Citrus Sinensis ID: 019738
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| 224070174 | 335 | predicted protein [Populus trichocarpa] | 0.991 | 0.994 | 0.787 | 1e-154 | |
| 147771521 | 332 | hypothetical protein VITISV_038532 [Viti | 0.985 | 0.996 | 0.773 | 1e-151 | |
| 302142493 | 332 | unnamed protein product [Vitis vinifera] | 0.985 | 0.996 | 0.770 | 1e-150 | |
| 225458285 | 352 | PREDICTED: putative S-adenosyl-L-methion | 0.985 | 0.940 | 0.770 | 1e-150 | |
| 255538640 | 331 | conserved hypothetical protein [Ricinus | 0.985 | 1.0 | 0.765 | 1e-149 | |
| 356510211 | 347 | PREDICTED: putative S-adenosyl-L-methion | 1.0 | 0.968 | 0.728 | 1e-147 | |
| 356518890 | 347 | PREDICTED: putative S-adenosyl-L-methion | 1.0 | 0.968 | 0.728 | 1e-146 | |
| 297795203 | 348 | hypothetical protein ARALYDRAFT_331125 [ | 0.982 | 0.948 | 0.665 | 1e-129 | |
| 10177279 | 370 | unnamed protein product [Arabidopsis tha | 0.982 | 0.891 | 0.662 | 1e-129 | |
| 79527881 | 348 | Leucine carboxyl methyltransferase [Arab | 0.982 | 0.948 | 0.662 | 1e-128 |
| >gi|224070174|ref|XP_002303129.1| predicted protein [Populus trichocarpa] gi|118486503|gb|ABK95091.1| unknown [Populus trichocarpa] gi|222844855|gb|EEE82402.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 551 bits (1420), Expect = e-154, Method: Compositional matrix adjust.
Identities = 263/334 (78%), Positives = 295/334 (88%), Gaps = 1/334 (0%)
Query: 1 MSDQENGLPENPQWQELKLSQLLLTDTVRNLHATIDAQWDYLQRTACQTAAGRAMWKHVI 60
MSDQENGL E+PQW ELKL +LL TDTV+ LHATI ++WD L+R+ACQTAAGRA+WKHVI
Sbjct: 1 MSDQENGLQEDPQWLELKLPRLLYTDTVQGLHATIQSEWDSLRRSACQTAAGRALWKHVI 60
Query: 61 HDPLADLLAGETYLRNVHEKIKKDRLNNAREISGVILAIRTLWFDSQIEAALNSFNSREA 120
HDP ADLLAGETYL++ HEKIK DRL NARE SGVILA+RTLWFDS+IEAAL+SFN E
Sbjct: 61 HDPFADLLAGETYLKSFHEKIKNDRLKNARETSGVILAVRTLWFDSKIEAALSSFNG-EG 119
Query: 121 QVVLLGAGMDTRAYRLNCLKESDVFEVDFSQVLQVKTALIQTAMEFGDEQQHPRMTAKSL 180
QVVLLGAGMD RAYRL+CLKESDVFEVDF +VL+VKT L++ A E DE HPR+TAKSL
Sbjct: 120 QVVLLGAGMDARAYRLSCLKESDVFEVDFPEVLEVKTTLLKAATETIDEHLHPRITAKSL 179
Query: 181 TTVAADIRENDWLEKLQLSGYKPEKNTVWVLEGIIYYLLDIHAMQVLKLIADKCNLVHTV 240
VAADIR NDWLEKLQ+SG+ PEKNTVWVLEGI+YYL HAMQVL +IADKC L TV
Sbjct: 180 NRVAADIRNNDWLEKLQISGFVPEKNTVWVLEGILYYLSHSHAMQVLSIIADKCALARTV 239
Query: 241 LLADFMNQPSTTLSSSIFHFSSDWPDRLLPTLGFSNVRLSQIGDPDAHFGLMNDPLNLFN 300
LLADFMN+PSTTLS+SIFHF SDWPD LLP+LGFS+V+LSQ+GDPDAHFGLMNDPLNLFN
Sbjct: 240 LLADFMNKPSTTLSNSIFHFYSDWPDHLLPSLGFSHVKLSQLGDPDAHFGLMNDPLNLFN 299
Query: 301 KLRSLPRSVQTHPDDGTPCRRLYLVQASGSPNQT 334
KLRSLPRSVQTHPDDGTPC RLYLV+ASG P+Q+
Sbjct: 300 KLRSLPRSVQTHPDDGTPCCRLYLVEASGLPSQS 333
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147771521|emb|CAN75691.1| hypothetical protein VITISV_038532 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302142493|emb|CBI19696.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225458285|ref|XP_002282579.1| PREDICTED: putative S-adenosyl-L-methionine-dependent methyltransferase Mvan_1345-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255538640|ref|XP_002510385.1| conserved hypothetical protein [Ricinus communis] gi|223551086|gb|EEF52572.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356510211|ref|XP_003523833.1| PREDICTED: putative S-adenosyl-L-methionine-dependent methyltransferase MSMEG_0093-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356518890|ref|XP_003528110.1| PREDICTED: putative S-adenosyl-L-methionine-dependent methyltransferase Mb1758c-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297795203|ref|XP_002865486.1| hypothetical protein ARALYDRAFT_331125 [Arabidopsis lyrata subsp. lyrata] gi|297311321|gb|EFH41745.1| hypothetical protein ARALYDRAFT_331125 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|10177279|dbj|BAB10632.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|79527881|ref|NP_568611.2| Leucine carboxyl methyltransferase [Arabidopsis thaliana] gi|332007474|gb|AED94857.1| Leucine carboxyl methyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 336 | ||||||
| UNIPROTKB|O53841 | 301 | MT0851 "Putative S-adenosyl-L- | 0.517 | 0.578 | 0.338 | 9.8e-12 | |
| UNIPROTKB|O86359 | 314 | MT3874 "Putative S-adenosyl-L- | 0.324 | 0.347 | 0.352 | 3.2e-10 | |
| UNIPROTKB|P71987 | 312 | MT1770 "Putative S-adenosyl-L- | 0.508 | 0.548 | 0.298 | 1.2e-09 | |
| UNIPROTKB|P95073 | 301 | Rv0725c "Uncharacterized prote | 0.502 | 0.561 | 0.326 | 5.5e-09 | |
| UNIPROTKB|P96823 | 310 | MT0154 "Putative S-adenosyl-L- | 0.511 | 0.554 | 0.305 | 1.8e-08 | |
| UNIPROTKB|O33293 | 296 | MT2821 "Conserved protein" [My | 0.565 | 0.641 | 0.272 | 2.6e-08 | |
| UNIPROTKB|O53686 | 302 | MT0293 "Putative S-adenosyl-L- | 0.315 | 0.350 | 0.352 | 4.8e-08 | |
| DICTYBASE|DDB_G0285065 | 529 | DDB_G0285065 "leucine carboxyl | 0.327 | 0.207 | 0.317 | 1.2e-06 | |
| GENEDB_PFALCIPARUM|PF14_0376 | 327 | PF14_0376 "hypothetical protei | 0.452 | 0.464 | 0.25 | 0.00026 | |
| UNIPROTKB|Q8IL72 | 327 | PF14_0376 "Leucine carboxyl me | 0.452 | 0.464 | 0.25 | 0.00026 |
| UNIPROTKB|O53841 MT0851 "Putative S-adenosyl-L-methionine-dependent methyltransferase Rv0830/MT0851" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
Score = 180 (68.4 bits), Expect = 9.8e-12, P = 9.8e-12
Identities = 69/204 (33%), Positives = 100/204 (49%)
Query: 38 QWDY---LQRTACQTAAGRAMWKH----VIHDPLADLLA---G-ETYLRNVHEKIKKD-- 84
+WD + TA AA RA+ +I DP A L G + Y R V +I +
Sbjct: 8 RWDLATSVGATATMVAAQRALAADPRYALIDDPYAAPLVRAVGMDVYTRLVDWQIPVEGD 67
Query: 85 -RLNNAREISGVILAIRTLWFDSQIEAALNSFNSREAQVVLLGAGMDTRAYRLNCLKESD 143
+ R +G +A RT +FD + L++ +S Q V+L +G+D RAYRL S
Sbjct: 68 SEFDPQRMATG--MACRTRFFD---QFFLDATHSGIGQFVILASGLDARAYRLAWPVGSI 122
Query: 144 VFEVDFSQVLQVKTALIQTAMEFGDEQQHPRMTAKSLTTVAADIRENDWLEKLQLSGYKP 203
V+EVD +V++ KTA T + G E P A TVA D+R+ DW LQ +G+ P
Sbjct: 123 VYEVDMPEVIEFKTA---TLSDLGAE---P---ATERRTVAVDLRD-DWATALQTAGFDP 172
Query: 204 EKNTVWVLEGIIYYLLDIHAMQVL 227
+ W EG++ YL + A L
Sbjct: 173 KVPAAWSAEGLLVYL-PVEAQDAL 195
|
|
| UNIPROTKB|O86359 MT3874 "Putative S-adenosyl-L-methionine-dependent methyltransferase Rv3767c/MT3874" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P71987 MT1770 "Putative S-adenosyl-L-methionine-dependent methyltransferase Rv1729c/MT1770" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P95073 Rv0725c "Uncharacterized protein" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P96823 MT0154 "Putative S-adenosyl-L-methionine-dependent methyltransferase Rv0146" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O33293 MT2821 "Conserved protein" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O53686 MT0293 "Putative S-adenosyl-L-methionine-dependent methyltransferase Rv0281/MT0293" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285065 DDB_G0285065 "leucine carboxyl methyltransferase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF14_0376 PF14_0376 "hypothetical protein" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IL72 PF14_0376 "Leucine carboxyl methyltransferase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| pfam04072 | 175 | pfam04072, LCM, Leucine carboxyl methyltransferase | 5e-38 | |
| COG3315 | 297 | COG3315, COG3315, O-Methyltransferase involved in | 5e-28 | |
| TIGR00027 | 260 | TIGR00027, mthyl_TIGR00027, methyltransferase, TIG | 9e-25 |
| >gnl|CDD|217872 pfam04072, LCM, Leucine carboxyl methyltransferase | Back alignment and domain information |
|---|
Score = 133 bits (336), Expect = 5e-38
Identities = 63/191 (32%), Positives = 99/191 (51%), Gaps = 21/191 (10%)
Query: 46 ACQTAAGRAMW----KHVIHDPLADLLAGETYLRNVHEKIKKDRLNNAREISGVILAIRT 101
A TAA RA+ ++ DP A L +R + K R A +++ I A RT
Sbjct: 1 ALITAAARALESRRPDPLLDDPYAAEL-----VRAIDYDFSKLRPGGAPQLNLGI-AART 54
Query: 102 LWFDSQIEAALNSFNSREAQVVLLGAGMDTRAYRLNCLKE-SDVFEVDFSQVLQVKTALI 160
+FD + A L + + QVV+LGAG+DTRAYRL+ FEVD +V++ K L+
Sbjct: 55 RFFDDFLRAFLAA-HPGARQVVILGAGLDTRAYRLDWPAGGVRWFEVDLPEVIEFKRRLL 113
Query: 161 QTAMEFGDEQQHPRMTAKSLTTVAADIRENDWLEKLQLSGYKPEKNTVWVLEGIIYYLLD 220
A ++ VA D+R++DWL+ L+ +G+ P + T++V EG++ YL +
Sbjct: 114 PEAGARPPARRR---------YVAVDLRDDDWLDALRAAGFDPSRPTLFVAEGLLMYLTE 164
Query: 221 IHAMQVLKLIA 231
+L+ IA
Sbjct: 165 EAVDALLRRIA 175
|
Family of leucine carboxyl methyltransferases EC:2.1.1.-. This family may need divides a the full alignment contains a significantly shorter mouse sequence. Length = 175 |
| >gnl|CDD|225852 COG3315, COG3315, O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|232789 TIGR00027, mthyl_TIGR00027, methyltransferase, TIGR00027 family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| KOG2918 | 335 | consensus Carboxymethyl transferase [Posttranslati | 100.0 | |
| COG3315 | 297 | O-Methyltransferase involved in polyketide biosynt | 100.0 | |
| TIGR00027 | 260 | mthyl_TIGR00027 methyltransferase, putative, TIGR0 | 100.0 | |
| PF04072 | 183 | LCM: Leucine carboxyl methyltransferase; InterPro: | 100.0 | |
| PF04672 | 267 | Methyltransf_19: S-adenosyl methyltransferase; Int | 98.9 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 97.01 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 96.96 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 96.73 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 96.64 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 96.51 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 96.43 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 96.41 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 96.26 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 96.14 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 96.09 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 96.06 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 96.03 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 95.98 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 95.89 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 95.83 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 95.8 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 95.56 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 95.47 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 95.3 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 95.03 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 94.49 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 94.31 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 93.64 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 92.36 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 92.33 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 91.8 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 91.73 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 91.7 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 91.66 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 91.02 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 90.33 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 90.11 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 90.02 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 89.64 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 89.63 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 89.18 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 89.14 | |
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 88.32 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 88.31 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 88.27 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 88.08 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 87.52 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 87.14 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 86.56 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 86.41 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 86.3 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 86.27 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 85.33 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 85.31 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 85.12 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 84.69 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 84.57 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 84.5 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 84.14 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 82.06 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 81.44 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 81.3 | |
| PLN02366 | 308 | spermidine synthase | 81.04 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 80.89 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 80.66 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 80.36 |
| >KOG2918 consensus Carboxymethyl transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-44 Score=337.09 Aligned_cols=236 Identities=22% Similarity=0.274 Sum_probs=201.5
Q ss_pred ccccccchhHHHHHHHHHHHhhhcCCCCChhhhhhhcchhhhhhhhhcchhhhccccccchhhHHHHHHHHHHHHHHHHh
Q 019738 34 TIDAQWDYLQRTACQTAAGRAMWKHVIHDPLADLLAGETYLRNVHEKIKKDRLNNAREISGVILAIRTLWFDSQIEAALN 113 (336)
Q Consensus 34 ~v~~t~d~v~~Tal~~a~~RA~~~~~~~Dp~A~~f~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~Rt~~iD~~v~~fl~ 113 (336)
.||.|+++.+..... |...||++||++..|+... ..++.|.+|+| |++|+..|+..|.+||.
T Consensus 22 ~vq~Tnddss~ck~~-----~~~~gy~~d~~~~~~~~~~-------~~rr~P~inRG------y~~R~~aI~~~v~~Fl~ 83 (335)
T KOG2918|consen 22 AVQGTNDDSSLCKRS-----ATKSGYWHDPFIKLFVPSK-------KARRAPEINRG------YWARTMAIRHAVRAFLE 83 (335)
T ss_pred hhhhccchhhhhhhH-----HHhcCCccCchhhhhcccc-------ccCCCceecch------hhHHHHHHHHHHHHHHH
Confidence 478888877633322 3345999999999999641 35788999986 89999999999999999
Q ss_pred hcCCCccEEEEeCCCCcchhhhhcc---CCCceEEEcchHHHHHHHHHHHHhhhccCC----------CCCCCccCCCcE
Q 019738 114 SFNSREAQVVLLGAGMDTRAYRLNC---LKESDVFEVDFSQVLQVKTALIQTAMEFGD----------EQQHPRMTAKSL 180 (336)
Q Consensus 114 ~~~~g~~QVV~LGaGlDTr~~RL~~---~~~~~~~EvD~P~vi~~K~~~l~~~~~~~~----------~~~~~~l~s~~y 180 (336)
+.. +++||||||||+||++|||.. ...+.|||||||+++++|..++.+.+..++ +..+..+++.+|
T Consensus 84 ~~~-~~~qivnLGcG~D~l~frL~s~~~~~~~~fievDfp~~~~rKi~ik~~~~~s~~l~~~~~eD~~~~s~~~l~s~~Y 162 (335)
T KOG2918|consen 84 QTD-GKKQIVNLGAGFDTLYFRLLSSGELDRVKFIEVDFPEVVERKISIKRKPELSSILLGLHDEDVVDLSGTDLHSGRY 162 (335)
T ss_pred hcC-CceEEEEcCCCccchhhhhhccCCCCcceEEEecCcHHHHHHHhhcccCchhhhhhccccccccccCcceeccCce
Confidence 964 899999999999999999986 368999999999999999955555444221 124567889999
Q ss_pred EEEeccCCCChhhH-HhhhcCCCCCCcEEEEeeccccccChHHHHHHHHHHHHhCCCceEEEEEeccCcccccccCCeee
Q 019738 181 TTVAADIRENDWLE-KLQLSGYKPEKNTVWVLEGIIYYLLDIHAMQVLKLIADKCNLVHTVLLADFMNQPSTTLSSSIFH 259 (336)
Q Consensus 181 ~~i~~DL~d~~~~~-~L~~~g~d~~~Ptl~i~EGvl~YL~~~~~~~Ll~~l~~~~~~gs~~l~~D~~~~~~~~~~~a~f~ 259 (336)
++++|||+|.+.++ .|..+++|.+.||+||+||||+||+++++..||+|+++.|+. +.|+
T Consensus 163 ~~~g~DLrdl~ele~kL~~c~~d~~lpTi~iaEcvLvYM~pe~S~~Li~w~~~~F~~-------------------a~fv 223 (335)
T KOG2918|consen 163 HLIGCDLRDLNELEEKLKKCGLDTNLPTIFIAECVLVYMEPEESANLIKWAASKFEN-------------------AHFV 223 (335)
T ss_pred eeeccchhhhHHHHHHHHhccCCcCcceeehhhhhheeccHHHHHHHHHHHHHhCCc-------------------ccEE
Confidence 99999999998775 788899999999999999999999999999999999999977 4688
Q ss_pred ecCCCcccccCCCCcceeeeccCCCcccccCCCCCccchhhhcccCCCCcCCCCCCCCCceeEEEEEeec
Q 019738 260 FSSDWPDRLLPTLGFSNVRLSQIGDPDAHFGLMNDPLNLFNKLRSLPRSVQTHPDDGTPCRRLYLVQASG 329 (336)
Q Consensus 260 ~~~d~~e~~~~~~gF~~~m~~~~~e~~~~f~~~~~pl~~~~~~~~~~~~~~~~p~~~~~~~R~~~~~~~~ 329 (336)
+| ||+.|+|+||++|+ .||.++++|| +++..|||+++|++||. --||.
T Consensus 224 ~Y----EQi~~~D~Fg~vM~-------~nlk~r~~~L----------~gle~y~s~Esq~~Rf~-~~Gw~ 271 (335)
T KOG2918|consen 224 NY----EQINPNDRFGKVML-------ANLKRRGCPL----------HGLETYNSIESQRSRFL-KAGWE 271 (335)
T ss_pred EE----eccCCCChHHHHHH-------HHHHhcCCCC----------chhhhcccHHHHHHHHH-hcCCc
Confidence 88 99999999999999 8999999999 89999999999999996 44454
|
|
| >COG3315 O-Methyltransferase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family | Back alignment and domain information |
|---|
| >PF04072 LCM: Leucine carboxyl methyltransferase; InterPro: IPR007213 This entry represents a group of leucine carboxymethyltransferases which methylate the carboxyl group of leucine residues to form alpha-leucine ester residues | Back alignment and domain information |
|---|
| >PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 336 | ||||
| 2ckd_A | 310 | Crystal Structure Of Ml2640 From Mycobacterium Lepr | 2e-09 |
| >pdb|2CKD|A Chain A, Crystal Structure Of Ml2640 From Mycobacterium Leprae Length = 310 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 336 | |||
| 2uyo_A | 310 | Hypothetical protein ML2640; putative methyltransf | 9e-32 | |
| 3iei_A | 334 | Leucine carboxyl methyltransferase 1; LCMT-1, S-ad | 1e-23 | |
| 1rjd_A | 334 | PPM1P, carboxy methyl transferase for protein phos | 6e-22 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-06 |
| >2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Length = 310 | Back alignment and structure |
|---|
Score = 120 bits (301), Expect = 9e-32
Identities = 63/306 (20%), Positives = 103/306 (33%), Gaps = 36/306 (11%)
Query: 44 RTACQTAAGRAMW----KHVIHDPLADLLAGETYLRNVHEKIKKDRLNNAREIS------ 93
TA AA RA +I DP A LL T + E + + E
Sbjct: 16 TTAVMVAAARAAETDRPDALIRDPYAKLLVTNTGAGALWEAMLDPSMVAKVEAIDAEAAA 75
Query: 94 -----GVILAIRTLWFDSQIEAALNSFNSREAQVVLLGAGMDTRAYRLNCLKESDVFEVD 148
A+RT +FD+ A+ Q V+L +G+D+RAYRL+ + V+E+D
Sbjct: 76 MVEHMRSYQAVRTNFFDTYFNNAVID---GIRQFVILASGLDSRAYRLDWPTGTTVYEID 132
Query: 149 FSQVLQVKTALIQTAMEFGDEQQHPRMTAKSLTTVAADIRENDWLEKLQLSGYKPEKNTV 208
+VL K+ + +H V D+R++ W L+ +G+ P T
Sbjct: 133 QPKVLAYKSTTL---------AEHGVTPTADRREVPIDLRQD-WPPALRSAGFDPSARTA 182
Query: 209 WVLEGIIYYLLDIHAMQVLKLIADKCNLVHTVLLADFMNQPSTTLSSSIFHFSSDWPDRL 268
W+ EG++ YL + I V + + + + D L
Sbjct: 183 WLAEGLLMYLPATAQDGLFTEIGGLSA-VGSRIAVETSPLHGDEWREQMQLRFRRVSDAL 241
Query: 269 LPTLGFSNVRLSQIGDPDAH-------FGLMNDPLNLFNKLRSLPRSVQTHPDDGTPCRR 321
L + A G + +++R + R P
Sbjct: 242 GFEQAVDVQELIYHDENRAVVADWLNRHGWRATAQSAPDEMRRVGRWGDGVPMADDKDAF 301
Query: 322 LYLVQA 327
V A
Sbjct: 302 AEFVTA 307
|
| >3iei_A Leucine carboxyl methyltransferase 1; LCMT-1, S-adenosyl-L-methionine; HET: SAH MES; 1.90A {Homo sapiens} PDB: 3p71_T* 3mnt_A* 3o7w_A* Length = 334 | Back alignment and structure |
|---|
| >1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Length = 334 | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| 3iei_A | 334 | Leucine carboxyl methyltransferase 1; LCMT-1, S-ad | 100.0 | |
| 1rjd_A | 334 | PPM1P, carboxy methyl transferase for protein phos | 100.0 | |
| 2uyo_A | 310 | Hypothetical protein ML2640; putative methyltransf | 100.0 | |
| 2zwa_A | 695 | Leucine carboxyl methyltransferase 2; HET: SAH CIT | 100.0 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 99.09 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 98.9 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 97.57 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 97.28 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 97.19 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 97.11 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 97.03 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 97.02 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 96.97 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 96.8 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 96.76 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 96.7 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 96.69 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 96.66 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 96.58 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 96.54 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 96.48 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 96.39 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 96.34 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 96.34 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 96.32 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 96.24 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 96.23 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 96.19 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 96.17 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 96.16 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 96.13 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 96.1 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 96.08 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 96.04 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 96.02 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 96.02 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 96.02 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 96.01 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 96.0 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 95.95 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 95.9 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 95.89 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 95.89 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 95.88 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 95.81 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 95.77 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 95.73 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 95.66 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 95.54 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 95.42 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 95.4 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 95.35 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 95.34 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 95.25 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 95.12 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 95.0 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 94.97 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 94.97 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 94.88 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 94.86 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 94.8 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 94.67 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 94.48 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 94.45 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 94.37 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 94.25 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 94.16 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 94.02 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 93.96 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 93.95 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 93.85 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 93.81 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 93.75 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 93.73 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 93.51 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 93.5 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 93.48 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 93.48 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 93.43 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 93.34 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 93.13 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 93.1 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 93.03 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 92.96 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 92.82 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 92.8 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 92.72 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 92.59 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 92.49 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 92.48 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 92.44 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 91.58 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 91.41 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 91.36 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 90.94 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 90.94 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 90.75 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 90.51 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 90.11 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 89.69 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 89.63 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 89.53 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 89.41 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 89.38 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 89.34 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 89.1 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 88.76 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 88.47 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 88.2 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 88.06 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 87.9 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 87.81 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 87.01 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 87.01 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 86.9 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 86.16 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 86.15 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 85.1 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 84.96 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 84.86 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 83.93 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 82.86 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 82.7 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 82.65 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 81.88 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 81.63 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 81.51 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 80.87 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 80.66 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 80.55 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 80.44 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 80.26 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 80.05 |
| >3iei_A Leucine carboxyl methyltransferase 1; LCMT-1, S-adenosyl-L-methionine; HET: SAH MES; 1.90A {Homo sapiens} PDB: 3p71_T* 3mnt_A* 3o7w_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.6e-48 Score=371.62 Aligned_cols=254 Identities=20% Similarity=0.201 Sum_probs=200.0
Q ss_pred cccchhhchhhhhhccccccccccchhHHHHHHHHHHHhhhcCCCCChhhhhhhcchhhhhhhhhcchhhhccccccchh
Q 019738 16 ELKLSQLLLTDTVRNLHATIDAQWDYLQRTACQTAAGRAMWKHVIHDPLADLLAGETYLRNVHEKIKKDRLNNAREISGV 95 (336)
Q Consensus 16 ~~~~~~~~~~~~~~~~~~~v~~t~d~v~~Tal~~a~~RA~~~~~~~Dp~A~~f~~~~~~~~~~~~i~~~~~~~~~~~~~~ 95 (336)
|-.|--+|+.++...--.+||+||++...++++ |++.|||+|||+++|+++.. .++.|++|+|
T Consensus 7 ~~~~~~~~~~~~~~~~d~~V~~T~~da~~sk~s-----av~~gY~~Dpf~~~Fv~~~~-------~rr~P~inrG----- 69 (334)
T 3iei_A 7 ESSITSCCSTSSMDENDEGVRGTCEDASLCKRF-----AVSIGYWHDPYIQHFVRLSK-------ERKAPEINRG----- 69 (334)
T ss_dssp ------------------CTTHHHHHHHHHHHH-----HHHHTSSCCSSGGGTSCCCC-------SCCCHHHHHH-----
T ss_pred cccCCcccccccCCCchhhhhcccHHHHHHHHH-----HHHcCCCCCHHHHHHcCccc-------CCCCchHHHH-----
Confidence 344666888888887678899999998887766 45569999999999997531 4678888875
Q ss_pred hHHHHHHHHHHHHHHHHhhcCCCccEEEEeCCCCcchhhhhccC--CCceEEEcchHHHHHHHHHHHHhhhccC------
Q 019738 96 ILAIRTLWFDSQIEAALNSFNSREAQVVLLGAGMDTRAYRLNCL--KESDVFEVDFSQVLQVKTALIQTAMEFG------ 167 (336)
Q Consensus 96 ~~~~Rt~~iD~~v~~fl~~~~~g~~QVV~LGaGlDTr~~RL~~~--~~~~~~EvD~P~vi~~K~~~l~~~~~~~------ 167 (336)
+++|+++||+.|++|+++++ +.+||||||||||||+|||.++ .+++|||||+|+|++.|+++|.+.+.+.
T Consensus 70 -~~~Rt~~iD~~v~~fl~~~~-~~~QVV~LGaGlDTr~~RL~~~~~~~~~~~EVD~P~vi~~K~~~l~~~~~l~~~lg~~ 147 (334)
T 3iei_A 70 -YFARVHGVSQLIKAFLRKTE-CHCQIVNLGAGMDTTFWRLKDEDLLSSKYFEVDFPMIVTRKLHSIKCKPPLSSPILEL 147 (334)
T ss_dssp -HHHHHHHHHHHHHHHHHHTT-TCSEEEEETCTTCCHHHHHHHTTCCCSEEEEEECHHHHHHHHHHHHHCHHHHHHHHHH
T ss_pred -HHHHHHHHHHHHHHHHHhCC-CCCEEEEeCCCcCchHHHhcCCCCCCCeEEECCcHHHHHHHHHHHhhchhhhhhhccc
Confidence 89999999999999999984 5889999999999999999985 4799999999999999999998754320
Q ss_pred -C----CCCCCccCCCcEEEEeccCCCChhhH-HhhhcCCCCCCcEEEEeeccccccChHHHHHHHHHHHHhCCCceEEE
Q 019738 168 -D----EQQHPRMTAKSLTTVAADIRENDWLE-KLQLSGYKPEKNTVWVLEGIIYYLLDIHAMQVLKLIADKCNLVHTVL 241 (336)
Q Consensus 168 -~----~~~~~~l~s~~y~~i~~DL~d~~~~~-~L~~~g~d~~~Ptl~i~EGvl~YL~~~~~~~Ll~~l~~~~~~gs~~l 241 (336)
. ...+..+.+++|++|++||++.+|++ .|.++|+|++.||+||+|||||||+++++++||+++++.|++|+
T Consensus 148 ~~~~~~~~~~~~l~s~~y~~v~~DL~d~~~l~~~L~~~g~d~~~Ptl~iaEGvL~YL~~~~~~~ll~~ia~~f~~~~--- 224 (334)
T 3iei_A 148 HSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAM--- 224 (334)
T ss_dssp SSSSSCBCCTTEEECSSEEEEECCTTCHHHHHHHHHHTTCCTTSCEEEEEESCGGGSCHHHHHHHHHHHHHHCSSEE---
T ss_pred ccccccccccccCCCCceEEEccccccchhHHHHHHhcCCCCCCCEEEEEchhhhCCCHHHHHHHHHHHHHhCCCce---
Confidence 0 01122345789999999999988885 68889999999999999999999999999999999999998854
Q ss_pred EEeccCcccccccCCeeeecCCCcccccCCCCcceeeeccCCCcccccCCCCCccchhhhcccCCCCcCCCCCCCCCcee
Q 019738 242 LADFMNQPSTTLSSSIFHFSSDWPDRLLPTLGFSNVRLSQIGDPDAHFGLMNDPLNLFNKLRSLPRSVQTHPDDGTPCRR 321 (336)
Q Consensus 242 ~~D~~~~~~~~~~~a~f~~~~d~~e~~~~~~gF~~~m~~~~~e~~~~f~~~~~pl~~~~~~~~~~~~~~~~p~~~~~~~R 321 (336)
|..| |++.|+++|+++|+ .||.+.++|+ .++..||+.++|.+|
T Consensus 225 ----------------~i~y----E~i~p~d~fg~~M~-------~~l~~~g~pl----------~sl~~y~t~~~~~~r 267 (334)
T 3iei_A 225 ----------------FINY----EQVNMGDRFGQIMI-------ENLRRRQCDL----------AGVETCKSLESQKER 267 (334)
T ss_dssp ----------------EEEE----EECCTTSHHHHHHH-------HHHHTTTCCC----------TTGGGGGCHHHHHHH
T ss_pred ----------------EEEE----eccCCCCHHHHHHH-------HHHHHhCCCC----------cccccCCCHHHHHHH
Confidence 3334 77778899999999 7888899999 899999999999999
Q ss_pred EEEEEeec
Q 019738 322 LYLVQASG 329 (336)
Q Consensus 322 ~~~~~~~~ 329 (336)
|. -.||.
T Consensus 268 ~~-~~Gw~ 274 (334)
T 3iei_A 268 LL-SNGWE 274 (334)
T ss_dssp HH-TTTCS
T ss_pred HH-HcCCC
Confidence 84 44444
|
| >1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A | Back alignment and structure |
|---|
| >2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* | Back alignment and structure |
|---|
| >2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 336 | ||||
| d2uyoa1 | 297 | c.66.1.57 (A:14-310) Putative methyltransferase ML | 1e-25 | |
| d1rjda_ | 328 | c.66.1.37 (A:) Leucine carboxy methyltransferase P | 1e-24 |
| >d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Length = 297 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: ML2640-like domain: Putative methyltransferase ML2640 species: Mycobacterium leprae [TaxId: 1769]
Score = 101 bits (253), Expect = 1e-25
Identities = 58/260 (22%), Positives = 92/260 (35%), Gaps = 29/260 (11%)
Query: 44 RTACQTAAGRAMW----KHVIHDPLADLLAGETYLRNVHEKIKKDRLN-----------N 88
TA AA RA +I DP A LL T + E + +
Sbjct: 3 TTAVMVAAARAAETDRPDALIRDPYAKLLVTNTGAGALWEAMLDPSMVAKVEAIDAEAAA 62
Query: 89 AREISGVILAIRTLWFDSQIEAALNSFNSREAQVVLLGAGMDTRAYRLNCLKESDVFEVD 148
E A+RT +FD+ A+ Q V+L +G+D+RAYRL+ + V+E+D
Sbjct: 63 MVEHMRSYQAVRTNFFDTYFNNAVIDGIR---QFVILASGLDSRAYRLDWPTGTTVYEID 119
Query: 149 FSQVLQVKTALIQTAMEFGDEQQHPRMTAKSLTTVAADIRENDWLEKLQLSGYKPEKNTV 208
+VL K+ + +H V D+R+ DW L+ +G+ P T
Sbjct: 120 QPKVLAYKSTTL---------AEHGVTPTADRREVPIDLRQ-DWPPALRSAGFDPSARTA 169
Query: 209 WVLEGIIYYLLDIHAMQVLKLIADKCNLVHTVLLADFMNQPSTTLSSSIFHFSSDWPDRL 268
W+ EG++ YL + I V + + + + D L
Sbjct: 170 WLAEGLLMYLPATAQDGLFTEIGGLSA-VGSRIAVETSPLHGDEWREQMQLRFRRVSDAL 228
Query: 269 LPTLGFSNVRLSQIGDPDAH 288
L + A
Sbjct: 229 GFEQAVDVQELIYHDENRAV 248
|
| >d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 336 | |||
| d1rjda_ | 328 | Leucine carboxy methyltransferase Ppm1 {Baker's ye | 100.0 | |
| d2uyoa1 | 297 | Putative methyltransferase ML2640 {Mycobacterium l | 100.0 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 97.67 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 97.54 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 97.43 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 97.41 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 97.11 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 96.49 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 96.32 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 96.16 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 96.01 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 95.83 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 95.8 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 95.78 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 95.78 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 95.74 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 95.6 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 95.58 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 95.55 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 95.25 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 94.75 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 94.6 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 94.54 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 94.34 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 94.17 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 93.35 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 93.32 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 92.66 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 91.01 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 89.74 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 88.36 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 87.68 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 87.16 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 86.82 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 85.99 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 85.0 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 84.44 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 84.43 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 83.78 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 83.13 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 82.68 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 82.28 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 82.09 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 81.26 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 80.6 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 80.12 |
| >d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Leucine carboxy methyltransferase Ppm1 domain: Leucine carboxy methyltransferase Ppm1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=6.3e-46 Score=354.45 Aligned_cols=233 Identities=16% Similarity=0.145 Sum_probs=188.8
Q ss_pred hHHHHHHHHHH--HhhhcCCCCChhhhhhhcchhhhh----------h------------hhhcchhhhccccccchhhH
Q 019738 42 LQRTACQTAAG--RAMWKHVIHDPLADLLAGETYLRN----------V------------HEKIKKDRLNNAREISGVIL 97 (336)
Q Consensus 42 v~~Tal~~a~~--RA~~~~~~~Dp~A~~f~~~~~~~~----------~------------~~~i~~~~~~~~~~~~~~~~ 97 (336)
|+.|+...+.+ +|++.||+.|||+..|+....... + ....++.|+||+| |
T Consensus 4 Vq~T~~da~~sK~SAv~~GY~~d~~~~~f~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~PlINrG------y 77 (328)
T d1rjda_ 4 IQQTDYDALSCKLAAISVGYLPSSGLQRLSVDLSKKYTEWHRSYLITLKKFSRRAFGKVDKAMRSSFPVMNYG------T 77 (328)
T ss_dssp HHTHHHHHHHHHHHHHHHTSCCCTTTTTCCHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHTCCHHHHHH------H
T ss_pred hhcccHHHHHHHHHHHHcCCCCchhHHHhhhhccccccccccccccccccccccccccccccccccCCchhhh------H
Confidence 34444443333 456779999999999974322110 0 0012345888886 8
Q ss_pred HHHHHHHHHHHHHHHhhcCCCccEEEEeCCCCcchhhhhcc-CCCceEEEcchHHHHHHHHHHHHhhhccC---------
Q 019738 98 AIRTLWFDSQIEAALNSFNSREAQVVLLGAGMDTRAYRLNC-LKESDVFEVDFSQVLQVKTALIQTAMEFG--------- 167 (336)
Q Consensus 98 ~~Rt~~iD~~v~~fl~~~~~g~~QVV~LGaGlDTr~~RL~~-~~~~~~~EvD~P~vi~~K~~~l~~~~~~~--------- 167 (336)
++|+++||.+|++|+++++ ++||||||||||||+||+.. .++++|||||+|+|++.|+++|++.+.+.
T Consensus 78 ~~Rt~~id~~v~~Fl~~~~--~~QVV~LGaG~DTr~~Rl~~~~~~~~~~EvD~p~vi~~K~~~i~~~~~l~~~l~~~~~~ 155 (328)
T d1rjda_ 78 YLRTVGIDAAILEFLVANE--KVQVVNLGCGSDLRMLPLLQMFPHLAYVDIDYNESVELKNSILRESEILRISLGLSKED 155 (328)
T ss_dssp HHHHHHHHHHHHHHHHHCS--SEEEEEETCTTCCTHHHHHHHCTTEEEEEEECHHHHHHHHHHHHHSHHHHHHHTCCSSC
T ss_pred HHHHHHHHHHHHHHHHHCC--CcEEEEeCCccchHHHHhhccCCCcEEEECCcHHHHHHHHHHHHhchhhhhhccccccc
Confidence 8999999999999999875 78999999999999999964 57899999999999999999998865431
Q ss_pred CCCCCCccCCCcEEEEeccCCCChhhHHhhhcCCCCCCcEEEEeeccccccChHHHHHHHHHHHHhCCCceEEEEEeccC
Q 019738 168 DEQQHPRMTAKSLTTVAADIRENDWLEKLQLSGYKPEKNTVWVLEGIIYYLLDIHAMQVLKLIADKCNLVHTVLLADFMN 247 (336)
Q Consensus 168 ~~~~~~~l~s~~y~~i~~DL~d~~~~~~L~~~g~d~~~Ptl~i~EGvl~YL~~~~~~~Ll~~l~~~~~~gs~~l~~D~~~ 247 (336)
....+..+.+++|++++|||++.+|+++|.++|+|++.|||||+||||+||+++++++||+++++.|++++
T Consensus 156 ~~~~~~~~~s~~y~lv~~DL~d~~~~~~l~~~~~d~~~PTl~iaE~vl~Yl~~~~~~~li~~~~~~f~~~~--------- 226 (328)
T d1rjda_ 156 TAKSPFLIDQGRYKLAACDLNDITETTRLLDVCTKREIPTIVISECLLCYMHNNESQLLINTIMSKFSHGL--------- 226 (328)
T ss_dssp CCCTTEEEECSSEEEEECCTTCHHHHHHHHHTTCCTTSCEEEEEESCGGGSCHHHHHHHHHHHHHHCSSEE---------
T ss_pred cccccccCCCCCeEEEecCCCCcHhhHHHHHccCCCCCCeEEEEeeehhcCCHHHHHHHHHHHHHhCCCce---------
Confidence 11233456789999999999999999999899999999999999999999999999999999999998742
Q ss_pred cccccccCCeeeecCCCcccc---cCCCCcceeeeccCCCcccccCC-CCCccchhhhcccCCCCcCCCCCCCCCceeE
Q 019738 248 QPSTTLSSSIFHFSSDWPDRL---LPTLGFSNVRLSQIGDPDAHFGL-MNDPLNLFNKLRSLPRSVQTHPDDGTPCRRL 322 (336)
Q Consensus 248 ~~~~~~~~a~f~~~~d~~e~~---~~~~gF~~~m~~~~~e~~~~f~~-~~~pl~~~~~~~~~~~~~~~~p~~~~~~~R~ 322 (336)
|+.| |++ .|+|+||++|+ .||.+ .++|+ +++..|||+++|.+||
T Consensus 227 ----------~i~Y----E~i~~~~p~D~FG~~M~-------~nl~~~r~~~l----------~~~~~~~t~~~~~~r~ 274 (328)
T d1rjda_ 227 ----------WISY----DPIGGSQPNDRFGAIMQ-------SNLKESRNLEM----------PTLMTYNSKEKYASRW 274 (328)
T ss_dssp ----------EEEE----EECCCCSTTCCHHHHHH-------HHHHHHHCCCC----------TTTTTTCSHHHHHGGG
T ss_pred ----------EEEe----ccCCCCCCCChHHHHHH-------HHHHHhcCCCC----------CccccCCCHHHHHHHH
Confidence 4445 666 47899999999 67754 57899 7999999999999998
|
| >d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|