Citrus Sinensis ID: 019679


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKDQVMMSG
ccccHHHHHHHHHHHHHHHHHHcccccHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHccHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccc
ccccHHHHHHHHHcHHHHHHHHcHHHHHHcHHHHHHHHHccccHHHHHHHHccHHHHHHcccccHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHcHHHHHHHHcccccccccHHHHHHHHHHHHHHHcc
MDKSWRVRYMVANQLYELCEavgpeptrsdvvpAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCvkelssdssQHVRSALATVIMGmapilgkdatIEQLLPIFLSLlkdefpdvRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLAsqlgvgffddKLGALCMQWLKDKVYSIRDAAANNVKRLAEefgpdwamqhIVPQVLEMINNPHYLYRMTILQAISLLapvmgseitcsqllpvvinaskdrvpniKFNVAKVLQSLipivdqsvvekSIRPClvelsedpdvdvRFFATQALQSkdqvmmsg
MDKSWRVRYMVANQLYELceavgpeptrsdVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSlipivdqsvvEKSIRPCLVelsedpdvdvRFFATqalqskdqvmmsg
MDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKDQVMMSG
****WRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELS*****HVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFAT*************
MDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKDQVMM**
MDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKE*********RSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQS********
***SWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKDQVMMSG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKDQVMMSG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query337 2.2.26 [Sep-21-2011]
Q38950587 Serine/threonine-protein yes no 0.979 0.562 0.928 0.0
Q38951587 Serine/threonine-protein no no 0.881 0.505 0.913 0.0
P36875395 Protein phosphatase PP2A N/A no 0.997 0.850 0.893 1e-176
Q38845588 Serine/threonine-protein no no 0.851 0.488 0.890 1e-176
Q54QR9584 Serine/threonine-protein yes no 0.961 0.554 0.606 1e-114
Q32PI5589 Serine/threonine-protein yes no 0.967 0.553 0.590 1e-111
P30153589 Serine/threonine-protein yes no 0.967 0.553 0.590 1e-111
P54612589 Serine/threonine-protein yes no 0.967 0.553 0.590 1e-111
Q76MZ3589 Serine/threonine-protein yes no 0.967 0.553 0.590 1e-111
P54613602 Serine/threonine-protein no no 0.967 0.541 0.584 1e-109
>sp|Q38950|2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana GN=PP2AA2 PE=1 SV=2 Back     alignment and function desciption
 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/336 (92%), Positives = 328/336 (97%)

Query: 2   DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRIL 61
           DKSWRVRYMVANQLYELCEAVGPEPTR+++VPAYVRLLRDNEAEVRIAAAGKVTK CRIL
Sbjct: 252 DKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVTKFCRIL 311

Query: 62  NPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEF 121
           NPE+AIQHILPCVKELSSDSSQHVRSALA+VIMGMAP+LGKDATIE LLPIFLSLLKDEF
Sbjct: 312 NPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLSLLKDEF 371

Query: 122 PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVG 181
           PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVG
Sbjct: 372 PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVG 431

Query: 182 FFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLY 241
           FFDDKLGALCMQWL+DKV+SIRDAAANN+KRLAEEFGP+WAMQHIVPQVLEM+NNPHYLY
Sbjct: 432 FFDDKLGALCMQWLQDKVHSIRDAAANNLKRLAEEFGPEWAMQHIVPQVLEMVNNPHYLY 491

Query: 242 RMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVE 301
           RMTIL+A+SLLAPVMGSEITCS+LLPVV+ ASKDRVPNIKFNVAKVLQSLIPIVDQSVVE
Sbjct: 492 RMTILRAVSLLAPVMGSEITCSKLLPVVMTASKDRVPNIKFNVAKVLQSLIPIVDQSVVE 551

Query: 302 KSIRPCLVELSEDPDVDVRFFATQALQSKDQVMMSG 337
           K+IRP LVELSEDPDVDVRFFA QALQS D VMMS 
Sbjct: 552 KTIRPGLVELSEDPDVDVRFFANQALQSIDNVMMSS 587




The A subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. Involved during developmental process such as seedling and floral developments. Seems to act as a negative regulator of PP2A catalytic activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q38951|2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana GN=PP2AA3 PE=1 SV=2 Back     alignment and function description
>sp|P36875|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|Q38845|2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana GN=PP2AA1 PE=1 SV=1 Back     alignment and function description
>sp|Q54QR9|2AAA_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit pppA OS=Dictyostelium discoideum GN=pppA PE=2 SV=1 Back     alignment and function description
>sp|Q32PI5|2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus GN=PPP2R1A PE=1 SV=1 Back     alignment and function description
>sp|P30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens GN=PPP2R1A PE=1 SV=4 Back     alignment and function description
>sp|P54612|2AAA_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Sus scrofa GN=PPP2R1A PE=2 SV=2 Back     alignment and function description
>sp|Q76MZ3|2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus GN=Ppp2r1a PE=1 SV=3 Back     alignment and function description
>sp|P54613|2AAB_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (Fragment) OS=Sus scrofa GN=PPP2R1B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
224115920 587 predicted protein [Populus trichocarpa] 0.878 0.504 0.952 0.0
225455902 587 PREDICTED: serine/threonine-protein phos 0.881 0.505 0.943 0.0
297734191 642 unnamed protein product [Vitis vinifera] 0.881 0.462 0.943 0.0
255541788 587 serine/threonine protein phosphatase 2a 0.765 0.439 0.943 0.0
343172122 576 protein phosphatase 2A subunit A2, parti 0.762 0.446 0.931 0.0
15230896 587 protein phosphatase 2A subunit A2 [Arabi 0.979 0.562 0.928 0.0
297818092 587 hypothetical protein ARALYDRAFT_904748 [ 0.979 0.562 0.931 0.0
255576493 587 serine/threonine protein phosphatase 2a 0.881 0.505 0.931 0.0
449434642 587 PREDICTED: serine/threonine-protein phos 0.881 0.505 0.928 0.0
356520585 587 PREDICTED: serine/threonine-protein phos 0.869 0.499 0.925 0.0
>gi|224115920|ref|XP_002332045.1| predicted protein [Populus trichocarpa] gi|222875342|gb|EEF12473.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/335 (95%), Positives = 331/335 (98%)

Query: 2   DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRIL 61
           DKSWRVRYMVANQLYELCEAVGPEPTRSD+VPAYVRLLRDNEAEVRIAAAGKVTK CRIL
Sbjct: 252 DKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRIL 311

Query: 62  NPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEF 121
           NPE+AIQHILPCVK+LS+DSSQHVRSALA+VIMGMAP+LGKDATIEQLLPIFLSLLKDEF
Sbjct: 312 NPEVAIQHILPCVKDLSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEF 371

Query: 122 PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVG 181
           PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVG
Sbjct: 372 PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVG 431

Query: 182 FFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLY 241
           FFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVL++INNPHYLY
Sbjct: 432 FFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLDLINNPHYLY 491

Query: 242 RMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVE 301
           RMTIL A+SLL+PVMGSEITCSQLLP+VINASKDRVPNIKFNVAKVLQSLIPIVDQSVVE
Sbjct: 492 RMTILHAVSLLSPVMGSEITCSQLLPIVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVE 551

Query: 302 KSIRPCLVELSEDPDVDVRFFATQALQSKDQVMMS 336
           K+IRPCLVELSEDPDVDVRFFATQALQS D VMMS
Sbjct: 552 KTIRPCLVELSEDPDVDVRFFATQALQSSDHVMMS 586




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225455902|ref|XP_002276180.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734191|emb|CBI15438.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255541788|ref|XP_002511958.1| serine/threonine protein phosphatase 2a regulatory subunit A, putative [Ricinus communis] gi|223549138|gb|EEF50627.1| serine/threonine protein phosphatase 2a regulatory subunit A, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|343172122|gb|AEL98765.1| protein phosphatase 2A subunit A2, partial [Silene latifolia] Back     alignment and taxonomy information
>gi|15230896|ref|NP_189208.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana] gi|83287930|sp|Q38950.2|2AAB_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform; Short=AtA beta; Short=PP2A, subunit A, beta isoform gi|7939566|dbj|BAA95767.1| protein phosphotase 2a 65kd regulatory subunit [Arabidopsis thaliana] gi|27311765|gb|AAO00848.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis thaliana] gi|30725386|gb|AAP37715.1| At3g25800 [Arabidopsis thaliana] gi|332643548|gb|AEE77069.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297818092|ref|XP_002876929.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. lyrata] gi|297322767|gb|EFH53188.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255576493|ref|XP_002529138.1| serine/threonine protein phosphatase 2a regulatory subunit A, putative [Ricinus communis] gi|223531417|gb|EEF33251.1| serine/threonine protein phosphatase 2a regulatory subunit A, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449434642|ref|XP_004135105.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform-like [Cucumis sativus] gi|449493464|ref|XP_004159301.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356520585|ref|XP_003528942.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
TAIR|locus:2085994587 PP2AA2 "protein phosphatase 2A 0.994 0.570 0.931 1.5e-163
TAIR|locus:2205354587 PP2AA3 "AT1G13320" [Arabidopsi 0.994 0.570 0.916 1.9e-161
TAIR|locus:2031165588 RCN1 "AT1G25490" [Arabidopsis 0.979 0.561 0.890 7e-157
DICTYBASE|DDB_G0283601584 pppA "protein phosphatase 2A s 0.973 0.561 0.606 2.5e-106
ZFIN|ZDB-GENE-040426-2700589 ppp2r1a "protein phosphatase 2 0.964 0.551 0.604 2.1e-100
UNIPROTKB|A5D973589 PPP2R1A "Alpha isoform of regu 0.967 0.553 0.590 7.1e-100
UNIPROTKB|Q32PI5589 PPP2R1A "Serine/threonine-prot 0.967 0.553 0.590 7.1e-100
UNIPROTKB|P30153589 PPP2R1A "Serine/threonine-prot 0.967 0.553 0.590 1.2e-99
UNIPROTKB|B3KQV6410 PPP2R1A "Serine/threonine-prot 0.967 0.795 0.590 1.2e-99
UNIPROTKB|F1PX75589 PPP2R1A "Uncharacterized prote 0.967 0.553 0.590 1.5e-99
TAIR|locus:2085994 PP2AA2 "protein phosphatase 2A subunit A2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1592 (565.5 bits), Expect = 1.5e-163, P = 1.5e-163
 Identities = 312/335 (93%), Positives = 328/335 (97%)

Query:     2 DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRIL 61
             DKSWRVRYMVANQLYELCEAVGPEPTR+++VPAYVRLLRDNEAEVRIAAAGKVTK CRIL
Sbjct:   252 DKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVTKFCRIL 311

Query:    62 NPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEF 121
             NPE+AIQHILPCVKELSSDSSQHVRSALA+VIMGMAP+LGKDATIE LLPIFLSLLKDEF
Sbjct:   312 NPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLSLLKDEF 371

Query:   122 PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVG 181
             PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVG
Sbjct:   372 PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQLGVG 431

Query:   182 FFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNPHYLY 241
             FFDDKLGALCMQWL+DKV+SIRDAAANN+KRLAEEFGP+WAMQHIVPQVLEM+NNPHYLY
Sbjct:   432 FFDDKLGALCMQWLQDKVHSIRDAAANNLKRLAEEFGPEWAMQHIVPQVLEMVNNPHYLY 491

Query:   242 RMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVE 301
             RMTIL+A+SLLAPVMGSEITCS+LLPVV+ ASKDRVPNIKFNVAKVLQSLIPIVDQSVVE
Sbjct:   492 RMTILRAVSLLAPVMGSEITCSKLLPVVMTASKDRVPNIKFNVAKVLQSLIPIVDQSVVE 551

Query:   302 KSIRPCLVELSEDPDVDVRFFATQALQSKDQVMMS 336
             K+IRP LVELSEDPDVDVRFFA QALQS D VMMS
Sbjct:   552 KTIRPGLVELSEDPDVDVRFFANQALQSIDNVMMS 586


GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0000902 "cell morphogenesis" evidence=RCA
GO:0016049 "cell growth" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
GO:0008601 "protein phosphatase type 2A regulator activity" evidence=ISS
GO:0042325 "regulation of phosphorylation" evidence=ISS
TAIR|locus:2205354 PP2AA3 "AT1G13320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031165 RCN1 "AT1G25490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283601 pppA "protein phosphatase 2A scaffold subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2700 ppp2r1a "protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A5D973 PPP2R1A "Alpha isoform of regulatory subunit A, protein phosphatase 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q32PI5 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P30153 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B3KQV6 PPP2R1A "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PX75 PPP2R1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q389502AAB_ARATHNo assigned EC number0.92850.97920.5621yesno
P368752AAA_PEANo assigned EC number0.89310.99700.8506N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-04
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
 Score = 40.8 bits (96), Expect = 1e-04
 Identities = 20/107 (18%), Positives = 40/107 (37%), Gaps = 6/107 (5%)

Query: 28  RSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPELAI---QHILPCVKELSSDSSQH 84
           ++  +PA V LL  ++  V+  AA  ++ +    N  +        LP + +L     + 
Sbjct: 5   QAGGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKSEDEE 64

Query: 85  VRS-ALATV--IMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNI 128
           V   AL  +  +                +P  ++LL     D++ N 
Sbjct: 65  VVKAALWALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSSNEDIQKNA 111


