T d1iyma_           6 VECAVCLAELEDGE--EARFLPRCGHGFHAECVDMWLGSH--------STCPLCRLTVV   54 (55)
T ss_dssp             CCCTTTCCCCCTTS--CCEECSSSCCEECTTHHHHTTTTC--------CSCSSSCCCSC
T ss_pred             CCCeEECccccCCC--EEEEeCCCCCcccHHHHHHHHHhC--------CcCCCCCCEeE
Confidence            56999999999886  67777 599999999999999864        25999999875
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure