Citrus Sinensis ID: 019721
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| 255577342 | 433 | chaperone protein DNAj, putative [Ricinu | 0.991 | 0.769 | 0.667 | 1e-131 | |
| 297734356 | 589 | unnamed protein product [Vitis vinifera] | 0.958 | 0.546 | 0.677 | 1e-123 | |
| 359491526 | 497 | PREDICTED: chaperone protein DnaJ-like [ | 0.958 | 0.647 | 0.677 | 1e-123 | |
| 356522869 | 525 | PREDICTED: chaperone protein DnaJ-like [ | 0.910 | 0.582 | 0.703 | 1e-123 | |
| 224135637 | 419 | predicted protein [Populus trichocarpa] | 0.866 | 0.694 | 0.735 | 1e-116 | |
| 297830416 | 518 | DNAJ heat shock family protein [Arabidop | 0.898 | 0.583 | 0.672 | 1e-109 | |
| 42564975 | 517 | molecular chaperone Hsp40/DnaJ family pr | 0.898 | 0.584 | 0.672 | 1e-109 | |
| 9294487 | 438 | DnaJ homolog [Arabidopsis thaliana] | 0.898 | 0.689 | 0.672 | 1e-108 | |
| 414865579 | 705 | TPA: hypothetical protein ZEAMMB73_81960 | 0.866 | 0.412 | 0.577 | 2e-94 | |
| 294461414 | 508 | unknown [Picea sitchensis] | 0.919 | 0.608 | 0.486 | 2e-83 |
| >gi|255577342|ref|XP_002529551.1| chaperone protein DNAj, putative [Ricinus communis] gi|223530963|gb|EEF32820.1| chaperone protein DNAj, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 475 bits (1223), Expect = e-131, Method: Compositional matrix adjust.
Identities = 235/352 (66%), Positives = 281/352 (79%), Gaps = 19/352 (5%)
Query: 1 MPVIASPSYVNLK---------------LHLSTSFSFKWNYCSGNNRSHR--RGMIRAAG 43
MP I P Y NLK H S F ++ N + R +IRAA
Sbjct: 1 MPAIQIPCYANLKSTFKPSSIPKSSISFCHGKVSLQFSSSFFRKNGKDRRCCNCVIRAAA 60
Query: 44 TDYYSTLNVRQNATLQEIKTSYRKLARKYHPDINKSPGAEEKFKEISSAYEVLSDDEKRS 103
TD+YSTLNV +NATLQEIK+SYRKLARKYHPD+NK PGAEEKFKEIS+AYEVLSDDEKRS
Sbjct: 61 TDHYSTLNVDRNATLQEIKSSYRKLARKYHPDLNKGPGAEEKFKEISAAYEVLSDDEKRS 120
Query: 104 VYDRFGEAGITGEYDGLSNTSQGVDPFELYSAFFGGSDGLFGGVGEAGGINFNFGNKGNF 163
+YDRFGEAG+ GEYDG S+ SQG+DPF++Y+AFFG SDG FGG+GEAGGI FN N G
Sbjct: 121 LYDRFGEAGLQGEYDG-SSGSQGMDPFDIYNAFFGDSDGFFGGMGEAGGIKFNMRNTGK- 178
Query: 164 GLDIRYDLHLSFEESIFGGQRGIEVSCFETCDSCGGTGAKSSNCIQSCKACWGRGGVLKT 223
LDIRY+L++SFEESIFGGQ+ IE SCFETCD CGGTGAKSS+ I+SC C GRGGV+KT
Sbjct: 179 DLDIRYNLNVSFEESIFGGQQEIEFSCFETCDKCGGTGAKSSSSIKSCADCGGRGGVMKT 238
Query: 224 QRTPFGLISQVSTCSKCGGDGKIIIDHCRRCGGNGEVQSKRSMKVVIPPGVSNGATMQIR 283
QRTPFG++SQVSTCSKC GDGK+I DHC++CGGNG V +KRS+K+VIPPG+S+GA M+I+
Sbjct: 239 QRTPFGMMSQVSTCSKCNGDGKLITDHCQKCGGNGNVSTKRSIKIVIPPGISDGALMRIQ 298
Query: 284 GEGNFDRRRSLAGDLFVALHVDEKQGIHRDGLNLFSKISVDYTEAILGTSME 335
GEGNFD++R +AGDL++ LH++EK GI RDGLNL+SKISVDYT AILGT ++
Sbjct: 299 GEGNFDKKRGIAGDLYITLHINEKHGIWRDGLNLYSKISVDYTRAILGTVIK 350
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297734356|emb|CBI15603.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359491526|ref|XP_002279102.2| PREDICTED: chaperone protein DnaJ-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356522869|ref|XP_003530065.1| PREDICTED: chaperone protein DnaJ-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224135637|ref|XP_002322123.1| predicted protein [Populus trichocarpa] gi|222869119|gb|EEF06250.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297830416|ref|XP_002883090.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata] gi|297328930|gb|EFH59349.1| DNAJ heat shock family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42564975|ref|NP_188410.2| molecular chaperone Hsp40/DnaJ family protein [Arabidopsis thaliana] gi|115646890|gb|ABJ17154.1| At3g17830 [Arabidopsis thaliana] gi|332642491|gb|AEE76012.1| molecular chaperone Hsp40/DnaJ family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9294487|dbj|BAB02706.1| DnaJ homolog [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|414865579|tpg|DAA44136.1| TPA: hypothetical protein ZEAMMB73_819602 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|294461414|gb|ADE76268.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| TAIR|locus:2088585 | 517 | AT3G17830 [Arabidopsis thalian | 0.904 | 0.588 | 0.617 | 3.8e-101 | |
| TAIR|locus:2016234 | 500 | AT1G80030 [Arabidopsis thalian | 0.931 | 0.626 | 0.449 | 2.8e-73 | |
| TAIR|locus:2140035 | 447 | AT4G39960 [Arabidopsis thalian | 0.898 | 0.675 | 0.416 | 2.7e-61 | |
| TAIR|locus:2041258 | 442 | AT2G22360 [Arabidopsis thalian | 0.877 | 0.667 | 0.424 | 2.4e-60 | |
| TIGR_CMR|CHY_0416 | 381 | CHY_0416 "chaperone protein dn | 0.854 | 0.753 | 0.394 | 1.1e-50 | |
| TIGR_CMR|BA_4538 | 371 | BA_4538 "chaperone protein dna | 0.842 | 0.762 | 0.350 | 1.1e-48 | |
| TIGR_CMR|DET_1398 | 356 | DET_1398 "co-chaperone protein | 0.502 | 0.474 | 0.325 | 8.6e-47 | |
| UNIPROTKB|P95830 | 378 | dnaJ "Chaperone protein DnaJ" | 0.851 | 0.756 | 0.342 | 7.9e-46 | |
| TIGR_CMR|GSU_0034 | 373 | GSU_0034 "chaperone protein dn | 0.494 | 0.445 | 0.335 | 1.2e-45 | |
| UNIPROTKB|Q47XI7 | 378 | dnaJ "Chaperone protein DnaJ" | 0.494 | 0.439 | 0.341 | 2e-45 |
| TAIR|locus:2088585 AT3G17830 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1003 (358.1 bits), Expect = 3.8e-101, P = 3.8e-101
Identities = 189/306 (61%), Positives = 237/306 (77%)
Query: 28 SGNNRSHRRGMIRAAGTDYYSTLNVRQNATLQEIKTSYRKLARKYHPDINKSPGAEEKFK 87
SG R RR + AAGTD+YSTLNV +NATLQEIK+SYRKLARKYHPD+NK+PGAE+KFK
Sbjct: 48 SGGYR--RRVITMAAGTDHYSTLNVNRNATLQEIKSSYRKLARKYHPDMNKNPGAEDKFK 105
Query: 88 EISSAYEVLSDDEKRSVYDRFGEAGITGEYDGLSNTSQGVDPFELYSAXXXXXXXXXXXX 147
+IS+AYEVLSD+EKRS YDRFGEAG+ G+++G +TS GVDPF+LYSA
Sbjct: 106 QISAAYEVLSDEEKRSAYDRFGEAGLEGDFNGSQDTSPGVDPFDLYSAFFGGSDGFFGGM 165
Query: 148 XEAXXXXXXXXXXXXXXLDIRYDLHLSFEESIFGGQRGIEVSCFETCDSCGGTGAKSSNC 207
E+ LDIRYDL LSFEE++FG +R IEVS ETCD CGGTGAKSSN
Sbjct: 166 GESGGMGFDFMNKRSLDLDIRYDLRLSFEEAVFGVKREIEVSYLETCDGCGGTGAKSSNS 225
Query: 208 IQSCKACWGRGGVLKTQRTPFGLISQVSTCSKCGGDGKIIIDHCRRCGGNGEVQSKRSMK 267
I+ C +C G+G V+ +QRTPFG++SQVSTCSKCGG+GK I D CR+C GNG +++++ M
Sbjct: 226 IKQCSSCDGKGRVMNSQRTPFGIMSQVSTCSKCGGEGKTITDKCRKCIGNGRLRARKKMD 285
Query: 268 VVIPPGVSNGATMQIRGEGNFDRRRSLAGDLFVALHVDEKQGIHRDGLNLFSKISVDYTE 327
VV+PPGVS+ ATM+I+GEGN D+R AGDLF+ L VDEK+GI R+GLNL+S I++D+T+
Sbjct: 286 VVVPPGVSDRATMRIQGEGNMDKRSGRAGDLFIVLQVDEKRGIRREGLNLYSNINIDFTD 345
Query: 328 AILGTS 333
AILG +
Sbjct: 346 AILGAT 351
|
|
| TAIR|locus:2016234 AT1G80030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140035 AT4G39960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2041258 AT2G22360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0416 CHY_0416 "chaperone protein dnaJ" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4538 BA_4538 "chaperone protein dnaJ" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1398 DET_1398 "co-chaperone protein DnaJ" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P95830 dnaJ "Chaperone protein DnaJ" [Streptococcus pneumoniae TIGR4 (taxid:170187)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0034 GSU_0034 "chaperone protein dnaJ" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q47XI7 dnaJ "Chaperone protein DnaJ" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 1e-108 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 2e-99 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 3e-88 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 1e-80 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 9e-80 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 8e-78 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 9e-77 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 6e-75 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 2e-74 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 6e-71 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 4e-70 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 8e-67 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 2e-66 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 4e-66 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 1e-65 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 3e-64 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 8e-63 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 9e-63 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 6e-61 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 1e-58 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 7e-57 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 4e-55 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 5e-55 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 2e-52 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 9e-51 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 8e-50 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 2e-49 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 2e-47 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 3e-47 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 2e-37 | |
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 5e-31 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 2e-26 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 2e-25 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 3e-24 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 2e-21 | |
| cd10719 | 65 | cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H | 2e-20 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 2e-20 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 2e-17 | |
| pfam00684 | 65 | pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | 4e-17 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 8e-11 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 4e-09 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 6e-07 | |
| COG5269 | 379 | COG5269, ZUO1, Ribosome-associated chaperone zuoti | 8e-06 | |
| COG1107 | 715 | COG1107, COG1107, Archaea-specific RecJ-like exonu | 6e-05 | |
| PRK01356 | 166 | PRK01356, hscB, co-chaperone HscB; Provisional | 3e-04 | |
| pfam01556 | 81 | pfam01556, DnaJ_C, DnaJ C terminal domain | 3e-04 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 3e-04 | |
| TIGR00714 | 155 | TIGR00714, hscB, Fe-S protein assembly co-chaperon | 5e-04 | |
| cd10747 | 158 | cd10747, DnaJ_C, C-terminal substrate binding doma | 9e-04 | |
| COG1107 | 715 | COG1107, COG1107, Archaea-specific RecJ-like exonu | 0.001 | |
| COG1076 | 174 | COG1076, DjlA, DnaJ-domain-containing proteins 1 [ | 0.002 |
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
Score = 320 bits (822), Expect = e-108
Identities = 128/292 (43%), Positives = 176/292 (60%), Gaps = 6/292 (2%)
Query: 45 DYYSTLNVRQNATLQEIKTSYRKLARKYHPDINKSPGAEEKFKEISSAYEVLSDDEKRSV 104
DYY L V ++A+ +EIK +YRKLA+KYHPD NK AEEKFKEI+ AYEVLSD EKR+
Sbjct: 1 DYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNKDKEAEEKFKEINEAYEVLSDPEKRAQ 60
Query: 105 YDRFGEAGITGEYDGLSNTSQGVDPFELYSAFFGGSDGLFGGV-GEAGGINFNFGNKGNF 163
YD+FG AG G G G + F+ FFG +FG G GG +
Sbjct: 61 YDQFGHAGFNG---GGGGGGGGFNGFD--IGFFGDFGDIFGDFFGGGGGSGRRRRSGPRR 115
Query: 164 GLDIRYDLHLSFEESIFGGQRGIEVSCFETCDSCGGTGAKSSNCIQSCKACWGRGGVLKT 223
G D+RYDL L+FEE++FG ++ IE+ E+C++C GTGAK ++C C G G V +
Sbjct: 116 GEDLRYDLELTFEEAVFGVEKEIEIPRKESCETCHGTGAKPGTDPKTCPTCGGTGQVRRQ 175
Query: 224 QRTPFGLISQVSTCSKCGGDGKIIIDHCRRCGGNGEVQSKRSMKVVIPPGVSNGATMQIR 283
Q TPFG Q TC CGG+GKII + C C G G V+ ++++ V IP GV G +++
Sbjct: 176 QGTPFGFFQQQQTCPTCGGEGKIIKEPCSTCKGKGRVKERKTITVKIPAGVDTGQRLRVS 235
Query: 284 GEGNFDRRRSLAGDLFVALHVDEKQGIHRDGLNLFSKISVDYTEAILGTSME 335
G+GN GDL+V + V + RDG +L+ ++ + +T+AILG +E
Sbjct: 236 GKGNAGENGGPNGDLYVVIRVKPHKIFERDGNDLYIEVPISFTQAILGGEIE 287
|
This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family. Length = 354 |
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|216058 pfam00684, DnaJ_CXXCXGXG, DnaJ central domain | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216569 pfam01556, DnaJ_C, DnaJ C terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|211601 TIGR00714, hscB, Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >gnl|CDD|199909 cd10747, DnaJ_C, C-terminal substrate binding domain of DnaJ and HSP40 | Back alignment and domain information |
|---|
| >gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 100.0 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 100.0 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 100.0 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 100.0 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 100.0 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 100.0 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 100.0 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.96 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.85 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.81 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.8 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.79 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.79 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.79 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.77 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.76 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.73 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.71 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.69 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.65 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.64 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.63 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.62 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.61 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.56 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.52 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.52 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.51 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.5 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.49 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.49 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.49 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.48 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.48 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.47 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.46 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.46 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.46 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.45 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.45 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 99.44 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.44 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.44 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.44 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.44 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.43 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.43 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.42 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.42 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.42 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.42 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.41 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.4 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.39 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.38 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.38 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.37 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.37 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.37 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.35 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.27 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.24 | |
| PF01556 | 81 | CTDII: DnaJ C terminal domain; InterPro: IPR002939 | 99.2 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.14 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 98.95 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.91 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.88 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 98.76 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.75 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.72 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.69 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 98.68 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.52 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 98.29 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.24 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.23 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 98.03 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 97.79 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 97.68 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 96.79 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.7 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 96.52 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 96.4 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 96.22 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.21 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 94.38 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 94.37 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 93.54 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 92.39 | |
| PF11833 | 194 | DUF3353: Protein of unknown function (DUF3353); In | 87.01 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 84.34 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 83.97 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 83.75 | |
| smart00709 | 160 | Zpr1 Duplicated domain in the epidermal growth fac | 82.06 | |
| TIGR00310 | 192 | ZPR1_znf ZPR1 zinc finger domain. | 81.67 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-76 Score=556.90 Aligned_cols=281 Identities=44% Similarity=0.781 Sum_probs=252.8
Q ss_pred ccccCcceecccCCCCCHHHHHHHHHHHHHHhCCCCCC-CcchHHHHHHHHHHHHHhchhcccccccccCCCCcCCcccC
Q 019721 41 AAGTDYYSTLNVRQNATLQEIKTSYRKLARKYHPDINK-SPGAEEKFKEISSAYEVLSDDEKRSVYDRFGEAGITGEYDG 119 (336)
Q Consensus 41 ~~~~d~Y~iLgv~~~a~~~eIk~ayr~la~~~hPd~~~-~~~~~~~f~~i~~Ay~vL~d~~~r~~YD~~G~~g~~~~~~~ 119 (336)
++.+|||+||||+++||++|||+||||||+|||||+|+ +++|+++|++|++||||||||+||++||+||+++++.+..+
T Consensus 1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g 80 (371)
T COG0484 1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG 80 (371)
T ss_pred CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence 35789999999999999999999999999999999999 88999999999999999999999999999999988632222
Q ss_pred CCCCCCCC--CchhhhccccCCCCCCCCCCCCCCCcccccCCCCCCCcceEEEEeecceeeeeceEEEEEeeeeeeCCCC
Q 019721 120 LSNTSQGV--DPFELYSAFFGGSDGLFGGVGEAGGINFNFGNKGNFGLDIRYDLHLSFEESIFGGQRGIEVSCFETCDSC 197 (336)
Q Consensus 120 ~~~~~~~~--d~~~~f~~ffg~~~~~fg~~g~~~~~~~~~~~~~~~g~di~~~l~vslee~~~G~~~~v~~~~~~~C~~C 197 (336)
+. ++.++ +..|||++|||++.+ + . ...+...++.|+.+.|.|||+||++|+++++.+++.+.|+.|
T Consensus 81 g~-g~~~fgg~~~DIF~~~FgGg~~--~---~------~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C 148 (371)
T COG0484 81 GF-GFGGFGGDFGDIFEDFFGGGGG--G---R------RRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTC 148 (371)
T ss_pred CC-CcCCCCCCHHHHHHHhhcCCCc--c---c------CCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcC
Confidence 11 22222 578999999974211 0 0 012235689999999999999999999999999999999999
Q ss_pred CCCCccCCCCcccCCCCCCccEEEEeeecCCcceeeeecCCCCCCcceEEeeeeeecCCceEEeeeeEEEEEeCCCCCCC
Q 019721 198 GGTGAKSSNCIQSCKACWGRGGVLKTQRTPFGLISQVSTCSKCGGDGKIIIDHCRRCGGNGEVQSKRSMKVVIPPGVSNG 277 (336)
Q Consensus 198 ~G~G~~~~~~~~~C~~C~G~G~~~~~~~~~~~~~~~~~~C~~C~G~G~~~~~~C~~C~g~g~~~~~~~l~V~Ip~G~~~G 277 (336)
+|+|.+..+...+|+.|+|+|.+...+++ +.++++++|+.|+|+|++++++|..|+|.+++...++|+|+||+|+.+|
T Consensus 149 ~GsGak~gt~~~tC~tC~G~G~v~~~~~~--g~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g 226 (371)
T COG0484 149 HGSGAKPGTDPKTCPTCNGSGQVRTVQRT--GFFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDG 226 (371)
T ss_pred CCCCCCCCCCCCcCCCCCCcCeEEEEEee--eEEEEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccC
Confidence 99999999999999999999999888877 7788889999999999999999999999999999999999999999999
Q ss_pred cEEEEccCCCCCCCCCCCccEEEEEEEecCCCccccccceeeecccChhhhhcCceec
Q 019721 278 ATMQIRGEGNFDRRRSLAGDLFVALHVDEKQGIHRDGLNLFSKISVDYTEAILGTSME 335 (336)
Q Consensus 278 ~~i~l~G~G~~~~~~g~~GDL~v~i~v~~~~~f~r~g~dL~~~~~I~l~eALlG~~~~ 335 (336)
++|+++|+|+++.+++++|||||+|.|++|+.|.|+++|||++++|++.+|+||++++
T Consensus 227 ~~ir~~g~G~~g~~Ggp~GDLyv~i~v~~h~~F~R~g~dL~~~~~Is~~~AalG~~i~ 284 (371)
T COG0484 227 DRIRLSGEGEAGPNGGPAGDLYVFVHVKPHPIFERDGDDLYCEVPISFTEAALGGEIE 284 (371)
T ss_pred CEEEEecCcccCCCCCCCccEEEEEEeecCCCeEECCCceEeccccCHHHHhcCCEEE
Confidence 9999999999988888999999999999999999999999999999999999998875
|
|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PF01556 CTDII: DnaJ C terminal domain; InterPro: IPR002939 Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
| >smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1 | Back alignment and domain information |
|---|
| >TIGR00310 ZPR1_znf ZPR1 zinc finger domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 336 | ||||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 3e-20 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 5e-17 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 1e-16 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 1e-15 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 3e-15 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 4e-15 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 5e-15 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 1e-14 | ||
| 2lgw_A | 99 | Solution Structure Of The J Domain Of Hsj1a Length | 1e-14 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 2e-14 | ||
| 2ctw_A | 109 | Solution Structure Of J-Domain From Mouse Dnaj Subf | 2e-14 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 4e-14 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 6e-14 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 6e-14 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 7e-14 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 4e-13 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 9e-13 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 3e-11 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 5e-11 | ||
| 1nlt_A | 248 | The Crystal Structure Of Hsp40 Ydj1 Length = 248 | 1e-08 | ||
| 1exk_A | 79 | Solution Structure Of The Cysteine-Rich Domain Of T | 4e-08 | ||
| 2qsa_A | 109 | Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 | 5e-08 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 1e-07 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 2e-07 | ||
| 2ctt_A | 104 | Solution Structure Of Zinc Finger Domain From Human | 2e-06 | ||
| 2yua_A | 99 | Solution Structure Of The Dnaj Domain From Human Wi | 6e-05 | ||
| 1wjz_A | 94 | Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P | 2e-04 | ||
| 2l6l_A | 155 | Solution Structure Of Human J-Protein Co-Chaperone, | 2e-04 | ||
| 2ctq_A | 112 | Solution Structure Of J-Domain From Human Dnaj Subf | 3e-04 | ||
| 2ys8_A | 90 | Solution Structure Of The Dnaj-Like Domain From Hum | 5e-04 |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
|
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1 Length = 248 | Back alignment and structure |
| >pdb|1EXK|A Chain A, Solution Structure Of The Cysteine-Rich Domain Of The Escherichia Coli Chaperone Protein Dnaj Length = 79 | Back alignment and structure |
| >pdb|2QSA|A Chain A, Crystal Structure Of J-Domain Of Dnaj Homolog Dnj-2 Precursor From C.Elegans Length = 109 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2CTT|A Chain A, Solution Structure Of Zinc Finger Domain From Human Dnaj Subfamily A Menber 3 Length = 104 | Back alignment and structure |
| >pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 | Back alignment and structure |
| >pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 | Back alignment and structure |
| >pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 | Back alignment and structure |
| >pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 | Back alignment and structure |
| >pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 4e-63 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 3e-43 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 3e-43 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 3e-42 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 7e-41 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 3e-37 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 4e-37 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 1e-36 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 1e-36 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 2e-36 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 2e-36 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 6e-36 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 1e-35 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 4e-35 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 8e-35 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 8e-35 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 2e-34 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 2e-33 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 2e-33 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 1e-32 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 2e-30 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 4e-30 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-29 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 2e-29 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 2e-28 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 1e-27 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-22 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 2e-19 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 4e-18 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 7e-17 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 2e-16 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 7e-16 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 2e-15 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 2e-13 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 7e-12 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 1e-11 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 2e-10 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 5e-10 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 3e-08 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
Score = 202 bits (516), Expect = 4e-63
Identities = 63/291 (21%), Positives = 108/291 (37%), Gaps = 67/291 (23%)
Query: 45 DYYSTLNVRQNATLQEIKTSYRKLARKYHPDINKSPGAEEKFKEISSAYEVLSDDEKRSV 104
DYY+ L V+ L+ IKT+YR+LARKYHPD++K AE KFK+++ A+EVL D+++R+
Sbjct: 29 DYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAE 88
Query: 105 YDRFGEAGITGEYDGLSNTSQGVDPFELYSAFFGGSDGLFGGVGEAGGINFNFGNKGNFG 164
YD+ + + T + + + F +FG G
Sbjct: 89 YDQLWQHRNDPGFGRQRQTHEQSYSQQDFDDIFS---SMFGQQAHQRR-----RQHAARG 140
Query: 165 LDIRYDLHLSFEESIFGGQRGIEVSCFETCDSCGGTGAKSSNCIQSCKACWGRGGVLKTQ 224
D+ ++ + EE++ R I + +G +
Sbjct: 141 HDLEIEVAVFLEETLAEQTRTISYN-------------------LPVYNVFGMIESETPK 181
Query: 225 RTPFGLISQVSTCSKCGGDGKIIIDHCRRCGGNGEVQSKRSMKVVIPPGVSNGATMQIRG 284
+ V IP GV +G ++++G
Sbjct: 182 T----------------------------------------LNVKIPAGVVDGQRIRLKG 201
Query: 285 EGNFDRRRSLAGDLFVALHVDEKQGIHRDGLNLFSKISVDYTEAILGTSME 335
+G GDL++ +H+ G NL + + EA LG +
Sbjct: 202 QGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVT 252
|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Length = 248 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Length = 79 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} Length = 180 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A Length = 181 | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A Length = 170 | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 100.0 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 100.0 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 99.93 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 99.92 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.9 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 99.89 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.88 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.87 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.86 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.86 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.86 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.85 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.85 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.85 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.84 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.84 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.84 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.84 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.83 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 99.81 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.8 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.79 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.79 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.78 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.74 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.73 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.72 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.72 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.72 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.68 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.68 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.67 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.66 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.65 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.64 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.64 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.63 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.59 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 99.5 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 99.43 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 99.34 | |
| 1xao_A | 121 | YDJ1, mitochondrial protein import protein MAS5; b | 99.29 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 99.08 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 99.07 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.04 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 99.03 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 98.91 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.82 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 97.69 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 97.66 | |
| 3pmq_A | 669 | Decaheme cytochrome C MTRF; greek KEY, C type cyto | 97.43 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 97.38 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.06 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 97.03 | |
| 2bx9_A | 53 | Anti-trap, AT, tryptophan RNA-binding attenuator p | 96.79 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 91.8 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.2e-49 Score=374.29 Aligned_cols=223 Identities=29% Similarity=0.477 Sum_probs=98.4
Q ss_pred cccCcceecccCCCCCHHHHHHHHHHHHHHhCCCCCCCcchHHHHHHHHHHHHHhchhcccccccccCCCCcCCcccCC-
Q 019721 42 AGTDYYSTLNVRQNATLQEIKTSYRKLARKYHPDINKSPGAEEKFKEISSAYEVLSDDEKRSVYDRFGEAGITGEYDGL- 120 (336)
Q Consensus 42 ~~~d~Y~iLgv~~~a~~~eIk~ayr~la~~~hPd~~~~~~~~~~f~~i~~Ay~vL~d~~~r~~YD~~G~~g~~~~~~~~- 120 (336)
..+|||++|||+++||.+|||+|||+||++||||+++++.++++|++|++||++|+||.+|+.||+|+..+...++.+.
T Consensus 26 ~~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~~~~~ 105 (329)
T 3lz8_A 26 ELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGFGRQR 105 (329)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred cccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCccccc
Confidence 4589999999999999999999999999999999998888999999999999999999999999999644321111110
Q ss_pred ---CCCCCCCCchhhhccccCCCCCCCCCCCCCCCcccccCCCCCCCcceEEEEeecceeeeeceEEEEEeeeeeeCCCC
Q 019721 121 ---SNTSQGVDPFELYSAFFGGSDGLFGGVGEAGGINFNFGNKGNFGLDIRYDLHLSFEESIFGGQRGIEVSCFETCDSC 197 (336)
Q Consensus 121 ---~~~~~~~d~~~~f~~ffg~~~~~fg~~g~~~~~~~~~~~~~~~g~di~~~l~vslee~~~G~~~~v~~~~~~~C~~C 197 (336)
++++.+.+..++|++|||++ ++ .++ .....++.|+.++|.|||+|+|+|+++++.+++.+.|
T Consensus 106 ~~~~~~f~~~~f~diF~~~Fg~~----g~---~~~-----~~~~~~g~Dl~~~l~vsleea~~G~~k~i~i~~~v~~--- 170 (329)
T 3lz8_A 106 QTHEQSYSQQDFDDIFSSMFGQQ----AH---QRR-----RQHAARGHDLEIEVAVFLEETLAEQTRTISYNLPVYN--- 170 (329)
T ss_dssp -------------------------------------------CCCCCCEEEEECCCTTGGGSCEEEEEEEEEEECC---
T ss_pred ccccCCcCCCchhhhhHhhhcCc----CC---CCC-----CCCcCCCCCEEEEEecchhhhhhccceEEEEEEEeec---
Confidence 11111224457788887642 10 000 1124578999999999999999999999999875532
Q ss_pred CCCCccCCCCcccCCCCCCccEEEEeeecCCcceeeeecCCCCCCcceEEeeeeeecCCceEEeeeeEEEEEeCCCCCCC
Q 019721 198 GGTGAKSSNCIQSCKACWGRGGVLKTQRTPFGLISQVSTCSKCGGDGKIIIDHCRRCGGNGEVQSKRSMKVVIPPGVSNG 277 (336)
Q Consensus 198 ~G~G~~~~~~~~~C~~C~G~G~~~~~~~~~~~~~~~~~~C~~C~G~G~~~~~~C~~C~g~g~~~~~~~l~V~Ip~G~~~G 277 (336)
|.|.+ .+...++++|+||||+++|
T Consensus 171 ------------------g~G~v--------------------------------------~~~~~~~l~V~IP~Gv~~G 194 (329)
T 3lz8_A 171 ------------------VFGMI--------------------------------------ESETPKTLNVKIPAGVVDG 194 (329)
T ss_dssp ------------------SCC-C--------------------------------------CEEEEEEEEEEECTTCCTT
T ss_pred ------------------CCeEE--------------------------------------EEecceEEEEeCCCCCCCC
Confidence 11111 1223568999999999999
Q ss_pred cEEEEccCCCCCCCCCCCccEEEEEEEecCCCccccccceeeecccChhhhhcCceec
Q 019721 278 ATMQIRGEGNFDRRRSLAGDLFVALHVDEKQGIHRDGLNLFSKISVDYTEAILGTSME 335 (336)
Q Consensus 278 ~~i~l~G~G~~~~~~g~~GDL~v~i~v~~~~~f~r~g~dL~~~~~I~l~eALlG~~~~ 335 (336)
++|+|+|+|+++..++.+|||||+|+|++|+.|+|+|+||+++++|+|+|||||++++
T Consensus 195 ~~Irl~G~G~~g~~gg~~GDL~v~I~v~~h~~F~R~G~DL~~~~~Isl~eAllG~~v~ 252 (329)
T 3lz8_A 195 QRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNLEIVLPLAPWEAALGAKVT 252 (329)
T ss_dssp CEEEESSCSCCC---CCCCCEEEEECCCCCSSCEEETTEEEEEEEECHHHHHHCEEEE
T ss_pred CEEEEcccccCCCCCCCCCcEEEEEEEecCCccEEcCCcEEEEEECCHHHHcCCCeEE
Confidence 9999999999977778899999999999999999999999999999999999999875
|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1xao_A YDJ1, mitochondrial protein import protein MAS5; beta sheets, chaperone; 2.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >3pmq_A Decaheme cytochrome C MTRF; greek KEY, C type cytochrome, outer membrane, electron trans; HET: HEC; 3.20A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 336 | ||||
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 2e-21 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 8e-21 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 2e-17 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 5e-17 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 7e-17 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 9e-16 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 2e-15 | |
| d1exka_ | 79 | g.54.1.1 (A:) Cysteine-rich domain of the chaperon | 2e-14 | |
| d1nlta3 | 74 | g.54.1.1 (A:139-212) Mitochondrial protein import | 2e-13 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 1e-12 | |
| d1m1qa_ | 90 | a.138.1.3 (A:) Flavocytochrome c3 (respiratory fum | 3e-12 | |
| d1c3ga1 | 80 | b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Ba | 4e-09 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Score = 84.7 bits (209), Expect = 2e-21
Identities = 37/73 (50%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
Query: 42 AGTDYYSTLNVRQNATLQEIKTSYRKLARKYHPDINKS-PGAEEKFKEISSAYEVLSDDE 100
A DYY L V + A +EI+ +Y++LA KYHPD N+ AE KFKEI AYEVL+D +
Sbjct: 1 AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQ 60
Query: 101 KRSVYDRFGEAGI 113
KR+ YD++G A
Sbjct: 61 KRAAYDQYGHAAF 73
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Length = 79 | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 74 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} Length = 90 | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.9 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.81 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.81 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.72 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.68 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.67 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.67 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.66 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.66 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 99.51 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 99.42 | |
| d1c3ga2 | 90 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 99.29 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 99.16 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 97.95 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 97.7 | |
| d1nlta2 | 80 | Mitochondrial protein import protein mas5 (Hsp40, | 97.29 | |
| d1m1qa_ | 90 | Flavocytochrome c3 (respiratory fumarate reductase | 96.49 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 90.74 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.90 E-value=7.2e-25 Score=161.26 Aligned_cols=71 Identities=51% Similarity=0.873 Sum_probs=66.7
Q ss_pred ccCcceecccCCCCCHHHHHHHHHHHHHHhCCCCCC-CcchHHHHHHHHHHHHHhchhcccccccccCCCCc
Q 019721 43 GTDYYSTLNVRQNATLQEIKTSYRKLARKYHPDINK-SPGAEEKFKEISSAYEVLSDDEKRSVYDRFGEAGI 113 (336)
Q Consensus 43 ~~d~Y~iLgv~~~a~~~eIk~ayr~la~~~hPd~~~-~~~~~~~f~~i~~Ay~vL~d~~~r~~YD~~G~~g~ 113 (336)
.+|||+||||+++||.+|||+|||+|+++||||+++ ++.+.++|+.|++||+||+||.+|+.||+||..++
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~ 73 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF 73 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence 579999999999999999999999999999999987 46678899999999999999999999999998765
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c3ga2 b.4.1.1 (A:260-349) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta2 b.4.1.1 (A:258-337) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m1qa_ a.138.1.3 (A:) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|