An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 337
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 100.0
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 99.95
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.94
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.93
PRK09687280 putative lyase; Provisional 99.91
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.91
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.91
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.89
PRK09687280 putative lyase; Provisional 99.88
KOG1242 569 consensus Protein containing adaptin N-terminal re 99.87
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.86
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.84
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.83
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 99.83
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.79
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 99.77
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.77
KOG1242569 consensus Protein containing adaptin N-terminal re 99.75
KOG0212 675 consensus Uncharacterized conserved protein [Funct 99.75
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 99.75
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.75
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.74
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.72
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.71
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 99.71
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 99.69
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.69
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 99.69
KOG1824 1233 consensus TATA-binding protein-interacting protein 99.68
KOG0212 675 consensus Uncharacterized conserved protein [Funct 99.67
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 99.67
PTZ00429 746 beta-adaptin; Provisional 99.66
PTZ00429 746 beta-adaptin; Provisional 99.63
KOG1824 1233 consensus TATA-binding protein-interacting protein 99.61
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.52
COG1413335 FOG: HEAT repeat [Energy production and conversion 99.49
KOG2259 823 consensus Uncharacterized conserved protein [Funct 99.49
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 99.49
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 99.48
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.46
COG1413335 FOG: HEAT repeat [Energy production and conversion 99.46
TIGR02270 410 conserved hypothetical protein. Members are found 99.44
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.43
KOG1243 690 consensus Protein kinase [General function predict 99.42
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 99.41
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.41
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 99.4
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.4
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.4
KOG1243 690 consensus Protein kinase [General function predict 99.39
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 99.38
KOG2259 823 consensus Uncharacterized conserved protein [Funct 99.35
TIGR02270410 conserved hypothetical protein. Members are found 99.33
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 99.31
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 99.27
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 99.19
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 99.16
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 99.1
COG5096 757 Vesicle coat complex, various subunits [Intracellu 99.09
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 99.08
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 99.06
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 99.03
KOG2137 700 consensus Protein kinase [Signal transduction mech 99.02
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 99.02
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 99.01
KOG2032533 consensus Uncharacterized conserved protein [Funct 98.94
KOG2137700 consensus Protein kinase [Signal transduction mech 98.93
COG5096 757 Vesicle coat complex, various subunits [Intracellu 98.92
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 98.91
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.91
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.9
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.9
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.88
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 98.88
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.88
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 98.86
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.84
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.82
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.82
KOG0567289 consensus HEAT repeat-containing protein [General 98.81
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 98.81
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 98.79
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 98.78
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.73
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.72
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 98.7
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 98.68
KOG4653982 consensus Uncharacterized conserved protein [Funct 98.67
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.66
KOG0567289 consensus HEAT repeat-containing protein [General 98.65
PF05804708 KAP: Kinesin-associated protein (KAP) 98.63
KOG2032533 consensus Uncharacterized conserved protein [Funct 98.59
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 98.59
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 98.58
KOG1293 678 consensus Proteins containing armadillo/beta-caten 98.56
KOG2025 892 consensus Chromosome condensation complex Condensi 98.55
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 98.54
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 98.53
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 98.52
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 98.52
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.5
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 98.48
PF05004309 IFRD: Interferon-related developmental regulator ( 98.48
KOG4413 524 consensus 26S proteasome regulatory complex, subun 98.47
KOG2062 929 consensus 26S proteasome regulatory complex, subun 98.46
KOG2025 892 consensus Chromosome condensation complex Condensi 98.46
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.44
KOG2956516 consensus CLIP-associating protein [General functi 98.43
PF05004309 IFRD: Interferon-related developmental regulator ( 98.41
KOG2062 929 consensus 26S proteasome regulatory complex, subun 98.36
KOG4653982 consensus Uncharacterized conserved protein [Funct 98.34
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.34
KOG4535 728 consensus HEAT and armadillo repeat-containing pro 98.33
KOG2956516 consensus CLIP-associating protein [General functi 98.32
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.31
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 98.29
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 98.29
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 98.29
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 98.26
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 98.25
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 98.23
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 98.22
KOG4535728 consensus HEAT and armadillo repeat-containing pro 98.22
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 98.22
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 98.21
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 98.2
PF14500262 MMS19_N: Dos2-interacting transcription regulator 98.2
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 98.19
smart00638574 LPD_N Lipoprotein N-terminal Domain. 98.16
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 98.15
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 98.12
PF14500262 MMS19_N: Dos2-interacting transcription regulator 98.12
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 98.12
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 98.11
PF05804 708 KAP: Kinesin-associated protein (KAP) 98.09
KOG1293 678 consensus Proteins containing armadillo/beta-caten 98.08
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 98.06
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 98.04
KOG0414 1251 consensus Chromosome condensation complex Condensi 97.9
KOG1822 2067 consensus Uncharacterized conserved protein [Funct 97.9
KOG2933334 consensus Uncharacterized conserved protein [Funct 97.89
KOG04141251 consensus Chromosome condensation complex Condensi 97.86
KOG1822 2067 consensus Uncharacterized conserved protein [Funct 97.84
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 97.82
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 97.81
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 97.79
COG5116 926 RPN2 26S proteasome regulatory complex component [ 97.78
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 97.78
KOG1992 960 consensus Nuclear export receptor CSE1/CAS (import 97.77
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.74
COG5116 926 RPN2 26S proteasome regulatory complex component [ 97.73
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 97.72
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 97.71
KOG0413 1529 consensus Uncharacterized conserved protein relate 97.66
KOG2933334 consensus Uncharacterized conserved protein [Funct 97.65
PF13251182 DUF4042: Domain of unknown function (DUF4042) 97.59
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 97.56
KOG1992 960 consensus Nuclear export receptor CSE1/CAS (import 97.52
smart00638574 LPD_N Lipoprotein N-terminal Domain. 97.51
KOG0413 1529 consensus Uncharacterized conserved protein relate 97.45
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 97.38
KOG2011 1048 consensus Sister chromatid cohesion complex Cohesi 97.35
PF1036392 DUF2435: Protein of unknown function (DUF2435) 97.35
COG5098 1128 Chromosome condensation complex Condensin, subunit 97.27
COG50981128 Chromosome condensation complex Condensin, subunit 97.26
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 97.25
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 97.24
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 97.23
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 97.23
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 97.15
KOG2021 980 consensus Nuclear mRNA export factor receptor LOS1 97.14
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 97.11
PF13251182 DUF4042: Domain of unknown function (DUF4042) 97.09
PF12054441 DUF3535: Domain of unknown function (DUF3535); Int 97.09
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 97.09
PF1036392 DUF2435: Protein of unknown function (DUF2435) 97.06
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 97.06
PF04118307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 97.03
KOG2973353 consensus Uncharacterized conserved protein [Funct 96.96
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 96.95
KOG2011 1048 consensus Sister chromatid cohesion complex Cohesi 96.91
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 96.9
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 96.86
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 96.85
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 96.84
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 96.81
PF11864 464 DUF3384: Domain of unknown function (DUF3384); Int 96.76
KOG45241014 consensus Uncharacterized conserved protein [Funct 96.66
COG5656 970 SXM1 Importin, protein involved in nuclear import 96.63
KOG2973353 consensus Uncharacterized conserved protein [Funct 96.6
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 96.6
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 96.57
KOG2081559 consensus Nuclear transport regulator [Intracellul 96.56
KOG1993 978 consensus Nuclear transport receptor KAP120 (impor 96.52
PF08161198 NUC173: NUC173 domain; InterPro: IPR012978 This is 96.51
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 96.51
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 96.41
KOG2549 576 consensus Transcription initiation factor TFIID, s 96.39
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 96.32
KOG2081559 consensus Nuclear transport regulator [Intracellul 96.31
PF0757192 DUF1546: Protein of unknown function (DUF1546); In 96.2
KOG2549 576 consensus Transcription initiation factor TFIID, s 96.17
PF14868559 DUF4487: Domain of unknown function (DUF4487) 96.12
PF05536 543 Neurochondrin: Neurochondrin 96.12
KOG0891 2341 consensus DNA-dependent protein kinase [Replicatio 96.07
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 95.88
PF03378 435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 95.85
PF03378435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 95.84
KOG1993 978 consensus Nuclear transport receptor KAP120 (impor 95.77
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 95.76
KOG2213460 consensus Apoptosis inhibitor 5/fibroblast growth 95.74
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 95.73
KOG0803 1312 consensus Predicted E3 ubiquitin ligase [Posttrans 95.67
PF08167165 RIX1: rRNA processing/ribosome biogenesis 95.66
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 95.63
KOG2149 393 consensus Uncharacterized conserved protein [Funct 95.62
KOG2149 393 consensus Uncharacterized conserved protein [Funct 95.55
PF0757192 DUF1546: Protein of unknown function (DUF1546); In 95.51
PF08167165 RIX1: rRNA processing/ribosome biogenesis 95.48
PF12054 441 DUF3535: Domain of unknown function (DUF3535); Int 95.48
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 95.47
PF11701157 UNC45-central: Myosin-binding striated muscle asse 95.44
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 95.43
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 95.42
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 95.39
KOG45241014 consensus Uncharacterized conserved protein [Funct 95.23
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 95.17
KOG2005 878 consensus 26S proteasome regulatory complex, subun 95.08
KOG0889 3550 consensus Histone acetyltransferase SAGA, TRRAP/TR 95.01
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 94.96
KOG18511710 consensus Uncharacterized conserved protein [Funct 94.91
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 94.91
KOG0803 1312 consensus Predicted E3 ubiquitin ligase [Posttrans 94.88
COG5095450 TAF6 Transcription initiation factor TFIID, subuni 94.78
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 94.71
COG5101 1053 CRM1 Importin beta-related nuclear transport recep 94.68
smart0056730 EZ_HEAT E-Z type HEAT repeats. Present in subunits 94.67
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 94.67
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 94.6
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 94.57
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 94.53
COG5110 881 RPN1 26S proteasome regulatory complex component [ 94.49
PF05536 543 Neurochondrin: Neurochondrin 94.47
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 94.4
COG5095450 TAF6 Transcription initiation factor TFIID, subuni 94.39
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 94.36
KOG18511710 consensus Uncharacterized conserved protein [Funct 94.31
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 94.26
PF08161198 NUC173: NUC173 domain; InterPro: IPR012978 This is 94.26
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 94.2
PF11701157 UNC45-central: Myosin-binding striated muscle asse 94.11
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 94.1
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 94.06
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 93.89
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 93.67
KOG2022 982 consensus Nuclear transport receptor LGL2 (importi 93.6
cd03561133 VHS VHS domain family; The VHS domain is present i 93.4
COG5537 740 IRR1 Cohesin [Cell division and chromosome partiti 93.38
KOG1848 1610 consensus Uncharacterized conserved protein [Funct 93.38
COG5656 970 SXM1 Importin, protein involved in nuclear import 93.36
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 93.17
KOG2213 460 consensus Apoptosis inhibitor 5/fibroblast growth 93.01
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 93.01
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 92.95
KOG2005 878 consensus 26S proteasome regulatory complex, subun 92.95
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 92.91
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 92.79
cd03561133 VHS VHS domain family; The VHS domain is present i 92.79
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 92.56
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 92.4
PF04118 307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 91.98
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 91.86
COG5110 881 RPN1 26S proteasome regulatory complex component [ 91.68
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 91.32
PF12397121 U3snoRNP10: U3 small nucleolar RNA-associated prot 91.26
KOG1848 1610 consensus Uncharacterized conserved protein [Funct 91.01
KOG0891 2341 consensus DNA-dependent protein kinase [Replicatio 90.95
smart0056730 EZ_HEAT E-Z type HEAT repeats. Present in subunits 90.89
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 90.81
COG5234 993 CIN1 Beta-tubulin folding cofactor D [Posttranslat 90.74
KOG3678 832 consensus SARM protein (with sterile alpha and arm 90.71
PF12397121 U3snoRNP10: U3 small nucleolar RNA-associated prot 90.53
KOG0889 3550 consensus Histone acetyltransferase SAGA, TRRAP/TR 90.42
PF11935239 DUF3453: Domain of unknown function (DUF3453); Int 90.42
PF07539141 DRIM: Down-regulated in metastasis; InterPro: IPR0 90.23
COG5537 740 IRR1 Cohesin [Cell division and chromosome partiti 90.1
KOG1048717 consensus Neural adherens junction protein Plakoph 90.04
cd06561197 AlkD_like A new structural DNA glycosylase. This d 89.68
KOG2022 982 consensus Nuclear transport receptor LGL2 (importi 89.43
KOG2153 704 consensus Protein involved in the nuclear export o 89.42
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 89.39
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 89.31
PF0313027 HEAT_PBS: PBS lyase HEAT-like repeat; InterPro: IP 89.18
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 88.76
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 88.47
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 88.43
cd06561197 AlkD_like A new structural DNA glycosylase. This d 88.41
PF08767319 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 88.03
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 87.9
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 87.78
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 87.69
PF0932486 DUF1981: Domain of unknown function (DUF1981); Int 87.0
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 86.79
COG5369 743 Uncharacterized conserved protein [Function unknow 86.78
KOG2199 462 consensus Signal transducing adaptor protein STAM/ 86.58
KOG2021 980 consensus Nuclear mRNA export factor receptor LOS1 86.48
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 86.44
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 86.21
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 85.86
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 85.55
PF0932486 DUF1981: Domain of unknown function (DUF1981); Int 85.37
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 84.62
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 83.95
KOG2229 616 consensus Protein required for actin cytoskeleton 83.73
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 83.62
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 83.6
KOG1087 470 consensus Cytosolic sorting protein GGA2/TOM1 [Int 83.18
KOG2038 988 consensus CAATT-binding transcription factor/60S r 82.83
KOG18371621 consensus Uncharacterized conserved protein [Funct 82.75
KOG2038 988 consensus CAATT-binding transcription factor/60S r 82.52
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 82.51
cd07064208 AlkD_like_1 A new structural DNA glycosylase conta 82.23
PF12612193 TFCD_C: Tubulin folding cofactor D C terminal; Int 81.71
COG5369 743 Uncharacterized conserved protein [Function unknow 81.65
COG5234 993 CIN1 Beta-tubulin folding cofactor D [Posttranslat 81.55
cd03565141 VHS_Tom1 VHS domain family, Tom1 subfamily; The VH 81.46
PF07539141 DRIM: Down-regulated in metastasis; InterPro: IPR0 81.07
cd03565141 VHS_Tom1 VHS domain family, Tom1 subfamily; The VH 80.98
KOG3961262 consensus Uncharacterized conserved protein [Funct 80.4
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=6.7e-32  Score=242.08  Aligned_cols=333  Identities=53%  Similarity=0.800  Sum_probs=314.9

Q ss_pred             CCChHHHHHHHHHHHHHHHHhCCCCcccchHHHHHHhcCCChHHHHHHHHHhHHHHHHhhC----HHHHHHhhhHhhHHh
Q 019679            2 DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILN----PELAIQHILPCVKEL   77 (337)
Q Consensus         2 D~~~~vR~~~~~~l~~~~~~~~~~~~~~~l~~~l~~~~~d~~~~vR~~a~~~l~~~~~~~~----~~~~~~~ll~~l~~l   77 (337)
                      |++|++|+++++....+...+|++..+.++.|.+..++.|+.+++|.+.+.-...+....+    +....+.++|.++.+
T Consensus       327 d~~~~v~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~l~~~~~~e~r~a~a~~~~~l~~~l~~~~~~~i~~~~ilp~~~~l  406 (759)
T KOG0211|consen  327 DGSWRVSYMVADKFSELSSAVGPSATRTQLVPPVSNLLKDEEWEVRYAIAKKVQKLACYLNASCYPNIPDSSILPEVQVL  406 (759)
T ss_pred             ChhHHHHHHHhhhhhhHHHHhccccCcccchhhHHHHhcchhhhhhHHhhcchHHHhhhcCcccccccchhhhhHHHHHH
Confidence            7899999999999999999999988899999999999999999999999999999999887    444556788999999


Q ss_pred             cCCCcHHHHHHHHHHHHhcCcccChhhHHhhhHHHHHHhhcCCChhHHHHHH---HhHHHhHhhhchhhHHhhHHHHHHH
Q 019679           78 SSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNII---SKLDQVNQVIGIDLLSQSLLPAIVE  154 (337)
Q Consensus        78 ~~d~~~~vr~~a~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~---~~l~~l~~~~~~~~~~~~llp~l~~  154 (337)
                      +.|.+..||.+.+..+..+...+|.+.....+.|.+...++|..+.||.+..   ..+..+....|.+...+..+|.+..
T Consensus       407 v~d~~~~vr~a~a~~~~~~~p~~~k~~ti~~llp~~~~~l~de~~~V~lnli~~ls~~~~v~~v~g~~~~s~slLp~i~e  486 (759)
T KOG0211|consen  407 VLDNALHVRSALASVITGLSPILPKERTISELLPLLIGNLKDEDPIVRLNLIDKLSLLEEVNDVIGISTVSNSLLPAIVE  486 (759)
T ss_pred             HhcccchHHHHHhccccccCccCCcCcCccccChhhhhhcchhhHHHHHhhHHHHHHHHhccCcccchhhhhhhhhhhhh
Confidence            9999999999999999999999998888899999999999999999999999   5666666777888888999999999


Q ss_pred             HhcCCchHHHHHHHHHhhHhHhhhChhhHHHHHHHHHHHHccccchHHHHHHHHHHHHHHHHhChHHHHhhHHHHHHHhh
Q 019679          155 LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMI  234 (337)
Q Consensus       155 ~~~d~~~~vr~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~~~~~~~~~~~~~~l~~~l~~~~  234 (337)
                      +..|..|++|.+..+.+..++...|.+.+.+.+-+.+..++.|...++|++|+..+..++..+|.+|..+.++|.+..+.
T Consensus       487 l~~d~~wRvr~ail~~ip~la~q~~~~~~~~~~~~l~~~~l~d~v~~Ir~~aa~~l~~l~~~~G~~w~~~~~i~k~L~~~  566 (759)
T KOG0211|consen  487 LAEDLLWRVRLAILEYIPQLALQLGVEFFDEKLAELLRTWLPDHVYSIREAAARNLPALVETFGSEWARLEEIPKLLAMD  566 (759)
T ss_pred             hccchhHHHHHHHHHHHHHHHHhhhhHHhhHHHHHHHHhhhhhhHHHHHHHHHHHhHHHHHHhCcchhHHHhhHHHHHHh
Confidence            99999999999999999999999999899999999999999999999999999999999999999999999999999999


Q ss_pred             cCcchHHHHHHHHHHHHhccccChHHHHhhHHHHHHhhccCCChhHHHHHHHHHHHHhhhhcHHHHHHhhhHHHHhhhCC
Q 019679          235 NNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSED  314 (337)
Q Consensus       235 ~~~~~~vR~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~i~~~~~~~~~~~~i~~~l~~l~~d  314 (337)
                      .+++|.+|.+.+.++..+++.+|.+.+..+++|.+..+..|+.++||.++++.|..+.+.+......+.+.|++..+..|
T Consensus       567 ~q~~y~~R~t~l~si~~la~v~g~ei~~~~Llp~~~~l~~D~vanVR~nvak~L~~i~~~L~~~~~~~~v~pll~~L~~d  646 (759)
T KOG0211|consen  567 LQDNYLVRMTTLFSIHELAEVLGQEITCEDLLPVFLDLVKDPVANVRINVAKHLPKILKLLDESVRDEEVLPLLETLSSD  646 (759)
T ss_pred             cCcccchhhHHHHHHHHHHHHhccHHHHHHHhHHHHHhccCCchhhhhhHHHHHHHHHhhcchHHHHHHHHHHHHHhccC
Confidence            99999999999999999999999999999999999999999999999999999999999999998899999999999999


Q ss_pred             CCccHHHHHHHHHHHHHHhh
Q 019679          315 PDVDVRFFATQALQSKDQVM  334 (337)
Q Consensus       315 ~~~~vr~~a~~al~~l~~~~  334 (337)
                      ++.+||+.|..|++.+....
T Consensus       647 ~~~dvr~~a~~a~~~i~l~~  666 (759)
T KOG0211|consen  647 QELDVRYRAILAFGSIELSR  666 (759)
T ss_pred             cccchhHHHHHHHHHHHHHH
Confidence            99999999999999987654



>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1822 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1822 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG2011 consensus Sister chromatid cohesion complex Cohesin, subunit STAG/IRR1/SCC3 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>KOG2021 consensus Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF12054 DUF3535: Domain of unknown function (DUF3535); InterPro: IPR022707 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG2011 consensus Sister chromatid cohesion complex Cohesin, subunit STAG/IRR1/SCC3 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>KOG4524 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2081 consensus Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08161 NUC173: NUC173 domain; InterPro: IPR012978 This is the central domain of a novel family of hypothetical nucleolar proteins [] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG2081 consensus Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6) Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF14868 DUF4487: Domain of unknown function (DUF4487) Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG2213 consensus Apoptosis inhibitor 5/fibroblast growth factor 2-interacting factor 2, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG0803 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG2149 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2149 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6) Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF12054 DUF3535: Domain of unknown function (DUF3535); InterPro: IPR022707 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>KOG4524 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2005 consensus 26S proteasome regulatory complex, subunit RPN1/PSMD2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1851 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>KOG0803 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>COG5101 CRM1 Importin beta-related nuclear transport receptor [Nuclear structure / Intracellular trafficking and secretion] Back     alignment and domain information
>smart00567 EZ_HEAT E-Z type HEAT repeats Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>COG5110 RPN1 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG1851 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08161 NUC173: NUC173 domain; InterPro: IPR012978 This is the central domain of a novel family of hypothetical nucleolar proteins [] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>COG5537 IRR1 Cohesin [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1848 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>KOG2213 consensus Apoptosis inhibitor 5/fibroblast growth factor 2-interacting factor 2, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>KOG2005 consensus 26S proteasome regulatory complex, subunit RPN1/PSMD2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>COG5110 RPN1 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>PF12397 U3snoRNP10: U3 small nucleolar RNA-associated protein 10 ; InterPro: IPR022125 This domain family is found in eukaryotes, and is approximately 120 amino acids in length Back     alignment and domain information
>KOG1848 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair] Back     alignment and domain information
>smart00567 EZ_HEAT E-Z type HEAT repeats Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>COG5234 CIN1 Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones / Cytoskeleton] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PF12397 U3snoRNP10: U3 small nucleolar RNA-associated protein 10 ; InterPro: IPR022125 This domain family is found in eukaryotes, and is approximately 120 amino acids in length Back     alignment and domain information
>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11935 DUF3453: Domain of unknown function (DUF3453); InterPro: IPR021850 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF07539 DRIM: Down-regulated in metastasis; InterPro: IPR011430 These eukaryotic proteins include DRIM (Down-Regulated In Metastasis) (O75691 from SWISSPROT), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells [] Back     alignment and domain information
>COG5537 IRR1 Cohesin [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>cd06561 AlkD_like A new structural DNA glycosylase Back     alignment and domain information
>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2153 consensus Protein involved in the nuclear export of pre-ribosomes [Translation, ribosomal structure and biogenesis; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03130 HEAT_PBS: PBS lyase HEAT-like repeat; InterPro: IPR004155 These proteins contain a short bi-helical repeat that is related to HEAT Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>cd06561 AlkD_like A new structural DNA glycosylase Back     alignment and domain information
>PF08767 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES) Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF09324 DUF1981: Domain of unknown function (DUF1981); InterPro: IPR015403 This domain is functionally uncharacterised and found in various plant and yeast protein transport proteins Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2199 consensus Signal transducing adaptor protein STAM/STAM2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2021 consensus Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF09324 DUF1981: Domain of unknown function (DUF1981); InterPro: IPR015403 This domain is functionally uncharacterised and found in various plant and yeast protein transport proteins Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>KOG2229 consensus Protein required for actin cytoskeleton organization and cell cycle progression [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>KOG1087 consensus Cytosolic sorting protein GGA2/TOM1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2038 consensus CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis; Transcription] Back     alignment and domain information
>KOG1837 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2038 consensus CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis; Transcription] Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>cd07064 AlkD_like_1 A new structural DNA glycosylase containing HEAT-like repeats Back     alignment and domain information
>PF12612 TFCD_C: Tubulin folding cofactor D C terminal; InterPro: IPR022577 This region is found in eukaryotes, and is typically between 182 and 199 amino acids in length Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5234 CIN1 Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones / Cytoskeleton] Back     alignment and domain information
>cd03565 VHS_Tom1 VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein Back     alignment and domain information
>PF07539 DRIM: Down-regulated in metastasis; InterPro: IPR011430 These eukaryotic proteins include DRIM (Down-Regulated In Metastasis) (O75691 from SWISSPROT), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells [] Back     alignment and domain information
>cd03565 VHS_Tom1 VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein Back     alignment and domain information
>KOG3961 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
2ie3_A589 Structure Of The Protein Phosphatase 2a Core Enzyme 1e-112
2ie3_A 589 Structure Of The Protein Phosphatase 2a Core Enzyme 3e-06
1b3u_A588 Crystal Structure Of Constant Regulatory Domain Of 1e-112
1b3u_A 588 Crystal Structure Of Constant Regulatory Domain Of 3e-06
2iae_A589 Crystal Structure Of A Protein Phosphatase 2a (Pp2a 1e-112
2iae_A 589 Crystal Structure Of A Protein Phosphatase 2a (Pp2a 3e-06
3fga_A588 Structural Basis Of Pp2a And Sgo Interaction Length 1e-112
3fga_A 588 Structural Basis Of Pp2a And Sgo Interaction Length 3e-06
3dw8_A582 Structure Of A Protein Phosphatase 2a Holoenzyme Wi 1e-112
3dw8_A 582 Structure Of A Protein Phosphatase 2a Holoenzyme Wi 4e-06
2pkg_A580 Structure Of A Complex Between The A Subunit Of Pro 1e-112
2pkg_A 580 Structure Of A Complex Between The A Subunit Of Pro 4e-06
2nyl_A582 Crystal Structure Of Protein Phosphatase 2a (Pp2a) 1e-107
2nyl_A 582 Crystal Structure Of Protein Phosphatase 2a (Pp2a) 2e-06
3c5w_A232 Complex Between Pp2a-Specific Methylesterase Pme-1 8e-64
>pdb|2IE3|A Chain A, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 589 Back     alignment and structure

Iteration: 1

Score = 401 bits (1030), Expect = e-112, Method: Compositional matrix adjust. Identities = 195/330 (59%), Positives = 257/330 (77%), Gaps = 4/330 (1%) Query: 2 DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRIL 61 DKSWRVRYMVA++ EL +AVGPE T++D+VPA+ L++D EAEVR AA+ KV + C L Sbjct: 254 DKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENL 313 Query: 62 NPE----LAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLL 117 + + + + ILPC+KEL SD++QHV+SALA+VIMG++PILGKD TIE LLP+FL+ L Sbjct: 314 SADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQL 373 Query: 118 KDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQ 177 KDE P+VRLNIIS LD VN+VIGI LSQSLLPAIVELAED WRVRLAIIEY+PLLA Q Sbjct: 374 KDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQ 433 Query: 178 LGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNP 237 LGV FFD+KL +LCM WL D VY+IR+AA +N+K+L E+FG +WA I+P+VL M +P Sbjct: 434 LGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDP 493 Query: 238 HYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQ 297 +YL+RMT L I++L+ V G +IT +LP V+ + D V N++FNVAK LQ + PI+D Sbjct: 494 NYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDN 553 Query: 298 SVVEKSIRPCLVELSEDPDVDVRFFATQAL 327 S ++ ++P L +L++D DVDV++FA +AL Sbjct: 554 STLQSEVKPILEKLTQDQDVDVKYFAQEAL 583
>pdb|2IE3|A Chain A, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 589 Back     alignment and structure
>pdb|1B3U|A Chain A, Crystal Structure Of Constant Regulatory Domain Of Human Pp2a, Pr65alpha Length = 588 Back     alignment and structure
>pdb|1B3U|A Chain A, Crystal Structure Of Constant Regulatory Domain Of Human Pp2a, Pr65alpha Length = 588 Back     alignment and structure
>pdb|2IAE|A Chain A, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 589 Back     alignment and structure
>pdb|2IAE|A Chain A, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 589 Back     alignment and structure
>pdb|3FGA|A Chain A, Structural Basis Of Pp2a And Sgo Interaction Length = 588 Back     alignment and structure
>pdb|3FGA|A Chain A, Structural Basis Of Pp2a And Sgo Interaction Length = 588 Back     alignment and structure
>pdb|3DW8|A Chain A, Structure Of A Protein Phosphatase 2a Holoenzyme With B55 Subunit Length = 582 Back     alignment and structure
>pdb|3DW8|A Chain A, Structure Of A Protein Phosphatase 2a Holoenzyme With B55 Subunit Length = 582 Back     alignment and structure
>pdb|2PKG|A Chain A, Structure Of A Complex Between The A Subunit Of Protein Phosphatase 2a And The Small T Antigen Of Sv40 Length = 580 Back     alignment and structure
>pdb|2PKG|A Chain A, Structure Of A Complex Between The A Subunit Of Protein Phosphatase 2a And The Small T Antigen Of Sv40 Length = 580 Back     alignment and structure
>pdb|2NYL|A Chain A, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 582 Back     alignment and structure
>pdb|2NYL|A Chain A, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 582 Back     alignment and structure
>pdb|3C5W|A Chain A, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 232 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 1e-110
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 4e-53
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 6e-45
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 3e-41
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 2e-38
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 6e-37
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 3e-07
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 5e-19
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 7e-15
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 1e-18
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 2e-09
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 1e-07
2db0_A253 253AA long hypothetical protein; heat repeats, hel 3e-14
2db0_A253 253AA long hypothetical protein; heat repeats, hel 2e-09
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 6e-12
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-11
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-07
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 1e-10
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 9e-10
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 3e-05
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 3e-05
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 8e-04
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-09
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 2e-08
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 2e-07
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-09
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 8e-08
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 1e-07
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 2e-09
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 3e-07
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 7e-08
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 5e-05
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 1e-07
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 8e-05
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 3e-07
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 9e-06
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 8e-06
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 1e-05
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 3e-05
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 8e-05
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-04
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 8e-05
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-04
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-04
1qgr_A 876 Protein (importin beta subunit); transport recepto 2e-04
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 3e-04
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 5e-04
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 5e-04
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 7e-04
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
 Score =  331 bits (850), Expect = e-110
 Identities = 195/332 (58%), Positives = 256/332 (77%), Gaps = 4/332 (1%)

Query: 2   DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRIL 61
           DKSWRVRYMVA++  EL +AVGPE T++D+VPA+  L++D EAEVR AA+ KV + C  L
Sbjct: 253 DKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENL 312

Query: 62  NPELA----IQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLL 117
           + +      +  ILPC+KEL SD++QHV+SALA+VIMG++PILGKD TIE LLP+FL+ L
Sbjct: 313 SADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQL 372

Query: 118 KDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLASQ 177
           KDE P+VRLNIIS LD VN+VIGI  LSQSLLPAIVELAED  WRVRLAIIEY+PLLA Q
Sbjct: 373 KDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQ 432

Query: 178 LGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNP 237
           LGV FFD+KL +LCM WL D VY+IR+AA +N+K+L E+FG +WA   I+P+VL M  +P
Sbjct: 433 LGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDP 492

Query: 238 HYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQ 297
           +YL+RMT L  I++L+ V G +IT   +LP V+  + D V N++FNVAK LQ + PI+D 
Sbjct: 493 NYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDN 552

Query: 298 SVVEKSIRPCLVELSEDPDVDVRFFATQALQS 329
           S ++  ++P L +L++D DVDV++FA +AL  
Sbjct: 553 STLQSEVKPILEKLTQDQDVDVKYFAQEALTV 584


>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Length = 244 Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Length = 244 Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Length = 244 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Length = 249 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Length = 249 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Length = 618 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Length = 507 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Length = 800 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Length = 462 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Length = 266 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 100.0
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 100.0
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.97
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.95
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.95
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.95
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.95
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.95
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.94
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.94
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.94
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.93
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.93
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.92
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.91
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.91
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.9
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.87
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.87
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.85
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.85
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.83
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.82
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.82
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.81
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.8
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.8
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.8
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.8
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.79
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.79
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.79
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.79
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.78
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.78
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.78
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.78
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.77
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.77
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.77
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.77
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.72
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.71
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 99.71
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.71
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.71
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.69
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.69
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.69
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.68
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.68
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.65
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.64
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.63
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 99.62
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 99.6
3nmz_A458 APC variant protein; protein-protein complex, arma 99.59
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.58
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 99.57
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.57
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 99.56
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.54
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.53
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 99.51
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 99.47
3nmz_A458 APC variant protein; protein-protein complex, arma 99.46
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.45
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 99.44
2x19_B 963 Importin-13; nuclear transport, protein transport; 99.44
2x1g_F 971 Cadmus; transport protein, developmental protein, 99.44
2x1g_F 971 Cadmus; transport protein, developmental protein, 99.44
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 99.4
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.38
2db0_A253 253AA long hypothetical protein; heat repeats, hel 99.38
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 99.38
2x19_B 963 Importin-13; nuclear transport, protein transport; 99.36
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.36
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.35
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 99.33
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 99.33
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 99.32
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 99.32
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 99.31
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 99.31
2db0_A253 253AA long hypothetical protein; heat repeats, hel 99.3
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 99.3
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.29
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.27
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.27
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 99.23
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 99.22
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 99.21
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 99.18
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 99.18
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 99.17
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 99.09
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 99.09
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 98.95
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 98.84
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 98.69
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 98.63
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 98.51
3grl_A 651 General vesicular transport factor P115; vesicle t 98.47
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 98.45
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 98.39
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 98.33
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 98.26
3grl_A 651 General vesicular transport factor P115; vesicle t 98.1
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 97.91
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 97.87
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 97.71
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 97.56
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.53
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.51
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 97.36
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 97.36
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 97.17
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 97.14
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 97.07
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 95.0
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 94.91
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 94.15
2b6c_A220 Hypothetical protein EF3068; structural genomis, D 93.91
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 93.54
2b6c_A220 Hypothetical protein EF3068; structural genomis, D 93.48
3g2s_A149 C-terminal fragment of sortilin-related receptor; 92.46
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 92.14
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 91.87
3jxy_A232 Alkylpurine DNA glycosylase ALKD; heat repeat, DNA 90.99
3jxy_A232 Alkylpurine DNA glycosylase ALKD; heat repeat, DNA 89.89
1elk_A157 Target of MYB1; superhelix of helices, endocytosis 89.34
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 89.24
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 89.02
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 87.75
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 86.89
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 85.52
3g2s_A149 C-terminal fragment of sortilin-related receptor; 85.44
1vsy_4 799 Proteasome activator BLM10; 20S proteasome BLM10, 84.94
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 82.99
3ut4_A134 CTHE_2751, putative uncharacterized protein; non P 81.95
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
Probab=100.00  E-value=2e-41  Score=310.89  Aligned_cols=331  Identities=59%  Similarity=0.977  Sum_probs=308.4

Q ss_pred             CCChHHHHHHHHHHHHHHHHhCCCCcccchHHHHHHhcCCChHHHHHHHHHhHHHHHHhhCHH----HHHHhhhHhhHHh
Q 019679            2 DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPE----LAIQHILPCVKEL   77 (337)
Q Consensus         2 D~~~~vR~~~~~~l~~~~~~~~~~~~~~~l~~~l~~~~~d~~~~vR~~a~~~l~~~~~~~~~~----~~~~~ll~~l~~l   77 (337)
                      |++|.||+.++++++.++..++++...+.++|.+.+++.|+++.||..++.+++.+++.++++    .+.+.++|.+..+
T Consensus       253 d~~~~vR~~a~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~~~~~~~~~~~~~~~~~~l~p~l~~~  332 (588)
T 1b3u_A          253 DKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKEL  332 (588)
T ss_dssp             CSSHHHHHHHHHTHHHHHHHHCHHHHHHTHHHHHHHHHTCSSHHHHHHHHHHHHHHHHTSCTTTHHHHHHHTHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHhCcccchhHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHhChhhhhhHHHHHHHHHHHHH
Confidence            789999999999999999988876666789999999999999999999999999999988765    4567899999999


Q ss_pred             cCCCcHHHHHHHHHHHHhcCcccChhhHHhhhHHHHHHhhcCCChhHHHHHHHhHHHhHhhhchhhHHhhHHHHHHHHhc
Q 019679           78 SSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAE  157 (337)
Q Consensus        78 ~~d~~~~vr~~a~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~l~~~~~~~~~~~~llp~l~~~~~  157 (337)
                      ++|++|.||..++.+++.++..+|++.....++|.+..+++|++++||..++.+++.+.+..+.+...+.++|.+.+..+
T Consensus       333 l~d~~~~vR~~a~~~l~~l~~~~~~~~~~~~l~p~l~~~l~d~~~~Vr~~a~~~l~~l~~~~~~~~~~~~~lp~l~~~~~  412 (588)
T 1b3u_A          333 VSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAE  412 (588)
T ss_dssp             HTCSCHHHHHHHHTTGGGGHHHHCHHHHHHHTHHHHHHHHTCSCHHHHHHHHTTCHHHHHHSCHHHHHHHHHHHHHHHHT
T ss_pred             hcCCCHHHHHHHHHHHHHHHHHhhHhHHHHHHHHHHHHHhCCCchHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHhc
Confidence            99999999999999999999999987767889999999999999999999999999999998887777889999999999


Q ss_pred             CCchHHHHHHHHHhhHhHhhhChhhHHHHHHHHHHHHccccchHHHHHHHHHHHHHHHHhChHHHHhhHHHHHHHhhcCc
Q 019679          158 DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNP  237 (337)
Q Consensus       158 d~~~~vr~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~~~~~~~~~~~~~~l~~~l~~~~~~~  237 (337)
                      |++|++|..++..++.++..+|.+.+.+.++|.+..+++|+++.||+.|+.+++.+...+|.+++.+.++|.+..+..++
T Consensus       413 d~~~~vr~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~Vr~~a~~~l~~l~~~~~~~~~~~~llp~l~~~~~~~  492 (588)
T 1b3u_A          413 DAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDP  492 (588)
T ss_dssp             CSSHHHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHHGGGCSSHHHHHHHHHHHHHHHHHHCHHHHHHHTHHHHHHTTTCS
T ss_pred             CCCchHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHHhCchhHHHHHHHHHHHHhhCC
Confidence            99999999999999999999998877788999999999999999999999999999999998877788999999999999


Q ss_pred             chHHHHHHHHHHHHhccccChHHHHhhHHHHHHhhccCCChhHHHHHHHHHHHHhhhhcHHHHHHhhhHHHHhhhCCCCc
Q 019679          238 HYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDV  317 (337)
Q Consensus       238 ~~~vR~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~i~~~~~~~~~~~~i~~~l~~l~~d~~~  317 (337)
                      +|.+|.+++.+++.++..+|.+.+.+.++|.+...+.|++++||.+++++|+.+.+.+|.+...+.+.|.|..+.+|+++
T Consensus       493 ~~~~R~~a~~~l~~l~~~~~~~~~~~~~~~~l~~~l~d~~~~Vr~~a~~~l~~l~~~~~~~~~~~~~~p~l~~l~~d~d~  572 (588)
T 1b3u_A          493 NYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDV  572 (588)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHGGGCSCHHHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHTTCSSH
T ss_pred             CHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhCCCCCchHHHHHHHHHHHHHHHhchhhhHHHHHHHHHHHcCCCch
Confidence            99999999999999999998888889999999999999999999999999999999999887778999999999999999


Q ss_pred             cHHHHHHHHHHHHHH
Q 019679          318 DVRFFATQALQSKDQ  332 (337)
Q Consensus       318 ~vr~~a~~al~~l~~  332 (337)
                      +||..|+++++.+..
T Consensus       573 ~vr~~a~~al~~l~~  587 (588)
T 1b3u_A          573 DVKYFAQEALTVLSL  587 (588)
T ss_dssp             HHHHHHHHHHHHTTC
T ss_pred             hHHHHHHHHHHHhhc
Confidence            999999999998753



>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>2b6c_A Hypothetical protein EF3068; structural genomis, DNA repair enzyme, structural genomics, protein structure initiative; HET: SO4; 2.10A {Enterococcus faecalis} SCOP: a.118.1.17 Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2b6c_A Hypothetical protein EF3068; structural genomis, DNA repair enzyme, structural genomics, protein structure initiative; HET: SO4; 2.10A {Enterococcus faecalis} SCOP: a.118.1.17 Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>3jxy_A Alkylpurine DNA glycosylase ALKD; heat repeat, DNA binding, DNA glycosylase, DNA alkylation, L complex, hydrolase-DNA complex; HET: DNA; 1.50A {Bacillus cereus} SCOP: a.118.1.0 PDB: 3jx7_A* 3bvs_A 3jy1_A* 3jxz_A* Back     alignment and structure
>3jxy_A Alkylpurine DNA glycosylase ALKD; heat repeat, DNA binding, DNA glycosylase, DNA alkylation, L complex, hydrolase-DNA complex; HET: DNA; 1.50A {Bacillus cereus} SCOP: a.118.1.0 PDB: 3jx7_A* 3bvs_A 3jy1_A* 3jxz_A* Back     alignment and structure
>1elk_A Target of MYB1; superhelix of helices, endocytosis/exocytosis complex; 1.50A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>1vsy_4 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_5 Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3ut4_A CTHE_2751, putative uncharacterized protein; non PFAM singleton, helical fold, unknown function; 2.03A {Clostridium thermocellum} PDB: 3ut8_A 3ut7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 337
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 1e-55
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 6e-24
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-23
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 3e-22
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 8e-21
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 5e-17
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 7e-17
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-14
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 3e-10
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 2e-09
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 3e-09
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 2e-08
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 5e-04
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 1e-11
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 2e-04
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 0.002
d1lrva_233 a.118.1.5 (A:) Leucine-rich repeat variant {Azotob 2e-10
d1lrva_233 a.118.1.5 (A:) Leucine-rich repeat variant {Azotob 1e-05
d1lrva_233 a.118.1.5 (A:) Leucine-rich repeat variant {Azotob 0.001
d2vgla_ 584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 3e-07
d2vgla_ 584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 5e-07
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 1e-05
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 1e-05
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 1e-04
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 1e-04
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 5e-04
d1oyza_276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 4e-05
d2bpta1861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 4e-04
d2bpta1 861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 0.003
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 0.001
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  188 bits (478), Expect = 1e-55
 Identities = 195/333 (58%), Positives = 256/333 (76%), Gaps = 4/333 (1%)

Query: 1   MDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRI 60
            DKSWRVRYMVA++  EL +AVGPE T++D+VPA+  L++D EAEVR AA+ KV + C  
Sbjct: 252 EDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCEN 311

Query: 61  LNPELA----IQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSL 116
           L+ +      +  ILPC+KEL SD++QHV+SALA+VIMG++PILGKD TIE LLP+FL+ 
Sbjct: 312 LSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQ 371

Query: 117 LKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLLAS 176
           LKDE P+VRLNIIS LD VN+VIGI  LSQSLLPAIVELAED  WRVRLAIIEY+PLLA 
Sbjct: 372 LKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAG 431

Query: 177 QLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINN 236
           QLGV FFD+KL +LCM WL D VY+IR+AA +N+K+L E+FG +WA   I+P+VL M  +
Sbjct: 432 QLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGD 491

Query: 237 PHYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVD 296
           P+YL+RMT L  I++L+ V G +IT   +LP V+  + D V N++FNVAK LQ + PI+D
Sbjct: 492 PNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILD 551

Query: 297 QSVVEKSIRPCLVELSEDPDVDVRFFATQALQS 329
            S ++  ++P L +L++D DVDV++FA +AL  
Sbjct: 552 NSTLQSEVKPILEKLTQDQDVDVKYFAQEALTV 584


>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Length = 233 Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Length = 233 Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Length = 233 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
d1b3ua_588 Constant regulatory domain of protein phosphatase 100.0
d1b3ua_588 Constant regulatory domain of protein phosphatase 100.0
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.89
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.83
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.83
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.83
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.82
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.81
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.81
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.79
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.77
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.77
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.74
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.74
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.72
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.7
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.61
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.6
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 99.55
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.55
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 99.47
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 99.35
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 99.27
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.12
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 99.05
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.04
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.72
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 98.45
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 98.07
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 95.22
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 94.75
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 94.54
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 92.29
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 91.87
d1juqa_151 ADP-ribosylation factor binding protein Gga3 {Huma 88.25
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 87.89
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 87.52
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 86.81
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 84.78
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 84.5
d1t06a_235 Hypothetical protein BC3264 {Bacillus cereus (stra 80.17
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1e-40  Score=303.98  Aligned_cols=330  Identities=59%  Similarity=0.981  Sum_probs=308.0

Q ss_pred             CCChHHHHHHHHHHHHHHHHhCCCCcccchHHHHHHhcCCChHHHHHHHHHhHHHHHHhhCHH----HHHHhhhHhhHHh
Q 019679            2 DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRILNPE----LAIQHILPCVKEL   77 (337)
Q Consensus         2 D~~~~vR~~~~~~l~~~~~~~~~~~~~~~l~~~l~~~~~d~~~~vR~~a~~~l~~~~~~~~~~----~~~~~ll~~l~~l   77 (337)
                      |++|+||..++++++.++..++++...+.++|.+..++.|++++||..++..++.++..++..    ...+.++|.+...
T Consensus       253 D~~~~Vr~~~~~~l~~l~~~~~~~~~~~~l~~~l~~ll~d~~~~vr~~a~~~l~~~~~~l~~~~~~~~~~~~i~~~l~~~  332 (588)
T d1b3ua_         253 DKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKEL  332 (588)
T ss_dssp             CSSHHHHHHHHHTHHHHHHHHCHHHHHHTHHHHHHHHHTCSSHHHHHHHHHHHHHHHHTSCTTTHHHHHHHTHHHHHHHH
T ss_pred             cccHHHHHHHHHhHHHHHHHhhhhhhhhhhhHHHHHHHhccchHHHHHHHHHHHHHHHHHhhhhhhhhhHHHHHHHHHHh
Confidence            889999999999999999999887777789999999999999999999999999998876643    3456788999999


Q ss_pred             cCCCcHHHHHHHHHHHHhcCcccChhhHHhhhHHHHHHhhcCCChhHHHHHHHhHHHhHhhhchhhHHhhHHHHHHHHhc
Q 019679           78 SSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAE  157 (337)
Q Consensus        78 ~~d~~~~vr~~a~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~l~~~~~~~~~~~~llp~l~~~~~  157 (337)
                      .+|+++.||..++.++..++...|.+...+.++|.+...++|++++||..++.+++.+...++...+.+.++|.+....+
T Consensus       333 ~~d~~~~vr~~~~~~l~~~~~~~~~~~~~~~l~p~l~~~l~d~~~~v~~~~~~~l~~~~~~~~~~~~~~~ll~~l~~~~~  412 (588)
T d1b3ua_         333 VSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAE  412 (588)
T ss_dssp             HTCSCHHHHHHHHTTGGGGHHHHCHHHHHHHTHHHHHHHHTCSCHHHHHHHHTTCHHHHHHSCHHHHHHHHHHHHHHHHT
T ss_pred             hcCCChHHHHHHHHHHhhhhhccchhHHHHHHHHHHHHHHHhhhhhhhhHHHHHHHHHHhhcchhhhhhHHHHHHHHHHh
Confidence            99999999999999999999888888888899999999999999999999999999999999888888999999999999


Q ss_pred             CCchHHHHHHHHHhhHhHhhhChhhHHHHHHHHHHHHccccchHHHHHHHHHHHHHHHHhChHHHHhhHHHHHHHhhcCc
Q 019679          158 DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFGPDWAMQHIVPQVLEMINNP  237 (337)
Q Consensus       158 d~~~~vr~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~~~~~~~~~~~~~~l~~~l~~~~~~~  237 (337)
                      |.+|++|..+++.++.+++.+|.+.+.+.+.|.+..++.|+.+.||.+|+.+++.+...+|.++....++|.+.+++.++
T Consensus       413 d~~~~~r~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l~D~~~~VR~~A~~~L~~l~~~~~~~~~~~~i~~~l~~~~~~~  492 (588)
T d1b3ua_         413 DAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDP  492 (588)
T ss_dssp             CSSHHHHHHHHHHHHHHHHHHCGGGCCHHHHHHHHHGGGCSSHHHHHHHHHHHHHHHHHHCHHHHHHHTHHHHHHTTTCS
T ss_pred             cccHHHHHHHHHHHHHHHHHcChHhHHHHHHHHHHhhccCCchhHHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHhcCC
Confidence            99999999999999999999999888889999999999999999999999999999999999888888999999999999


Q ss_pred             chHHHHHHHHHHHHhccccChHHHHhhHHHHHHhhccCCChhHHHHHHHHHHHHhhhhcHHHHHHhhhHHHHhhhCCCCc
Q 019679          238 HYLYRMTILQAISLLAPVMGSEITCSQLLPVVINASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDV  317 (337)
Q Consensus       238 ~~~vR~~~~~~l~~l~~~~~~~~~~~~l~~~l~~~l~d~~~~vr~~a~~~l~~i~~~~~~~~~~~~i~~~l~~l~~d~~~  317 (337)
                      +|.+|.+++.+++.+.+.++.+.+.++++|.++++++|+.++||.+++++|+.+...++++.+...+.|.+.++.+|+|.
T Consensus       493 ~~~~R~~~~~~l~~l~~~~~~~~~~~~ilp~ll~~~~D~v~nVR~~a~~~l~~i~~~~~~~~~~~~i~~~l~~L~~D~d~  572 (588)
T d1b3ua_         493 NYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDV  572 (588)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHGGGCSCHHHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHTTCSSH
T ss_pred             CHHHHHHHHHHHHHHHHHcChHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHcCcHhHHHHHHHHHHHHcCCCCH
Confidence            99999999999999999888888889999999999999999999999999999999999888888999999999999999


Q ss_pred             cHHHHHHHHHHHHH
Q 019679          318 DVRFFATQALQSKD  331 (337)
Q Consensus       318 ~vr~~a~~al~~l~  331 (337)
                      +||+.|.+|+..++
T Consensus       573 dVr~~A~~al~~l~  586 (588)
T d1b3ua_         573 DVKYFAQEALTVLS  586 (588)
T ss_dssp             HHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHh
Confidence            99999999999875



>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t06a_ a.118.1.17 (A:) Hypothetical protein BC3264 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure