Citrus Sinensis ID: 019790


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-----
MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNIDGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVGKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIMLVP
cEEEEEccccccccEEEEEccccccccccEEEEEEEEcccHHHHHHHHcccccccccccccccEEEEEEEEEcccccccccccEEEEEEcccccccEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHccccEEEccccccHHHHHHHHHccccccEEEEccccccHHHHHHHHccccEEEEEEccccccccccHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEcEEcHHHHHHHHHHHHccccEEEEEEEc
ccEEEEEccccccEEEEEcccccccccccEEEEEEEEccccHHHHHHccccccccccccccccEEEEEEEEEcccccccccccEEEEEEcccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccEEEEcccccHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHcccEEEEcccccHHHHHHHHHccccEEEEEEcccHHHHHHHHccEEEEEEEEEccccccccccEccHHHHHcHcEEEccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHccccEEEEEEcc
mkaivitqpgspevlqlqevedpqikddEVLIKVEATALNRadtlqrkgsypppkgaspypglecsgtilsvgknvsrwkvGDQVCALlggggyaekvavpagqvlpvpsgvslkdaaafpevACTVWSTVFmtshlspgesflvdfcsisysdvhggssgiGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFqrnlgslnidgrlfiigtqggakteLNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEknvwpaiavgkvkpvIYKYLPLCEAAEAHQLMESSQHIGKIMLVP
mkaivitqpgspevlqlqeVEDPQIKDDEVLIKVEATalnradtlqrkgsypppkgaspypGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFvarvkeetggkgvDVILDCMGASYFQRNLGSLNIDGRLFIIGTQGGAKTELNITSLFAKRLTVqaaglrsrstenkalivseveknvwpaiavgKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIMLVP
MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNIDGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVGKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIMLVP
*****************************VLIKVEA*************************GLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNIDGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVGKVKPVIYKYLPLCEAAEAH****************
MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNIDGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVGKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIMLVP
MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNIDGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVGKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIMLVP
MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNIDGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVGKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIMLVP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNIDGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVGKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIMLVP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query335 2.2.26 [Sep-21-2011]
Q53FA7332 Quinone oxidoreductase PI yes no 0.964 0.972 0.405 7e-63
Q6AYT0329 Quinone oxidoreductase OS yes no 0.946 0.963 0.337 5e-37
P11415329 Quinone oxidoreductase OS yes no 0.949 0.966 0.323 7e-36
O97764330 Zeta-crystallin OS=Bos ta no no 0.946 0.960 0.319 9e-36
P47199331 Quinone oxidoreductase OS yes no 0.934 0.945 0.334 8e-35
Q5R4S7329 Quinone oxidoreductase OS no no 0.946 0.963 0.307 1e-34
Q08257329 Quinone oxidoreductase OS no no 0.946 0.963 0.304 6e-34
Q0MVN8329 Quinone oxidoreductase OS no no 0.946 0.963 0.310 7e-34
Q28452330 Quinone oxidoreductase OS N/A no 0.946 0.960 0.316 1e-32
P96202 2188 Phthiocerol synthesis pol no no 0.940 0.143 0.297 2e-32
>sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 Back     alignment and function desciption
 Score =  241 bits (614), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 137/338 (40%), Positives = 198/338 (58%), Gaps = 15/338 (4%)

Query: 1   MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY 60
           M A+   +PG PE L ++EV  P   + EVL+KV A+ALNRAD +QR+G Y PP GAS  
Sbjct: 1   MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNI 60

Query: 61  PGLECSGTILSVGKNVS-RWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAA 119
            GLE SG +  +G      WK+GD   ALL GGG A+ V VP G ++P+P G++L  AAA
Sbjct: 61  LGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAA 120

Query: 120 FPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFV 179
            PE     W T F   HL      + +  +  Y  +H G SG+GT AIQ+ +  G    V
Sbjct: 121 IPEA----WLTAFQLLHL------VGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLV 170

Query: 180 TAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLN 239
           TAGS++KL + + LGA    NYK EDF     + T G GV++ILDC+G SY+++N+  L 
Sbjct: 171 TAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLA 230

Query: 240 IDGRLFIIGTQGGAKTELNITS-LFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIA 298
           +DGR  + G  GG      + S L  KR ++  + LRSR  + K ++V+   + + P  +
Sbjct: 231 LDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFS 290

Query: 299 V---GKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIML 333
                ++ PV+ +  P+ E  EAH+ ME++++IGKI+L
Sbjct: 291 TEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVL 328




May be involved in the generation of reactive oxygen species (ROS). Has low NADPH-dependent beta-naphthoquinone reductase activity, with a preference for 1,2-beta-naphthoquinone over 1,4-beta-naphthoquinone. Has low NADPH-dependent diamine reductase activity (in vitro).
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 Back     alignment and function description
>sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 Back     alignment and function description
>sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 Back     alignment and function description
>sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=2 SV=1 Back     alignment and function description
>sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 Back     alignment and function description
>sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 Back     alignment and function description
>sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 Back     alignment and function description
>sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 Back     alignment and function description
>sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis GN=ppsC PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query335
224078882325 predicted protein [Populus trichocarpa] 0.967 0.996 0.826 1e-158
357446363325 Quinone oxidoreductase PIG3 [Medicago tr 0.967 0.996 0.808 1e-154
449443438325 PREDICTED: quinone oxidoreductase PIG3-l 0.970 1.0 0.808 1e-153
388523009325 unknown [Medicago truncatula] 0.967 0.996 0.802 1e-153
147863686325 hypothetical protein VITISV_008189 [Viti 0.970 1.0 0.782 1e-151
359496322325 PREDICTED: LOW QUALITY PROTEIN: quinone 0.970 1.0 0.782 1e-151
255560828325 quinone oxidoreductase, putative [Ricinu 0.967 0.996 0.796 1e-151
358249074325 uncharacterized protein LOC100813682 [Gl 0.970 1.0 0.791 1e-150
147766549325 hypothetical protein VITISV_002784 [Viti 0.970 1.0 0.779 1e-150
357446353325 Quinone oxidoreductase [Medicago truncat 0.967 0.996 0.790 1e-149
>gi|224078882|ref|XP_002305665.1| predicted protein [Populus trichocarpa] gi|222848629|gb|EEE86176.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 276/334 (82%), Positives = 298/334 (89%), Gaps = 10/334 (2%)

Query: 1   MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY 60
           MKA+VIT PG PEVLQLQEVEDPQI +DEVLIKVEATALNRADTLQR+G YPPPKGASPY
Sbjct: 1   MKAVVITTPGGPEVLQLQEVEDPQINEDEVLIKVEATALNRADTLQRQGKYPPPKGASPY 60

Query: 61  PGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAF 120
           PGLECSGTI +VGKNVSRWK+GDQVCALL GGGYAEKVAVPAGQVLPVP GVSLKDAAA 
Sbjct: 61  PGLECSGTIEAVGKNVSRWKIGDQVCALLSGGGYAEKVAVPAGQVLPVPQGVSLKDAAAL 120

Query: 121 PEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVT 180
           PEVACTVWSTVFM S LS GE+FLV          HGGSSGIGTFAIQ+ K QGV+VFVT
Sbjct: 121 PEVACTVWSTVFMMSRLSAGETFLV----------HGGSSGIGTFAIQIAKHQGVKVFVT 170

Query: 181 AGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNI 240
           AGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILD +GA YFQ+N+ SLNI
Sbjct: 171 AGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDSVGAPYFQKNVDSLNI 230

Query: 241 DGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVG 300
           DGRLF++G  GGA T++N+ SLFAKR+TVQAAGLR+R+ ENKA IVSEVEKNVWPAI  G
Sbjct: 231 DGRLFLLGFMGGAVTQVNLASLFAKRITVQAAGLRTRTLENKAEIVSEVEKNVWPAIVAG 290

Query: 301 KVKPVIYKYLPLCEAAEAHQLMESSQHIGKIMLV 334
           KVKPV+YKYLPL EAAE H+LMESSQHIGKI+LV
Sbjct: 291 KVKPVVYKYLPLSEAAEGHRLMESSQHIGKILLV 324




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357446363|ref|XP_003593459.1| Quinone oxidoreductase PIG3 [Medicago truncatula] gi|217072752|gb|ACJ84736.1| unknown [Medicago truncatula] gi|355482507|gb|AES63710.1| Quinone oxidoreductase PIG3 [Medicago truncatula] gi|388520243|gb|AFK48183.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449443438|ref|XP_004139484.1| PREDICTED: quinone oxidoreductase PIG3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388523009|gb|AFK49566.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|147863686|emb|CAN83618.1| hypothetical protein VITISV_008189 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496322|ref|XP_002267967.2| PREDICTED: LOW QUALITY PROTEIN: quinone oxidoreductase PIG3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560828|ref|XP_002521427.1| quinone oxidoreductase, putative [Ricinus communis] gi|223539326|gb|EEF40917.1| quinone oxidoreductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358249074|ref|NP_001240244.1| uncharacterized protein LOC100813682 [Glycine max] gi|255642907|gb|ACU22674.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|147766549|emb|CAN76421.1| hypothetical protein VITISV_002784 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357446353|ref|XP_003593454.1| Quinone oxidoreductase [Medicago truncatula] gi|355482502|gb|AES63705.1| Quinone oxidoreductase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query335
TAIR|locus:2119682325 AT4G21580 [Arabidopsis thalian 0.964 0.993 0.750 1.2e-129
UNIPROTKB|P72043328 Rv3777 "Oxidoreductase" [Mycob 0.955 0.975 0.523 7.2e-84
TIGR_CMR|SPO_0231327 SPO_0231 "alcohol dehydrogenas 0.955 0.978 0.486 2.2e-73
TIGR_CMR|SO_0640332 SO_0640 "alcohol dehydrogenase 0.955 0.963 0.424 3.1e-67
UNIPROTKB|F1NUE4337 TP53I3 "Uncharacterized protei 0.940 0.934 0.421 2.1e-61
UNIPROTKB|Q53FA7332 TP53I3 "Quinone oxidoreductase 0.964 0.972 0.414 3.5e-59
UNIPROTKB|Q0VC75332 TP53I3 "Uncharacterized protei 0.964 0.972 0.399 7.3e-59
UNIPROTKB|E2RR83332 TP53I3 "Uncharacterized protei 0.964 0.972 0.402 1.9e-58
UNIPROTKB|F1SDJ3332 TP53I3 "Uncharacterized protei 0.964 0.972 0.393 8.4e-58
TIGR_CMR|GSU_2637328 GSU_2637 "alcohol dehydrogenas 0.961 0.981 0.401 8.4e-58
TAIR|locus:2119682 AT4G21580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1272 (452.8 bits), Expect = 1.2e-129, P = 1.2e-129
 Identities = 250/333 (75%), Positives = 277/333 (83%)

Query:     1 MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY 60
             MKAIVI++PG PEVLQL++V DP++KDDEVLI+V ATALNRADTLQR G Y PP G+SPY
Sbjct:     1 MKAIVISEPGKPEVLQLRDVADPEVKDDEVLIRVLATALNRADTLQRLGLYNPPPGSSPY 60

Query:    61 PGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAF 120
              GLECSGTI SVGK VSRWKVGDQVCALL GGGYAEKV+VPAGQ+ P+P+G+SLKDAAAF
Sbjct:    61 LGLECSGTIESVGKGVSRWKVGDQVCALLSGGGYAEKVSVPAGQIFPIPAGISLKDAAAF 120

Query:   121 PEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVT 180
             PEVACTVWSTVFM   LS GESFL+          HGGSSGIGTFAIQ+ K  GVRVFVT
Sbjct:   121 PEVACTVWSTVFMMGRLSVGESFLI----------HGGSSGIGTFAIQIAKHLGVRVFVT 170

Query:   181 AGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNI 240
             AGS+EKLA CK+LGADVCINYKTEDFVA+VK ET GKGVDVILDC+GA Y Q+NL SLN 
Sbjct:   171 AGSDEKLAACKELGADVCINYKTEDFVAKVKAETDGKGVDVILDCIGAPYLQKNLDSLNF 230

Query:   241 DGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVG 300
             DGRL IIG  GGA  E+ ++SL  KRLTV  A LR RS ENKA++V EVEKNVWPAI  G
Sbjct:   231 DGRLCIIGLMGGANAEIKLSSLLPKRLTVLGAALRPRSPENKAVVVREVEKNVWPAIEAG 290

Query:   301 KVKPVIYKYLPLCEAAEAHQLMESSQHIGKIML 333
             KVKPVIYKYLPL +AAE H LMESS HIGKI+L
Sbjct:   291 KVKPVIYKYLPLSQAAEGHSLMESSNHIGKILL 323




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005739 "mitochondrion" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0009610 "response to symbiotic fungus" evidence=RCA
UNIPROTKB|P72043 Rv3777 "Oxidoreductase" [Mycobacterium tuberculosis H37Rv (taxid:83332)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0231 SPO_0231 "alcohol dehydrogenase, zinc-containing" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0640 SO_0640 "alcohol dehydrogenase, zinc-containing" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUE4 TP53I3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q53FA7 TP53I3 "Quinone oxidoreductase PIG3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VC75 TP53I3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR83 TP53I3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDJ3 TP53I3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2637 GSU_2637 "alcohol dehydrogenase, zinc-containing" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6AYT0QOR_RAT1, ., 6, ., 5, ., 50.33720.94620.9635yesno
Q53FA7QORX_HUMAN1, ., -, ., -, ., -0.40530.96410.9728yesno
P47199QOR_MOUSE1, ., 6, ., 5, ., 50.33430.93430.9456yesno
P40783QOR_SALTY1, ., 6, ., 5, ., 50.31080.93730.9602yesno
P11415QOR_CAVPO1, ., 6, ., 5, ., 50.32340.94920.9665yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.6.5.5LOW CONFIDENCE prediction!
3rd Layer1.6.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0093007001
hypothetical protein (325 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.28930002
annotation not avaliable (211 aa)
     0.493

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query335
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 0.0
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 1e-174
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 1e-114
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 1e-107
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 2e-91
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 3e-89
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 4e-85
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 5e-81
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 5e-75
cd08275337 cd08275, MDR3, Medium chain dehydrogenases/reducta 3e-72
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 8e-72
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reducta 1e-71
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reducta 6e-66
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 8e-64
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 4e-58
cd08243320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 3e-55
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 8e-55
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 1e-54
smart00829287 smart00829, PKS_ER, Enoylreductase 1e-54
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 3e-54
cd08251303 cd08251, polyketide_synthase, polyketide synthase 1e-53
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 2e-52
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 6e-52
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 2e-49
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 3e-48
PRK10754327 PRK10754, PRK10754, quinone oxidoreductase, NADPH- 2e-45
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 1e-44
cd08248350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 3e-44
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reducta 6e-41
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 4e-40
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 8e-38
cd08264325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 2e-37
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 1e-36
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 2e-36
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 4e-35
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 5e-35
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 1e-34
cd08252336 cd08252, AL_MDR, Arginate lyase and other MDR fami 3e-33
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 7e-33
cd08290341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 4e-32
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 5e-32
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 2e-31
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 5e-30
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 9e-30
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 4e-29
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and 1e-28
cd08270305 cd08270, MDR4, Medium chain dehydrogenases/reducta 2e-28
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 2e-28
cd08296333 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases 3e-27
cd05281341 cd05281, TDH, Threonine dehydrogenase 3e-26
cd08247352 cd08247, AST1_like, AST1 is a cytoplasmic protein 4e-26
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 5e-26
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 1e-25
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formald 2e-25
cd08292324 cd08292, ETR_like_2, 2-enoyl thioester reductase ( 2e-25
cd08240350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa 2e-24
pfam13602129 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenas 3e-24
TIGR01751398 TIGR01751, crot-CoA-red, crotonyl-CoA reductase 3e-23
cd08291324 cd08291, ETR_like_1, 2-enoyl thioester reductase ( 9e-23
cd05288329 cd05288, PGDH, Prostaglandin dehydrogenases 3e-22
PRK05396341 PRK05396, tdh, L-threonine 3-dehydrogenase; Valida 3e-22
TIGR02817336 TIGR02817, adh_fam_1, zinc-binding alcohol dehydro 1e-21
cd08246393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 2e-21
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 2e-21
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 6e-21
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 1e-20
cd08298329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 1e-19
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 5e-19
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 1e-18
cd05280325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 6e-18
cd08283386 cd08283, FDH_like_1, Glutathione-dependent formald 1e-17
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 3e-17
cd08255277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 1e-16
TIGR00692340 TIGR00692, tdh, L-threonine 3-dehydrogenase 2e-16
TIGR02823323 TIGR02823, oxido_YhdH, putative quinone oxidoreduc 3e-16
cd05279365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 3e-15
cd08256350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD 7e-15
cd08286345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase 7e-15
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 7e-15
cd08289326 cd08289, MDR_yhfp_like, Yhfp putative quinone oxid 5e-14
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 5e-14
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 1e-13
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like 2e-13
cd08262341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 2e-13
PRK09422338 PRK09422, PRK09422, ethanol-active dehydrogenase/a 3e-13
cd08288324 cd08288, MDR_yhdh, Yhdh putative quinone oxidoredu 9e-13
cd08281371 cd08281, liver_ADH_like1, Zinc-dependent alcohol d 9e-13
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 1e-12
cd08265384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 1e-11
cd08294329 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifun 2e-11
TIGR03451358 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi 3e-10
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 3e-10
TIGR03989369 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa 2e-09
TIGR03201349 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1 6e-09
cd08278365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro 7e-09
cd08282375 cd08282, PFDH_like, Pseudomonas putida aldehyde-di 1e-08
PLN02702364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 1e-08
TIGR02825325 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehy 3e-08
PRK10083339 PRK10083, PRK10083, putative oxidoreductase; Provi 3e-08
cd08287345 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase 4e-08
PRK10309347 PRK10309, PRK10309, galactitol-1-phosphate dehydro 1e-07
cd08295338 cd08295, double_bond_reductase_like, Arabidopsis a 6e-07
cd08278365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro 2e-06
PLN02514357 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase 6e-06
cd08300368 cd08300, alcohol_DH_class_III, class III alcohol d 7e-06
PLN03154348 PLN03154, PLN03154, putative allyl alcohol dehydro 9e-06
PLN02178375 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase 1e-05
cd08299373 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV 1e-05
PLN02586360 PLN02586, PLN02586, probable cinnamyl alcohol dehy 2e-05
cd08242319 cd08242, MDR_like, Medium chain dehydrogenases/red 2e-05
cd08293345 cd08293, PTGR2, Prostaglandin reductase 3e-05
TIGR02818368 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat 4e-05
cd08230355 cd08230, glucose_DH, Glucose dehydrogenase 2e-04
cd08238410 cd08238, sorbose_phosphate_red, L-sorbose-1-phosph 4e-04
PLN02827378 PLN02827, PLN02827, Alcohol dehydrogenase-like 4e-04
cd08301369 cd08301, alcohol_DH_plants, Plant alcohol dehydrog 0.001
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
 Score =  535 bits (1382), Expect = 0.0
 Identities = 191/333 (57%), Positives = 232/333 (69%), Gaps = 10/333 (3%)

Query: 1   MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY 60
           MKAIVI +PG PEVL+L EV  P     EVLI+V A  +NRAD LQR+G YPPP GAS  
Sbjct: 1   MKAIVIKEPGGPEVLELGEVPKPAPGPGEVLIRVAAAGVNRADLLQRQGLYPPPPGASDI 60

Query: 61  PGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAF 120
            GLE +G +++VG  V+ WKVGD+VCALL GGGYAE V VPAGQ+LPVP G+SL +AAA 
Sbjct: 61  LGLEVAGVVVAVGPGVTGWKVGDRVCALLAGGGYAEYVVVPAGQLLPVPEGLSLVEAAAL 120

Query: 121 PEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVT 180
           PEV  T W  +F    L  GE+ L+          HGG+SG+GT AIQ+ K  G RV  T
Sbjct: 121 PEVFFTAWQNLFQLGGLKAGETVLI----------HGGASGVGTAAIQLAKALGARVIAT 170

Query: 181 AGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNI 240
           AGSEEKL  C+ LGADV INY+TEDF   VKE TGG+GVDVILD +G  Y  RNL +L  
Sbjct: 171 AGSEEKLEACRALGADVAINYRTEDFAEEVKEATGGRGVDVILDMVGGDYLARNLRALAP 230

Query: 241 DGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVG 300
           DGRL +IG  GGAK EL++  L  KRLT+  + LRSRS E KA + +   ++VWP  A G
Sbjct: 231 DGRLVLIGLLGGAKAELDLAPLLRKRLTLTGSTLRSRSLEEKAALAAAFREHVWPLFASG 290

Query: 301 KVKPVIYKYLPLCEAAEAHQLMESSQHIGKIML 333
           +++PVI K  PL EAAEAH+ MES++HIGKI+L
Sbjct: 291 RIRPVIDKVFPLEEAAEAHRRMESNEHIGKIVL 323


PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 323

>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|222256 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|234026 TIGR02823, oxido_YhdH, putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|176248 cd08288, MDR_yhdh, Yhdh putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176254 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family Back     alignment and domain information
>gnl|CDD|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|131872 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176255 cd08295, double_bond_reductase_like, Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|215606 PLN03154, PLN03154, putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177834 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176253 cd08293, PTGR2, Prostaglandin reductase Back     alignment and domain information
>gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase Back     alignment and domain information
>gnl|CDD|176200 cd08238, sorbose_phosphate_red, L-sorbose-1-phosphate reductase Back     alignment and domain information
>gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 335
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 100.0
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 100.0
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 100.0
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 100.0
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 100.0
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 100.0
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 100.0
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 100.0
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 100.0
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 100.0
PLN02740381 Alcohol dehydrogenase-like 100.0
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 100.0
PLN02586360 probable cinnamyl alcohol dehydrogenase 100.0
PLN02827378 Alcohol dehydrogenase-like 100.0
PRK09880343 L-idonate 5-dehydrogenase; Provisional 100.0
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 100.0
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 100.0
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 100.0
PLN02178375 cinnamyl-alcohol dehydrogenase 100.0
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 100.0
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 100.0
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 100.0
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 100.0
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 100.0
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 100.0
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 100.0
PLN02514357 cinnamyl-alcohol dehydrogenase 100.0
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 100.0
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 100.0
PTZ00354334 alcohol dehydrogenase; Provisional 100.0
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 100.0
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 100.0
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 100.0
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 100.0
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 100.0
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 100.0
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 100.0
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 100.0
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 100.0
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 100.0
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 100.0
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 100.0
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 100.0
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 100.0
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 100.0
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 100.0
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 100.0
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 100.0
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 100.0
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 100.0
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 100.0
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 100.0
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 100.0
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 100.0
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 100.0
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 100.0
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 100.0
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 100.0
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 100.0
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 100.0
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 100.0
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 100.0
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 100.0
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 100.0
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 100.0
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 100.0
PRK10083339 putative oxidoreductase; Provisional 100.0
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 100.0
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 100.0
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 100.0
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 100.0
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 100.0
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 100.0
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 100.0
PRK13771334 putative alcohol dehydrogenase; Provisional 100.0
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 100.0
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 100.0
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 100.0
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 100.0
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 100.0
cd08252336 AL_MDR Arginate lyase and other MDR family members 100.0
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 100.0
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 100.0
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 100.0
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 100.0
COG2130340 Putative NADP-dependent oxidoreductases [General f 100.0
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 100.0
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 100.0
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 100.0
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 100.0
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 100.0
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 100.0
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 100.0
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 100.0
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 100.0
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 100.0
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 100.0
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 100.0
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 100.0
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 100.0
cd08251303 polyketide_synthase polyketide synthase. Polyketid 100.0
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 100.0
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 100.0
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 100.0
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 100.0
PLN02702364 L-idonate 5-dehydrogenase 100.0
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 100.0
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 100.0
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 100.0
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 100.0
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 100.0
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 100.0
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 100.0
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 100.0
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.97
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.96
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.75
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 99.72
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 99.54
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 99.29
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 99.17
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.26
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.2
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.19
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.96
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 97.82
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.79
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.74
PLN02494477 adenosylhomocysteinase 97.72
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 97.66
PF11017314 DUF2855: Protein of unknown function (DUF2855); In 97.61
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.54
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 97.46
PRK08324681 short chain dehydrogenase; Validated 97.42
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.36
PTZ00075476 Adenosylhomocysteinase; Provisional 97.25
COG0300265 DltE Short-chain dehydrogenases of various substra 97.24
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 97.24
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.15
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.13
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.12
PRK12742237 oxidoreductase; Provisional 97.08
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.07
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 96.99
PRK06198260 short chain dehydrogenase; Provisional 96.98
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.87
PRK06182273 short chain dehydrogenase; Validated 96.84
PRK05693274 short chain dehydrogenase; Provisional 96.82
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 96.81
PRK05993277 short chain dehydrogenase; Provisional 96.77
PRK07060245 short chain dehydrogenase; Provisional 96.74
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.73
PRK06139 330 short chain dehydrogenase; Provisional 96.71
PLN03209 576 translocon at the inner envelope of chloroplast su 96.68
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.63
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.57
PRK08265261 short chain dehydrogenase; Provisional 96.56
PRK12939250 short chain dehydrogenase; Provisional 96.54
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 96.52
PRK07806248 short chain dehydrogenase; Provisional 96.51
PRK08177225 short chain dehydrogenase; Provisional 96.5
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.46
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 96.42
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 96.39
PRK07109 334 short chain dehydrogenase; Provisional 96.34
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 96.3
PRK12829264 short chain dehydrogenase; Provisional 96.21
PRK05872296 short chain dehydrogenase; Provisional 96.19
PRK06953222 short chain dehydrogenase; Provisional 96.19
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 96.17
PLN02780320 ketoreductase/ oxidoreductase 96.16
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 96.16
TIGR00438188 rrmJ cell division protein FtsJ. 96.16
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 96.12
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.1
PRK05866293 short chain dehydrogenase; Provisional 96.1
PRK07831262 short chain dehydrogenase; Provisional 96.07
PRK08017256 oxidoreductase; Provisional 96.03
PRK06484520 short chain dehydrogenase; Validated 96.02
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 96.01
PRK06128300 oxidoreductase; Provisional 96.01
PRK08339263 short chain dehydrogenase; Provisional 95.96
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 95.95
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.95
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 95.93
PRK07814263 short chain dehydrogenase; Provisional 95.92
PRK06057255 short chain dehydrogenase; Provisional 95.9
PRK07904253 short chain dehydrogenase; Provisional 95.89
PRK06949258 short chain dehydrogenase; Provisional 95.89
PRK07832272 short chain dehydrogenase; Provisional 95.88
COG4122219 Predicted O-methyltransferase [General function pr 95.88
PRK06196315 oxidoreductase; Provisional 95.87
PRK09291257 short chain dehydrogenase; Provisional 95.84
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.83
COG2910211 Putative NADH-flavin reductase [General function p 95.82
PRK04148134 hypothetical protein; Provisional 95.82
PRK06194287 hypothetical protein; Provisional 95.82
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 95.76
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 95.74
PRK06180277 short chain dehydrogenase; Provisional 95.73
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 95.72
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.69
PRK05854 313 short chain dehydrogenase; Provisional 95.69
PRK12367245 short chain dehydrogenase; Provisional 95.68
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 95.67
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 95.67
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 95.67
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 95.65
PRK05867253 short chain dehydrogenase; Provisional 95.64
PRK06500249 short chain dehydrogenase; Provisional 95.64
PRK07890258 short chain dehydrogenase; Provisional 95.63
PRK06841255 short chain dehydrogenase; Provisional 95.62
PRK06720169 hypothetical protein; Provisional 95.6
PRK07576264 short chain dehydrogenase; Provisional 95.59
PRK08267260 short chain dehydrogenase; Provisional 95.57
PRK07825273 short chain dehydrogenase; Provisional 95.56
PRK09072263 short chain dehydrogenase; Provisional 95.55
PRK07453 322 protochlorophyllide oxidoreductase; Validated 95.55
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 95.54
PRK07478254 short chain dehydrogenase; Provisional 95.53
PLN02476278 O-methyltransferase 95.53
PRK08628258 short chain dehydrogenase; Provisional 95.53
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.52
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.49
PRK06181263 short chain dehydrogenase; Provisional 95.49
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.49
PRK07063260 short chain dehydrogenase; Provisional 95.42
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 95.41
PRK06172253 short chain dehydrogenase; Provisional 95.39
PRK07062265 short chain dehydrogenase; Provisional 95.39
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.36
PRK08213259 gluconate 5-dehydrogenase; Provisional 95.35
PLN02589247 caffeoyl-CoA O-methyltransferase 95.33
PRK06484 520 short chain dehydrogenase; Validated 95.31
PRK07523255 gluconate 5-dehydrogenase; Provisional 95.3
PRK10538248 malonic semialdehyde reductase; Provisional 95.29
PRK06138252 short chain dehydrogenase; Provisional 95.29
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 95.29
PRK12937245 short chain dehydrogenase; Provisional 95.28
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 95.27
PRK05876275 short chain dehydrogenase; Provisional 95.27
KOG0725270 consensus Reductases with broad range of substrate 95.25
PRK06125259 short chain dehydrogenase; Provisional 95.23
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.2
PRK07677252 short chain dehydrogenase; Provisional 95.17
PRK07067257 sorbitol dehydrogenase; Provisional 95.15
PRK06114254 short chain dehydrogenase; Provisional 95.15
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 95.14
PRK09242257 tropinone reductase; Provisional 95.14
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 95.14
PRK05884223 short chain dehydrogenase; Provisional 95.12
PRK07024257 short chain dehydrogenase; Provisional 95.12
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 95.11
PRK07774250 short chain dehydrogenase; Provisional 95.11
PRK06197 306 short chain dehydrogenase; Provisional 95.11
PRK08264238 short chain dehydrogenase; Validated 95.09
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.09
PRK06101240 short chain dehydrogenase; Provisional 95.08
PRK08862227 short chain dehydrogenase; Provisional 95.08
PRK08277278 D-mannonate oxidoreductase; Provisional 95.08
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 95.08
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 95.08
PRK11207197 tellurite resistance protein TehB; Provisional 95.05
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 95.04
PRK05875276 short chain dehydrogenase; Provisional 95.04
PRK08589272 short chain dehydrogenase; Validated 95.03
PRK06482276 short chain dehydrogenase; Provisional 95.02
PRK08226263 short chain dehydrogenase; Provisional 95.0
PRK08643256 acetoin reductase; Validated 94.99
PRK07326237 short chain dehydrogenase; Provisional 94.98
PRK08085254 gluconate 5-dehydrogenase; Provisional 94.98
PRK07454241 short chain dehydrogenase; Provisional 94.97
PRK05717255 oxidoreductase; Validated 94.95
PRK07097265 gluconate 5-dehydrogenase; Provisional 94.92
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 94.9
PRK12828239 short chain dehydrogenase; Provisional 94.89
PRK05650270 short chain dehydrogenase; Provisional 94.88
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.88
PRK08703239 short chain dehydrogenase; Provisional 94.85
PRK08303 305 short chain dehydrogenase; Provisional 94.85
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 94.84
CHL00194 317 ycf39 Ycf39; Provisional 94.83
PRK07856252 short chain dehydrogenase; Provisional 94.82
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.8
PRK06179270 short chain dehydrogenase; Provisional 94.8
PRK09186256 flagellin modification protein A; Provisional 94.79
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 94.79
PRK07074257 short chain dehydrogenase; Provisional 94.77
PRK08340259 glucose-1-dehydrogenase; Provisional 94.77
PRK07035252 short chain dehydrogenase; Provisional 94.76
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 94.76
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 94.74
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 94.69
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 94.67
PRK07424406 bifunctional sterol desaturase/short chain dehydro 94.66
PRK08263275 short chain dehydrogenase; Provisional 94.64
PLN02253280 xanthoxin dehydrogenase 94.64
PRK12747252 short chain dehydrogenase; Provisional 94.63
PLN00016 378 RNA-binding protein; Provisional 94.63
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 94.61
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 94.6
PRK07791286 short chain dehydrogenase; Provisional 94.6
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 94.6
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 94.59
PRK06398258 aldose dehydrogenase; Validated 94.54
PRK06124256 gluconate 5-dehydrogenase; Provisional 94.53
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 94.52
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 94.47
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.46
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 94.45
PRK07985294 oxidoreductase; Provisional 94.45
PRK08278273 short chain dehydrogenase; Provisional 94.42
PRK12743256 oxidoreductase; Provisional 94.4
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 94.37
PRK14967223 putative methyltransferase; Provisional 94.35
PRK08251248 short chain dehydrogenase; Provisional 94.35
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 94.34
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 94.32
PRK07577234 short chain dehydrogenase; Provisional 94.31
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 94.31
PLN03075296 nicotianamine synthase; Provisional 94.28
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 94.26
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 94.25
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 94.24
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.24
KOG1208314 consensus Dehydrogenases with different specificit 94.22
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 94.21
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 94.2
PRK13940414 glutamyl-tRNA reductase; Provisional 94.19
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.17
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 94.17
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 94.17
KOG1252362 consensus Cystathionine beta-synthase and related 94.16
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 94.15
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 94.14
PLN02244340 tocopherol O-methyltransferase 94.13
PRK06914280 short chain dehydrogenase; Provisional 94.11
PRK08618325 ornithine cyclodeaminase; Validated 94.07
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.05
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 94.01
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 94.01
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 93.95
PRK08219227 short chain dehydrogenase; Provisional 93.94
PRK06719157 precorrin-2 dehydrogenase; Validated 93.93
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.92
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.92
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 93.91
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.89
PRK07775274 short chain dehydrogenase; Provisional 93.88
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 93.88
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 93.84
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.79
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 93.77
PRK06523260 short chain dehydrogenase; Provisional 93.77
PRK06483236 dihydromonapterin reductase; Provisional 93.75
PRK07102243 short chain dehydrogenase; Provisional 93.74
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 93.73
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 93.7
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 93.69
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 93.68
PF1382323 ADH_N_assoc: Alcohol dehydrogenase GroES-associate 93.67
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 93.67
PRK06701290 short chain dehydrogenase; Provisional 93.64
PRK05855582 short chain dehydrogenase; Validated 93.61
PRK13255218 thiopurine S-methyltransferase; Reviewed 93.6
PRK12935247 acetoacetyl-CoA reductase; Provisional 93.56
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.56
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.54
PRK12938246 acetyacetyl-CoA reductase; Provisional 93.53
PRK07402196 precorrin-6B methylase; Provisional 93.52
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 93.51
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.5
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 93.47
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.47
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 93.46
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 93.41
PRK12549284 shikimate 5-dehydrogenase; Reviewed 93.38
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 93.31
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 93.3
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 93.27
PRK12550272 shikimate 5-dehydrogenase; Reviewed 93.27
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.25
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.15
PRK08936261 glucose-1-dehydrogenase; Provisional 93.13
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 93.13
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 93.12
TIGR02415254 23BDH acetoin reductases. One member of this famil 93.11
PRK08317241 hypothetical protein; Provisional 93.07
PLN02653 340 GDP-mannose 4,6-dehydratase 93.04
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 93.04
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 93.01
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 92.95
PRK00811283 spermidine synthase; Provisional 92.94
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 92.93
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 92.93
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 92.93
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 92.89
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 92.89
PRK07041230 short chain dehydrogenase; Provisional 92.88
PRK12746254 short chain dehydrogenase; Provisional 92.82
PLN02896 353 cinnamyl-alcohol dehydrogenase 92.8
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 92.78
PLN02233261 ubiquinone biosynthesis methyltransferase 92.76
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 92.75
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 92.64
PRK12548289 shikimate 5-dehydrogenase; Provisional 92.64
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.57
COG0031300 CysK Cysteine synthase [Amino acid transport and m 92.57
PLN02214 342 cinnamoyl-CoA reductase 92.56
PRK12827249 short chain dehydrogenase; Provisional 92.54
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 92.52
PRK08655 437 prephenate dehydrogenase; Provisional 92.48
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 92.46
PRK12744257 short chain dehydrogenase; Provisional 92.42
PRK14027283 quinate/shikimate dehydrogenase; Provisional 92.41
COG0569225 TrkA K+ transport systems, NAD-binding component [ 92.41
PRK09135249 pteridine reductase; Provisional 92.41
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 92.37
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 92.36
PRK05599246 hypothetical protein; Provisional 92.34
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 92.33
PRK07023243 short chain dehydrogenase; Provisional 92.3
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.27
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 92.25
PRK07069251 short chain dehydrogenase; Validated 92.21
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 92.21
PRK07574385 formate dehydrogenase; Provisional 92.18
PRK06940275 short chain dehydrogenase; Provisional 92.16
PRK07201657 short chain dehydrogenase; Provisional 92.14
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.1
PRK07340304 ornithine cyclodeaminase; Validated 92.07
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 92.06
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 92.04
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 92.0
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 91.95
PRK07417 279 arogenate dehydrogenase; Reviewed 91.92
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 91.91
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 91.9
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 91.87
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 91.87
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 91.87
PRK04457262 spermidine synthase; Provisional 91.85
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 91.83
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 91.82
PRK09134258 short chain dehydrogenase; Provisional 91.81
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 91.71
PRK03659601 glutathione-regulated potassium-efflux system prot 91.64
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 91.61
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 91.57
PLN02928347 oxidoreductase family protein 91.55
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 91.54
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.52
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.5
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 91.48
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.42
PRK10669558 putative cation:proton antiport protein; Provision 91.38
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 91.38
PLN02240 352 UDP-glucose 4-epimerase 91.35
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 91.3
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.29
PRK03562621 glutathione-regulated potassium-efflux system prot 91.28
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 91.27
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 91.27
PRK04266226 fibrillarin; Provisional 91.25
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.23
PRK13243333 glyoxylate reductase; Reviewed 91.21
PLN03139386 formate dehydrogenase; Provisional 91.18
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.11
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 91.09
PLN02686 367 cinnamoyl-CoA reductase 91.09
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.08
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 91.02
PRK14968188 putative methyltransferase; Provisional 91.01
PLN00015 308 protochlorophyllide reductase 90.99
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 90.99
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 90.91
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 90.91
PRK01581374 speE spermidine synthase; Validated 90.84
PRK06141314 ornithine cyclodeaminase; Validated 90.83
PRK10258251 biotin biosynthesis protein BioC; Provisional 90.8
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 90.75
PRK13403 335 ketol-acid reductoisomerase; Provisional 90.7
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 90.68
PRK06947248 glucose-1-dehydrogenase; Provisional 90.65
PLN02427 386 UDP-apiose/xylose synthase 90.65
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 90.62
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.62
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 90.59
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 90.59
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.56
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=8e-56  Score=392.36  Aligned_cols=305  Identities=36%  Similarity=0.538  Sum_probs=279.9

Q ss_pred             CEEEEEcCCCCCcceEEEeecCCCCCCCcEEEEEEEeecCcchhhhhcCCCCCCCCCCCCCCCceEEEEEEecCCCCCCC
Q 019790            1 MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWK   80 (335)
Q Consensus         1 mka~~~~~~~~~~~l~~~~~~~~~~~~~eVlI~v~~~~i~~~D~~~~~g~~~~~~~~p~~~G~e~~G~V~~vG~~~~~~~   80 (335)
                      |||+++.++++|  +++.+.+.|+|.++||+|+|.|+|+|++|+|.++|.++... +|++||||.+|+|+++|++|++|+
T Consensus         4 mkA~~~~~~~~p--l~i~e~~~p~p~~~eVlI~v~~~GVChsDlH~~~G~~~~~~-~P~ipGHEivG~V~~vG~~V~~~k   80 (339)
T COG1064           4 MKAAVLKKFGQP--LEIEEVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWPVPK-LPLIPGHEIVGTVVEVGEGVTGLK   80 (339)
T ss_pred             eEEEEEccCCCC--ceEEeccCCCCCCCeEEEEEEEEeecchhhhhhcCCCCCCC-CCccCCcceEEEEEEecCCCccCC
Confidence            899999999988  99999999999999999999999999999999999998766 899999999999999999999999


Q ss_pred             CCCEEEE----------------------------ecCCcceeeEEEecCCceEeCCCCCChhhhccCcchHHHHHHHHH
Q 019790           81 VGDQVCA----------------------------LLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVF  132 (335)
Q Consensus        81 ~Gd~V~~----------------------------~~~~g~~~~~~~~~~~~~~~~p~~~~~~~aa~~~~~~~~a~~~l~  132 (335)
                      +||||..                            +..+|+|+||+++++.+++++|+++++++||.+.|++.|+|++| 
T Consensus        81 ~GDrVgV~~~~~~Cg~C~~C~~G~E~~C~~~~~~gy~~~GGyaeyv~v~~~~~~~iP~~~d~~~aApllCaGiT~y~al-  159 (339)
T COG1064          81 VGDRVGVGWLVISCGECEYCRSGNENLCPNQKITGYTTDGGYAEYVVVPARYVVKIPEGLDLAEAAPLLCAGITTYRAL-  159 (339)
T ss_pred             CCCEEEecCccCCCCCCccccCcccccCCCccccceeecCcceeEEEEchHHeEECCCCCChhhhhhhhcCeeeEeeeh-
Confidence            9999953                            22469999999999999999999999999999999999999999 


Q ss_pred             HhcCCCCCCEEEEeeccccccccccccchHHHHHHHHHhhCCCeEEEEecChhhHHHHHHcCCCEEEeCCCccHHHHHHH
Q 019790          133 MTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKE  212 (335)
Q Consensus       133 ~~~~~~~~~~vli~~~~~~~~~~~g~~g~~G~~a~~~a~~~g~~V~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~  212 (335)
                      +..++.||++|+|          .| .|++|++++|+|+++|++|+++++++++.+.++++|++++++.++.++.+.+++
T Consensus       160 k~~~~~pG~~V~I----------~G-~GGlGh~avQ~Aka~ga~Via~~~~~~K~e~a~~lGAd~~i~~~~~~~~~~~~~  228 (339)
T COG1064         160 KKANVKPGKWVAV----------VG-AGGLGHMAVQYAKAMGAEVIAITRSEEKLELAKKLGADHVINSSDSDALEAVKE  228 (339)
T ss_pred             hhcCCCCCCEEEE----------EC-CcHHHHHHHHHHHHcCCeEEEEeCChHHHHHHHHhCCcEEEEcCCchhhHHhHh
Confidence            5599999999999          88 689999999999999999999999999999999999999999887777777665


Q ss_pred             HhCCCcccEEEeCCChhhHHHhhccccCCCEEEEEeccC-CCccccChhHHhhcceEEEEeeccccchhhHHHHHHHHHH
Q 019790          213 ETGGKGVDVILDCMGASYFQRNLGSLNIDGRLFIIGTQG-GAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEK  291 (335)
Q Consensus       213 ~~~~~~~d~vid~~g~~~~~~~~~~l~~~G~~v~~g~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  291 (335)
                      .     +|+++|+++...+..+++.|+++|+++++|... .....++...+..+++++.|+...++.+.          +
T Consensus       229 ~-----~d~ii~tv~~~~~~~~l~~l~~~G~~v~vG~~~~~~~~~~~~~~li~~~~~i~GS~~g~~~d~----------~  293 (339)
T COG1064         229 I-----ADAIIDTVGPATLEPSLKALRRGGTLVLVGLPGGGPIPLLPAFLLILKEISIVGSLVGTRADL----------E  293 (339)
T ss_pred             h-----CcEEEECCChhhHHHHHHHHhcCCEEEEECCCCCcccCCCCHHHhhhcCeEEEEEecCCHHHH----------H
Confidence            3     999999999666899999999999999999985 45566888889999999999998875432          2


Q ss_pred             HHHHHHHCCccccccccccchhhHHHHHHHHHhCCCceeEEEeC
Q 019790          292 NVWPAIAVGKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIMLVP  335 (335)
Q Consensus       292 ~~~~~~~~g~~~~~~~~~~~l~~~~~a~~~~~~~~~~gkvvi~~  335 (335)
                      .++++..+|+++|.+.+.++++++++|++.|++++..|++||++
T Consensus       294 e~l~f~~~g~Ikp~i~e~~~l~~in~A~~~m~~g~v~gR~Vi~~  337 (339)
T COG1064         294 EALDFAAEGKIKPEILETIPLDEINEAYERMEKGKVRGRAVIDM  337 (339)
T ss_pred             HHHHHHHhCCceeeEEeeECHHHHHHHHHHHHcCCeeeEEEecC
Confidence            28999999999999978999999999999999999999999875



>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF13823 ADH_N_assoc: Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query335
4dup_A353 Crystal Structure Of A Quinone Oxidoreductase From 8e-77
2j8z_A354 Crystal Structure Of Human P53 Inducible Oxidoreduc 5e-64
2oby_A338 Crystal Structure Of Human P53 Inducible Oxidoreduc 7e-64
2eih_A343 Crystal Structure Of Nad-Dependent Alcohol Dehydrog 8e-41
1yb5_A351 Crystal Structure Of Human Zeta-crystallin With Bou 5e-35
1qor_A327 Crystal Structure Of Escherichia Coli Quinone Oxido 1e-32
1wly_A333 Crystal Structure Of 2-haloacrylate Reductase Lengt 7e-29
3qwa_A334 Crystal Structure Of Saccharomyces Cerevisiae Zeta- 1e-28
3jyl_A325 Crystal Structures Of Pseudomonas Syringae Pv. Toma 2e-27
4a27_A349 Crystal Structure Of Human Synaptic Vesicle Membran 6e-25
1iyz_A302 Crystal Structures Of The Quinone Oxidoreductase Fr 2e-24
3uog_A363 Crystal Structure Of Putative Alcohol Dehydrogenase 2e-23
2cf2_D295 Architecture Of Mammalian Fatty Acid Synthase Lengt 1e-22
4eye_A342 Crystal Structure Of A Probable Oxidoreductase From 1e-22
3tqh_A321 Structure Of The Quinone Oxidoreductase From Coxiel 9e-22
2vz8_A 2512 Crystal Structure Of Mammalian Fatty Acid Synthase 8e-21
1iz0_A302 Crystal Structures Of The Quinone Oxidoreductase Fr 5e-20
3gaz_A343 Crystal Structure Of An Alcohol Dehydrogenase Super 2e-18
2c0c_A362 Structure Of The Mgc45594 Gene Product Length = 362 1e-17
2wek_A341 Crystal Structure Of The Human Mgc45594 Gene Produc 2e-17
2x7h_A370 Crystal Structure Of The Human Mgc45594 Gene Produc 2e-17
1rjw_A339 Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd 3e-17
3pii_A339 Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog 4e-17
3slk_A 795 Structure Of Ketoreductase And Enoylreductase Didom 1e-16
3gms_A340 Crystal Structure Of Putative Nadph:quinone Reducta 1e-16
2eer_A347 Structural Study Of Project Id St2577 From Sulfolob 2e-16
1pqw_A198 Putative Enoyl Reductase Domain Of Polyketide Synth 5e-15
4a0s_A447 Structure Of The 2-Octenoyl-Coa Carboxylase Reducta 8e-15
3fbg_A346 Crystal Structure Of A Putative Arginate Lyase From 8e-15
2hcy_A347 Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevi 2e-14
2vn8_A375 Crystal Structure Of Human Reticulon 4 Interacting 3e-14
1llu_A342 The Ternary Complex Of Pseudomonas Aeruginosa Alcoh 2e-13
3s1l_A340 Crystal Structure Of Apo-Form Furx Length = 340 2e-12
3hzz_A467 2.4 Angstrom Crystal Structure Of Streptomyces Coll 2e-12
1nto_A347 N249y Mutant Of Alcohol Dehydrogenase From The Arch 2e-12
3i4c_A347 Crystal Structure Of Sulfolobus Solfataricus Adh(Ss 2e-12
3meq_A365 Crystal Structure Of Alcohol Dehydrogenase From Bru 6e-12
1r37_A347 Alcohol Dehydrogenase From Sulfolobus Solfataricus 2e-11
3krt_A456 Crystal Structure Of Putative Crotonyl Coa Reductas 4e-11
3b6z_A371 Lovastatin Polyketide Enoyl Reductase (Lovc) Comple 4e-11
3gqv_A371 Lovastatin Polyketide Enoyl Reductase (Lovc) Mutant 4e-11
4eex_A348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 6e-09
1h0k_A364 Enoyl Thioester Reductase 2 Length = 364 6e-09
1n9g_A386 Mitochondrial 2-enoyl Thioester Reductase Etr1p/etr 6e-09
1gu7_A364 Enoyl Thioester Reductase From Candida Tropicalis L 1e-08
1n9g_B386 Mitochondrial 2-enoyl Thioester Reductase Etr1p/etr 1e-08
4eez_A348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 2e-08
1zsy_A357 The Structure Of Human Mitochondrial 2-Enoyl Thioes 3e-08
2dfv_A347 Hyperthermophilic Threonine Dehydrogenase From Pyro 3e-08
2d8a_A348 Crystal Structure Of Ph0655 From Pyrococcus Horikos 3e-08
2vcy_A344 Crystal Structure Of 2-Enoyl Thioester Reductase Of 3e-08
1gyr_A364 Mutant Form Of Enoyl Thioester Reductase From Candi 1e-07
1jvb_A347 Alcohol Dehydrogenase From The Archaeon Sulfolobus 2e-07
3gfb_A350 L-Threonine Dehydrogenase (Tktdh) From The Hyperthe 3e-07
4dvj_A363 Crystal Structure Of A Putative Zinc-Dependent Alco 3e-07
3nx4_A324 Crystal Structure Of The Yhdh Oxidoreductase From S 4e-07
2y05_A328 Crystal Structure Of Human Leukotriene B4 12-Hydrox 7e-07
3pi7_A349 Crystal Structure Of A Putative Nadph:quinone Reduc 8e-07
1zsv_A349 Crystal Structure Of Human Nadp-Dependent Leukotrie 9e-07
4b7c_A336 Crystal Structure Of Hypothetical Protein Pa1648 Fr 1e-06
1v3t_A333 Crystal Structure Of Leukotriene B4 12- Hydroxydehy 1e-06
2xaa_A345 Alcohol Dehydrogenase Adh-'a' From Rhodococcus Rube 2e-06
2dq4_A343 Crystal Structure Of Threonine 3-Dehydrogenase Leng 5e-06
1o89_A345 Crystal Structure Of E. Coli K-12 Yhdh Length = 345 7e-06
1f8f_A371 Crystal Structure Of Benzyl Alcohol Dehydrogenase F 7e-06
1f8f_A371 Crystal Structure Of Benzyl Alcohol Dehydrogenase F 1e-04
1teh_A373 Structure Of Human Liver Chichi Alcohol Dehydrogena 9e-06
1mc5_A374 Ternary Complex Of Human Glutathione-Dependent Form 9e-06
3qj5_A374 S-Nitrosoglutathione Reductase (Gsnor) In Complex W 9e-06
1xa0_A328 Crystal Structure Of Mcsg Target Apc35536 From Baci 1e-05
2j3h_A345 Crystal Structure Of Arabidopsis Thaliana Double Bo 4e-05
2fzw_A373 Structure Of The Binary Complex Of The E67l Mutant 7e-05
3ip1_A404 Structure Of Putative Alcohol Dehydrogenase (Tm_042 9e-05
3goh_A315 Crystal Structure Of Alcohol Dehydrogenase Superfam 1e-04
3iup_A379 Crystal Structure Of Putative Nadph:quinone Oxidore 2e-04
4ilk_A359 Crystal Structure Of Short Chain Alcohol Dehydrogen 2e-04
1tt7_A330 Crystal Structure Of Bacillus Subtilis Protein Yhfp 2e-04
1vj0_A380 Crystal Structure Of Alcohol Dehydrogenase (Tm0436) 3e-04
1e3j_A352 Ketose Reductase (Sorbitol Dehydrogenase) From Silv 4e-04
2h6e_A344 Crystal Structure Of The D-Arabinose Dehydrogenase 5e-04
2zb3_A353 Crystal Structure Of Mouse 15-Ketoprostaglandin Del 5e-04
>pdb|4DUP|A Chain A, Crystal Structure Of A Quinone Oxidoreductase From Rhizobium Etli Cfn 42 Length = 353 Back     alignment and structure

Iteration: 1

Score = 283 bits (725), Expect = 8e-77, Method: Compositional matrix adjust. Identities = 152/325 (46%), Positives = 200/325 (61%), Gaps = 12/325 (3%) Query: 10 GSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTI 69 G P+V + + P + EVL++ EA +NR D QR+GSYPPPK ASP GLE SG I Sbjct: 38 GGPDVXVIGKRPLPVAGEGEVLVRAEAIGVNRPDIAQRQGSYPPPKDASPILGLELSGEI 97 Query: 70 LSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWS 129 + VG VS + VGD+VC L GG YAE +PAGQ+LP P G AAA PE TVW+ Sbjct: 98 VGVGPGVSGYAVGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDAVKAAALPETFFTVWA 157 Query: 130 TVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVTAGSEEKLAV 189 +F + L+ GES L +HGG+SGIGT AIQ+ + G V+ TAGS K Sbjct: 158 NLFQXAGLTEGESVL----------IHGGTSGIGTTAIQLARAFGAEVYATAGSTGKCEA 207 Query: 190 CKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNIDGRLFIIGT 249 C+ LGA INY++EDF A +K ET G+GVD+ILD +GA+YF+RN+ SL DG L II Sbjct: 208 CERLGAKRGINYRSEDFAAVIKAET-GQGVDIILDXIGAAYFERNIASLAKDGCLSIIAF 266 Query: 250 QGGAKTE-LNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVGKVKPVIYK 308 GGA E +N++ + KRLTV + R R+ E K I ++ VWP + G V PVI+K Sbjct: 267 LGGAVAEKVNLSPIXVKRLTVTGSTXRPRTAEEKRAIRDDLLSEVWPLLEAGTVAPVIHK 326 Query: 309 YLPLCEAAEAHQLMESSQHIGKIML 333 + A+AH+L+E H+GK+ L Sbjct: 327 VFAFEDVADAHRLLEEGSHVGKVXL 351
>pdb|2J8Z|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase ( Tp53i3,Pig3) Length = 354 Back     alignment and structure
>pdb|2OBY|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase (Tp53i3,Pig3) Length = 338 Back     alignment and structure
>pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 Back     alignment and structure
>pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 Back     alignment and structure
>pdb|1QOR|A Chain A, Crystal Structure Of Escherichia Coli Quinone Oxidoreductase Complexed With Nadph Length = 327 Back     alignment and structure
>pdb|1WLY|A Chain A, Crystal Structure Of 2-haloacrylate Reductase Length = 333 Back     alignment and structure
>pdb|3QWA|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Zeta-Crystallin-Like Quinone Oxidoreductase Zta1 Length = 334 Back     alignment and structure
>pdb|3JYL|A Chain A, Crystal Structures Of Pseudomonas Syringae Pv. Tomato Dc3000 Quinone Oxidoreductase Length = 325 Back     alignment and structure
>pdb|4A27|A Chain A, Crystal Structure Of Human Synaptic Vesicle Membrane Protein Vat-1 Homolog-Like Protein Length = 349 Back     alignment and structure
>pdb|1IYZ|A Chain A, Crystal Structures Of The Quinone Oxidoreductase From Thermus Thermophilus Hb8 And Its Complex With Nadph Length = 302 Back     alignment and structure
>pdb|3UOG|A Chain A, Crystal Structure Of Putative Alcohol Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 363 Back     alignment and structure
>pdb|2CF2|D Chain D, Architecture Of Mammalian Fatty Acid Synthase Length = 295 Back     alignment and structure
>pdb|4EYE|A Chain A, Crystal Structure Of A Probable Oxidoreductase From Mycobacterium Abscessus Solved By Iodide Ion Sad Length = 342 Back     alignment and structure
>pdb|3TQH|A Chain A, Structure Of The Quinone Oxidoreductase From Coxiella Burnetii Length = 321 Back     alignment and structure
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure
>pdb|1IZ0|A Chain A, Crystal Structures Of The Quinone Oxidoreductase From Thermus Thermophilus Hb8 And Its Complex With Nadph Length = 302 Back     alignment and structure
>pdb|3GAZ|A Chain A, Crystal Structure Of An Alcohol Dehydrogenase Superfamily Protein From Novosphingobium Aromaticivorans Length = 343 Back     alignment and structure
>pdb|2C0C|A Chain A, Structure Of The Mgc45594 Gene Product Length = 362 Back     alignment and structure
>pdb|2WEK|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Diclofenac Length = 341 Back     alignment and structure
>pdb|2X7H|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Fenoprofen Length = 370 Back     alignment and structure
>pdb|1RJW|A Chain A, Crystal Structure Of Nad(+)-Dependent Alcohol Dehydrogenase From Bacillus Stearothermophilus Strain Lld-R Length = 339 Back     alignment and structure
>pdb|3PII|A Chain A, Crystal Structure Of Mutant Of Ht- Alcohol Dehydrogenase With Substrate Analogue Butyramide Length = 339 Back     alignment and structure
>pdb|3SLK|A Chain A, Structure Of Ketoreductase And Enoylreductase Didomain From Modular Polyketide Synthase Length = 795 Back     alignment and structure
>pdb|3GMS|A Chain A, Crystal Structure Of Putative Nadph:quinone Reductase From Bacillus Thuringiensis Length = 340 Back     alignment and structure
>pdb|2EER|A Chain A, Structural Study Of Project Id St2577 From Sulfolobus Tokodaii Strain7 Length = 347 Back     alignment and structure
>pdb|1PQW|A Chain A, Putative Enoyl Reductase Domain Of Polyketide Synthase Length = 198 Back     alignment and structure
>pdb|4A0S|A Chain A, Structure Of The 2-Octenoyl-Coa Carboxylase Reductase Cinf In Complex With Nadp And 2-Octenoyl-Coa Length = 447 Back     alignment and structure
>pdb|3FBG|A Chain A, Crystal Structure Of A Putative Arginate Lyase From Staphylococcus Haemolyticus Length = 346 Back     alignment and structure
>pdb|2HCY|A Chain A, Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevisiae Fermentative Enzyme Length = 347 Back     alignment and structure
>pdb|2VN8|A Chain A, Crystal Structure Of Human Reticulon 4 Interacting Protein 1 In Complex With Nadph Length = 375 Back     alignment and structure
>pdb|1LLU|A Chain A, The Ternary Complex Of Pseudomonas Aeruginosa Alcohol Dehydrogenase With Its Coenzyme And Weak Substrate Length = 342 Back     alignment and structure
>pdb|3S1L|A Chain A, Crystal Structure Of Apo-Form Furx Length = 340 Back     alignment and structure
>pdb|3HZZ|A Chain A, 2.4 Angstrom Crystal Structure Of Streptomyces Collinus Crotonyl Coa CarboxylaseREDUCTASE Length = 467 Back     alignment and structure
>pdb|1NTO|A Chain A, N249y Mutant Of Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus-Monoclinic Crystal Form Length = 347 Back     alignment and structure
>pdb|3I4C|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Adh(Ssadh) Double Mutant (W95l,N249y) Length = 347 Back     alignment and structure
>pdb|3MEQ|A Chain A, Crystal Structure Of Alcohol Dehydrogenase From Brucella Mel Length = 365 Back     alignment and structure
>pdb|1R37|A Chain A, Alcohol Dehydrogenase From Sulfolobus Solfataricus Complexed With Nad(H) And 2-Ethoxyethanol Length = 347 Back     alignment and structure
>pdb|3KRT|A Chain A, Crystal Structure Of Putative Crotonyl Coa Reductase From Streptomyces Coelicolor A3(2) Length = 456 Back     alignment and structure
>pdb|3B6Z|A Chain A, Lovastatin Polyketide Enoyl Reductase (Lovc) Complexed With 2'- Phosphoadenosyl Isomer Of Crotonoyl-Coa Length = 371 Back     alignment and structure
>pdb|3GQV|A Chain A, Lovastatin Polyketide Enoyl Reductase (Lovc) Mutant K54s With Bound Nadp Length = 371 Back     alignment and structure
>pdb|4EEX|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Length = 348 Back     alignment and structure
>pdb|1H0K|A Chain A, Enoyl Thioester Reductase 2 Length = 364 Back     alignment and structure
>pdb|1N9G|A Chain A, Mitochondrial 2-enoyl Thioester Reductase Etr1p/etr2p Heterodimer From Candida Tropicalis Length = 386 Back     alignment and structure
>pdb|1GU7|A Chain A, Enoyl Thioester Reductase From Candida Tropicalis Length = 364 Back     alignment and structure
>pdb|1N9G|B Chain B, Mitochondrial 2-enoyl Thioester Reductase Etr1p/etr2p Heterodimer From Candida Tropicalis Length = 386 Back     alignment and structure
>pdb|4EEZ|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Variant Re1 Length = 348 Back     alignment and structure
>pdb|1ZSY|A Chain A, The Structure Of Human Mitochondrial 2-Enoyl Thioester Reductase (Cgi- 63) Length = 357 Back     alignment and structure
>pdb|2DFV|A Chain A, Hyperthermophilic Threonine Dehydrogenase From Pyrococcus Horikoshii Length = 347 Back     alignment and structure
>pdb|2D8A|A Chain A, Crystal Structure Of Ph0655 From Pyrococcus Horikoshii Ot3 Length = 348 Back     alignment and structure
>pdb|2VCY|A Chain A, Crystal Structure Of 2-Enoyl Thioester Reductase Of Human Fas Ii Length = 344 Back     alignment and structure
>pdb|1GYR|A Chain A, Mutant Form Of Enoyl Thioester Reductase From Candida Tropicalis Length = 364 Back     alignment and structure
>pdb|1JVB|A Chain A, Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus Length = 347 Back     alignment and structure
>pdb|3GFB|A Chain A, L-Threonine Dehydrogenase (Tktdh) From The Hyperthermophilic Archaeon Thermococcus Kodakaraensis Length = 350 Back     alignment and structure
>pdb|4DVJ|A Chain A, Crystal Structure Of A Putative Zinc-Dependent Alcohol Dehydrogenase Protein From Rhizobium Etli Cfn 42 Length = 363 Back     alignment and structure
>pdb|3NX4|A Chain A, Crystal Structure Of The Yhdh Oxidoreductase From Salmonella Enterica In Complex With Nadp Length = 324 Back     alignment and structure
>pdb|2Y05|A Chain A, Crystal Structure Of Human Leukotriene B4 12-Hydroxydehydrogenase In Complex With Nadp And Raloxifene Length = 328 Back     alignment and structure
>pdb|3PI7|A Chain A, Crystal Structure Of A Putative Nadph:quinone Reductase (Mll3093) From Mesorhizobium Loti At 1.71 A Resolution Length = 349 Back     alignment and structure
>pdb|1ZSV|A Chain A, Crystal Structure Of Human Nadp-Dependent Leukotriene B4 12- Hydroxydehydrogenase Length = 349 Back     alignment and structure
>pdb|4B7C|A Chain A, Crystal Structure Of Hypothetical Protein Pa1648 From Pseudomonas Aeruginosa. Length = 336 Back     alignment and structure
>pdb|1V3T|A Chain A, Crystal Structure Of Leukotriene B4 12- Hydroxydehydrogenase15-Oxo-Prostaglandin 13-Reductase Length = 333 Back     alignment and structure
>pdb|2XAA|A Chain A, Alcohol Dehydrogenase Adh-'a' From Rhodococcus Ruber Dsm 44541 At Ph 8.5 In Complex With Nad And Butane-1,4-Diol Length = 345 Back     alignment and structure
>pdb|2DQ4|A Chain A, Crystal Structure Of Threonine 3-Dehydrogenase Length = 343 Back     alignment and structure
>pdb|1O89|A Chain A, Crystal Structure Of E. Coli K-12 Yhdh Length = 345 Back     alignment and structure
>pdb|1F8F|A Chain A, Crystal Structure Of Benzyl Alcohol Dehydrogenase From Acinetobacter Calcoaceticus Length = 371 Back     alignment and structure
>pdb|1F8F|A Chain A, Crystal Structure Of Benzyl Alcohol Dehydrogenase From Acinetobacter Calcoaceticus Length = 371 Back     alignment and structure
>pdb|1TEH|A Chain A, Structure Of Human Liver Chichi Alcohol Dehydrogenase (A Glutathione- Dependent Formaldehyde Dehydrogenase) Length = 373 Back     alignment and structure
>pdb|1MC5|A Chain A, Ternary Complex Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With S-(Hydroxymethyl)glutathione And Nadh Length = 374 Back     alignment and structure
>pdb|3QJ5|A Chain A, S-Nitrosoglutathione Reductase (Gsnor) In Complex With N6022 Length = 374 Back     alignment and structure
>pdb|1XA0|A Chain A, Crystal Structure Of Mcsg Target Apc35536 From Bacillus Stearothermophilus Length = 328 Back     alignment and structure
>pdb|2J3H|A Chain A, Crystal Structure Of Arabidopsis Thaliana Double Bond Reductase (At5g16970)-Apo Form Length = 345 Back     alignment and structure
>pdb|2FZW|A Chain A, Structure Of The Binary Complex Of The E67l Mutant Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With Nad(H) Length = 373 Back     alignment and structure
>pdb|3IP1|A Chain A, Structure Of Putative Alcohol Dehydrogenase (Tm_042) From Thermotoga Maritima Length = 404 Back     alignment and structure
>pdb|3GOH|A Chain A, Crystal Structure Of Alcohol Dehydrogenase Superfamily Protein (np_718042.1) From Shewanella Oneidensis At 1.55 A Resolution Length = 315 Back     alignment and structure
>pdb|3IUP|A Chain A, Crystal Structure Of Putative Nadph:quinone Oxidoreductase (Yp_296108.1) From Ralstonia Eutropha Jmp134 At 1.70 A Resolution Length = 379 Back     alignment and structure
>pdb|4ILK|A Chain A, Crystal Structure Of Short Chain Alcohol Dehydrogenase (rspb) From E. Coli Cft073 (efi Target Efi-506413) Complexed With Cofactor Nadh Length = 359 Back     alignment and structure
>pdb|1TT7|A Chain A, Crystal Structure Of Bacillus Subtilis Protein Yhfp Length = 330 Back     alignment and structure
>pdb|1VJ0|A Chain A, Crystal Structure Of Alcohol Dehydrogenase (Tm0436) From Thermotoga Maritima At 2.00 A Resolution Length = 380 Back     alignment and structure
>pdb|1E3J|A Chain A, Ketose Reductase (Sorbitol Dehydrogenase) From Silverleaf Whitefly Length = 352 Back     alignment and structure
>pdb|2H6E|A Chain A, Crystal Structure Of The D-Arabinose Dehydrogenase From Sulfolobus Solfataricus Length = 344 Back     alignment and structure
>pdb|2ZB3|A Chain A, Crystal Structure Of Mouse 15-Ketoprostaglandin Delta-13- Reductase In Complex With Nadph Length = 353 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query335
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 0.0
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 0.0
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 1e-169
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 1e-166
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 1e-157
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 1e-153
4eye_A342 Probable oxidoreductase; structural genomics, niai 1e-149
3gms_A340 Putative NADPH:quinone reductase; structural genom 1e-149
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 1e-149
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 1e-135
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 1e-134
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 1e-119
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 1e-116
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 1e-111
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 1e-100
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 3e-99
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 4e-99
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 8e-98
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 5e-96
3krt_A456 Crotonyl COA reductase; structural genomics, prote 7e-93
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 2e-91
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 4e-85
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 8e-79
3fbg_A346 Putative arginate lyase; structural genomics, unkn 1e-73
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 5e-69
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 8e-69
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 2e-65
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 6e-63
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 7e-56
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 8e-52
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 2e-47
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 2e-47
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 5e-47
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 3e-46
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 1e-42
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 2e-42
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 5e-42
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 6e-41
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 1e-39
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 6e-39
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 4e-38
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 1e-36
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 2e-34
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 6e-34
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 2e-29
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 4e-28
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 4e-28
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 7e-28
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 1e-27
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 5e-21
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 5e-20
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 8e-20
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 2e-19
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 5e-18
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 2e-17
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 5e-16
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 2e-14
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 3e-14
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 4e-14
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 1e-13
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 2e-13
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 2e-13
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 3e-13
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 4e-13
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 4e-13
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 3e-12
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 3e-12
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 5e-11
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
 Score =  534 bits (1379), Expect = 0.0
 Identities = 154/334 (46%), Positives = 207/334 (61%), Gaps = 12/334 (3%)

Query: 1   MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPY 60
           M+ + +   G P+V+ + +   P   + EVL++ EA  +NR D  QR+GSYPPPK ASP 
Sbjct: 29  MRFVDLKSFGGPDVMVIGKRPLPVAGEGEVLVRAEAIGVNRPDIAQRQGSYPPPKDASPI 88

Query: 61  PGLECSGTILSVGKNVSRWKVGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAF 120
            GLE SG I+ VG  VS + VGD+VC L  GG YAE   +PAGQ+LP P G     AAA 
Sbjct: 89  LGLELSGEIVGVGPGVSGYAVGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDAVKAAAL 148

Query: 121 PEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGVRVFVT 180
           PE   TVW+ +F  + L+ GES L          +HGG+SGIGT AIQ+ +  G  V+ T
Sbjct: 149 PETFFTVWANLFQMAGLTEGESVL----------IHGGTSGIGTTAIQLARAFGAEVYAT 198

Query: 181 AGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNI 240
           AGS  K   C+ LGA   INY++EDF A +K ET G+GVD+ILD +GA+YF+RN+ SL  
Sbjct: 199 AGSTGKCEACERLGAKRGINYRSEDFAAVIKAET-GQGVDIILDMIGAAYFERNIASLAK 257

Query: 241 DGRLFIIGTQGGAKTE-LNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAV 299
           DG L II   GGA  E +N++ +  KRLTV  + +R R+ E K  I  ++   VWP +  
Sbjct: 258 DGCLSIIAFLGGAVAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEA 317

Query: 300 GKVKPVIYKYLPLCEAAEAHQLMESSQHIGKIML 333
           G V PVI+K     + A+AH+L+E   H+GK+ML
Sbjct: 318 GTVAPVIHKVFAFEDVADAHRLLEEGSHVGKVML 351


>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Length = 328 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Length = 330 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Length = 324 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Length = 333 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Length = 357 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Length = 345 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query335
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 100.0
4eye_A342 Probable oxidoreductase; structural genomics, niai 100.0
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 100.0
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 100.0
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 100.0
3gms_A340 Putative NADPH:quinone reductase; structural genom 100.0
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 100.0
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 100.0
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 100.0
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 100.0
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 100.0
3fbg_A346 Putative arginate lyase; structural genomics, unkn 100.0
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 100.0
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 100.0
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 100.0
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 100.0
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 100.0
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 100.0
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 100.0
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 100.0
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 100.0
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 100.0
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 100.0
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 100.0
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 100.0
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 100.0
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 100.0
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 100.0
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 100.0
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 100.0
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 100.0
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 100.0
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 100.0
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 100.0
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 100.0
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 100.0
3krt_A456 Crotonyl COA reductase; structural genomics, prote 100.0
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 100.0
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 100.0
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 100.0
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 100.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 100.0
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 100.0
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 100.0
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 100.0
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 100.0
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 100.0
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 100.0
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 100.0
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 100.0
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 100.0
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 100.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 100.0
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 100.0
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 100.0
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 100.0
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 100.0
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 100.0
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 100.0
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 100.0
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 100.0
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 100.0
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 100.0
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 100.0
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 100.0
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 100.0
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 100.0
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.91
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.79
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.56
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.5
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.43
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.43
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.36
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.16
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.96
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.78
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.75
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.67
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.56
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.49
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 97.47
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 97.4
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.37
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.33
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.18
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.15
4eso_A255 Putative oxidoreductase; NADP, structural genomics 97.12
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.11
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.08
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.07
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.07
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.0
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 96.95
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.93
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 96.93
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.93
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 96.92
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 96.92
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 96.91
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.87
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.86
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 96.84
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 96.76
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 96.76
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.76
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 96.75
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.74
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 96.73
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 96.72
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 96.69
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.69
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 96.68
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 96.66
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.64
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.63
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 96.62
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 96.62
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 96.62
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.62
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.62
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 96.61
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 96.61
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 96.6
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 96.59
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 96.57
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 96.55
4dqx_A277 Probable oxidoreductase protein; structural genomi 96.55
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 96.54
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 96.54
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.54
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 96.52
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.52
3imf_A257 Short chain dehydrogenase; structural genomics, in 96.49
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.49
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 96.49
1xq1_A266 Putative tropinone reducatse; structural genomics, 96.48
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 96.48
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 96.47
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 96.47
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.46
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.45
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 96.44
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 96.44
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 96.43
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 96.43
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 96.43
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.43
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 96.42
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 96.42
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.42
3tjr_A301 Short chain dehydrogenase; structural genomics, se 96.42
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 96.42
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 96.41
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 96.41
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.41
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 96.4
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.4
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 96.4
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.39
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 96.39
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 96.38
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 96.37
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 96.36
3tox_A280 Short chain dehydrogenase; structural genomics, PS 96.35
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 96.33
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 96.32
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 96.32
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 96.31
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 96.31
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 96.31
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.3
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 96.3
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 96.3
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 96.29
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 96.28
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 96.28
3edm_A259 Short chain dehydrogenase; structural genomics, ox 96.28
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 96.27
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 96.27
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.26
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 96.26
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 96.26
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 96.26
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.25
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 96.25
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 96.24
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 96.23
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 96.23
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 96.23
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.23
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 96.23
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 96.22
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 96.22
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.21
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 96.21
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 96.21
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.2
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 96.19
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 96.19
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 96.19
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.17
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 96.17
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 96.14
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.14
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 96.14
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.13
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.13
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 96.13
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 96.12
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.12
3gem_A260 Short chain dehydrogenase; structural genomics, AP 96.12
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 96.12
3cxt_A291 Dehydrogenase with different specificities; rossma 96.11
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.11
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 96.11
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 96.11
1nff_A260 Putative oxidoreductase RV2002; directed evolution 96.11
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 96.1
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.09
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 96.09
3qlj_A322 Short chain dehydrogenase; structural genomics, se 96.09
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.09
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.09
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 96.08
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 96.06
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 96.06
3rih_A293 Short chain dehydrogenase or reductase; structural 96.06
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 96.06
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 96.05
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.04
3tsc_A277 Putative oxidoreductase; structural genomics, seat 96.02
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.02
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.01
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 96.01
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 96.01
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 96.0
1xkq_A280 Short-chain reductase family member (5D234); parra 95.99
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 95.98
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 95.96
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.96
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 95.95
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 95.95
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 95.95
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 95.95
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 95.94
1xhl_A297 Short-chain dehydrogenase/reductase family member 95.94
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.94
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 95.94
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 95.93
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 95.93
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 95.93
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 95.9
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 95.89
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 95.89
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 95.88
1spx_A278 Short-chain reductase family member (5L265); paral 95.88
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 95.85
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 95.84
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 95.84
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 95.83
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 95.8
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 95.8
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 95.79
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 95.79
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 95.77
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 95.76
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 95.76
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 95.75
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 95.73
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 95.72
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 95.71
3e03_A274 Short chain dehydrogenase; structural genomics, PS 95.71
1xq6_A253 Unknown protein; structural genomics, protein stru 95.7
3l07_A285 Bifunctional protein fold; structural genomics, ID 95.7
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 95.7
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 95.7
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 95.68
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 95.68
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 95.67
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 95.6
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.6
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 95.58
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 95.58
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 95.56
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 95.55
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 95.54
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 95.54
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 95.53
3duw_A223 OMT, O-methyltransferase, putative; alternating of 95.52
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 95.51
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 95.51
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 95.5
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 95.48
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 95.47
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 95.47
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 95.47
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 95.46
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 95.45
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 95.45
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 95.44
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.42
3p2o_A285 Bifunctional protein fold; structural genomics, ce 95.41
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 95.4
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 95.4
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 95.4
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 95.4
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.4
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 95.39
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 95.38
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 95.37
4e4y_A244 Short chain dehydrogenase family protein; structur 95.35
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 95.35
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 95.34
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 95.34
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 95.33
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 95.32
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 95.32
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 95.32
2avd_A229 Catechol-O-methyltransferase; structural genomics, 95.32
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 95.3
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 95.29
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 95.29
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 95.29
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.26
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 95.26
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 95.26
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 95.26
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 95.24
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 95.24
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 95.24
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 95.21
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 95.21
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 95.16
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.16
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.16
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.15
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 95.15
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 95.14
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 95.14
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 95.11
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 95.1
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 95.1
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 95.09
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 95.08
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 95.08
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.07
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 95.05
2b25_A336 Hypothetical protein; structural genomics, methyl 95.02
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 95.02
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 95.02
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 95.01
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 95.01
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 94.97
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 94.97
1ooe_A236 Dihydropteridine reductase; structural genomics, P 94.96
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 94.95
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 94.94
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 94.84
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 94.82
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 94.79
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.78
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.75
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 94.74
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 94.72
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 94.72
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 94.71
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 94.71
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.69
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 94.65
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 94.65
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 94.62
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.61
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 94.59
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 94.59
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.57
3f4k_A257 Putative methyltransferase; structural genomics, P 94.55
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 94.53
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 94.53
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 94.52
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 94.52
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 94.51
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 94.51
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 94.48
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 94.48
1vl5_A260 Unknown conserved protein BH2331; putative methylt 94.47
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 94.47
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 94.47
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 94.47
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 94.44
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 94.43
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 94.43
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 94.4
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 94.4
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 94.38
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 94.38
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 94.38
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 94.35
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 94.27
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 94.27
1yb2_A275 Hypothetical protein TA0852; structural genomics, 94.21
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 94.2
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 94.2
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 94.19
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 94.17
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.16
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 94.16
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 94.15
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 94.14
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 94.13
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 94.13
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 94.12
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 94.08
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 94.07
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 94.06
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 94.05
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 94.04
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 94.04
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 94.03
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 93.99
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 93.98
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 93.98
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 93.96
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 93.95
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 93.93
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 93.88
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 93.87
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 93.87
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 93.86
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 93.85
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.84
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 93.83
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 93.81
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 93.78
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 93.78
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 93.76
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 93.75
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 93.71
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 93.71
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 93.71
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 93.69
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 93.68
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 93.63
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 93.62
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 93.6
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 93.57
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 93.54
2kw5_A202 SLR1183 protein; structural genomics, northeast st 93.53
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 93.5
3ius_A286 Uncharacterized conserved protein; APC63810, silic 93.47
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 93.46
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 93.45
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 93.45
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 93.42
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 93.4
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 93.39
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 93.34
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 93.34
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 93.31
3hnr_A220 Probable methyltransferase BT9727_4108; structural 93.26
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 93.2
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 93.19
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 93.15
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 93.15
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 93.13
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 93.1
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 93.06
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 93.03
3m33_A226 Uncharacterized protein; structural genomics, PSI- 93.03
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 93.0
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 92.98
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 92.98
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 92.98
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 92.95
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 92.93
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 92.93
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 92.89
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 92.88
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 92.88
3i9f_A170 Putative type 11 methyltransferase; structural gen 92.88
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 92.87
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 92.87
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 92.86
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 92.86
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 92.82
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 92.82
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 92.77
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 92.74
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 92.73
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 92.71
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 92.7
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 92.68
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 92.67
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 92.67
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 92.65
3dh0_A219 SAM dependent methyltransferase; cystal structure, 92.6
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 92.59
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
Probab=100.00  E-value=4.1e-57  Score=416.19  Aligned_cols=324  Identities=48%  Similarity=0.810  Sum_probs=301.7

Q ss_pred             CEEEEEcCCCCCcceEEEeecCCCCCCCcEEEEEEEeecCcchhhhhcCCCCCCCCCCCCCCCceEEEEEEecCCCCCCC
Q 019790            1 MKAIVITQPGSPEVLQLQEVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRWK   80 (335)
Q Consensus         1 mka~~~~~~~~~~~l~~~~~~~~~~~~~eVlI~v~~~~i~~~D~~~~~g~~~~~~~~p~~~G~e~~G~V~~vG~~~~~~~   80 (335)
                      |||+++..+|+|+.+++++.+.|+|+++||+|||.+++||++|++.+.|.++.+..+|.++|||++|+|+++|+++++|+
T Consensus        29 MkA~~~~~~g~~~~l~~~~~~~P~~~~~eVlVkv~a~gi~~~D~~~~~g~~~~~~~~p~i~G~E~~G~V~~vG~~v~~~~  108 (353)
T 4dup_A           29 MRFVDLKSFGGPDVMVIGKRPLPVAGEGEVLVRAEAIGVNRPDIAQRQGSYPPPKDASPILGLELSGEIVGVGPGVSGYA  108 (353)
T ss_dssp             EEEEEESSSSSGGGEEEEEECCCCCCTTEEEEEEEEEEECHHHHHHHTTSSCCCTTSCSSSCCEEEEEEEEECTTCCSCC
T ss_pred             eeEEEEccCCCccceEEEeccCCCCCCCEEEEEEEEEecCHHHHHHhCCCCCCCCCCCCccccccEEEEEEECCCCCCCC
Confidence            89999999998999999999999999999999999999999999999998877667899999999999999999999999


Q ss_pred             CCCEEEEecCCcceeeEEEecCCceEeCCCCCChhhhccCcchHHHHHHHHHHhcCCCCCCEEEEeeccccccccccccc
Q 019790           81 VGDQVCALLGGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSS  160 (335)
Q Consensus        81 ~Gd~V~~~~~~g~~~~~~~~~~~~~~~~p~~~~~~~aa~~~~~~~~a~~~l~~~~~~~~~~~vli~~~~~~~~~~~g~~g  160 (335)
                      +||+|+++..+|+|+||++++++.++++|+++++++||+++++++|||+++.+.+++++|++|||          +||+|
T Consensus       109 vGdrV~~~~~~G~~aey~~v~~~~~~~~P~~~~~~~aa~l~~~~~ta~~~l~~~~~~~~g~~VlV----------~Gg~g  178 (353)
T 4dup_A          109 VGDKVCGLANGGAYAEYCLLPAGQILPFPKGYDAVKAAALPETFFTVWANLFQMAGLTEGESVLI----------HGGTS  178 (353)
T ss_dssp             TTCEEEEECSSCCSBSEEEEEGGGEEECCTTCCHHHHHTSHHHHHHHHHHHTTTTCCCTTCEEEE----------SSTTS
T ss_pred             CCCEEEEecCCCceeeEEEEcHHHcEeCCCCCCHHHHhhhhhHHHHHHHHHHHhcCCCCCCEEEE----------EcCCC
Confidence            99999999889999999999999999999999999999999999999999988899999999999          99999


Q ss_pred             hHHHHHHHHHhhCCCeEEEEecChhhHHHHHHcCCCEEEeCCCccHHHHHHHHhCCCcccEEEeCCChhhHHHhhccccC
Q 019790          161 GIGTFAIQMGKCQGVRVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNLGSLNI  240 (335)
Q Consensus       161 ~~G~~a~~~a~~~g~~V~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~d~vid~~g~~~~~~~~~~l~~  240 (335)
                      ++|++++|+|+..|++|+++++++++++.++++|++.++|+.+.++.+.+++.+ +.++|++|||+|+..+..++++|++
T Consensus       179 ~iG~~~~~~a~~~Ga~Vi~~~~~~~~~~~~~~lGa~~~~~~~~~~~~~~~~~~~-~~g~Dvvid~~g~~~~~~~~~~l~~  257 (353)
T 4dup_A          179 GIGTTAIQLARAFGAEVYATAGSTGKCEACERLGAKRGINYRSEDFAAVIKAET-GQGVDIILDMIGAAYFERNIASLAK  257 (353)
T ss_dssp             HHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHTCSEEEETTTSCHHHHHHHHH-SSCEEEEEESCCGGGHHHHHHTEEE
T ss_pred             HHHHHHHHHHHHcCCEEEEEeCCHHHHHHHHhcCCCEEEeCCchHHHHHHHHHh-CCCceEEEECCCHHHHHHHHHHhcc
Confidence            999999999999999999999999999999999999999999999999999998 6799999999999989999999999


Q ss_pred             CCEEEEEeccCCCccc-cChhHHhhcceEEEEeeccccchhhHHHHHHHHHHHHHHHHHCCccccccccccchhhHHHHH
Q 019790          241 DGRLFIIGTQGGAKTE-LNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWPAIAVGKVKPVIYKYLPLCEAAEAH  319 (335)
Q Consensus       241 ~G~~v~~g~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~l~~~~~a~  319 (335)
                      +|+++.+|...+.... ++...++.+++++.++.+......+.....++.++.+++++++|+++++++++|+++++++|+
T Consensus       258 ~G~iv~~g~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~l~~~i~~~~~l~~~~~A~  337 (353)
T 4dup_A          258 DGCLSIIAFLGGAVAEKVNLSPIMVKRLTVTGSTMRPRTAEEKRAIRDDLLSEVWPLLEAGTVAPVIHKVFAFEDVADAH  337 (353)
T ss_dssp             EEEEEECCCTTCSEEEEEECHHHHHTTCEEEECCSTTSCHHHHHHHHHHHHHHTHHHHHHTSSCCCEEEEEEGGGHHHHH
T ss_pred             CCEEEEEEecCCCcccCCCHHHHHhcCceEEEEeccccchhhhHHHHHHHHHHHHHHHHCCCccCCcceEEeHHHHHHHH
Confidence            9999999977655434 777788899999999988776655555556666888999999999999999999999999999


Q ss_pred             HHHHhCCCceeEEEeC
Q 019790          320 QLMESSQHIGKIMLVP  335 (335)
Q Consensus       320 ~~~~~~~~~gkvvi~~  335 (335)
                      +.+.+++..||+|+++
T Consensus       338 ~~l~~~~~~gKvvl~~  353 (353)
T 4dup_A          338 RLLEEGSHVGKVMLTV  353 (353)
T ss_dssp             HHHHHTCCSSEEEEEC
T ss_pred             HHHHhCCCCceEEEeC
Confidence            9999999999999975



>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 335
d1pqwa_183 c.2.1.1 (A:) Putative enoyl reductase domain of po 2e-26
d1xa0a1152 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo 2e-26
d1o89a1146 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein 3e-24
d1yb5a1150 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductas 2e-23
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 8e-23
d1qora2179 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escher 1e-22
d1iz0a1131 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase 3e-22
d1gu7a2189 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yea 4e-22
d1qora1147 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductas 5e-22
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 2e-21
d1tt7a1162 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein 3e-21
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 3e-21
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 3e-19
d1yb5a2174 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human 6e-19
d1rjwa1171 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase 3e-18
d1jvba1177 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase 7e-18
d1f8fa2174 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { 9e-17
d1e3ia1202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 5e-16
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 5e-16
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 3e-15
d1gu7a1175 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu 3e-15
d1xa0a2176 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Ba 5e-15
d2jhfa1198 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase 8e-15
d1h2ba1171 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas 3e-14
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 7e-14
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 1e-13
d2jhfa2176 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( 1e-13
d1o89a2177 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Esc 2e-13
d2fzwa2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 5e-13
d1uufa1179 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein 5e-13
d1iz0a2171 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus 8e-13
d1h2ba2172 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeo 9e-13
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 2e-12
d1v3va2182 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehyd 4e-12
d1vj0a1184 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein 6e-12
d1uufa2168 c.2.1.1 (A:145-312) Hypothetical protein YahK {Esc 2e-11
d1cdoa2175 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga 2e-11
d1pl8a2171 c.2.1.1 (A:146-316) Ketose reductase (sorbitol deh 3e-11
d1kola2195 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps 3e-11
d1jqba1177 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon 6e-11
d1p0fa2174 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog 1e-10
d1o8ca277 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Esc 7e-10
d1jqba2174 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol 2e-09
d1vj0a2182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 6e-09
d1e3ja2170 c.2.1.1 (A:143-312) Ketose reductase (sorbitol deh 1e-08
d1jvba2170 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeo 2e-08
d1llua2166 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudom 6e-08
d1vj1a2187 c.2.1.1 (A:125-311) Putative zinc-binding alcohol 3e-07
d1rjwa2168 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillu 3e-07
d1d1ta2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 9e-07
d1e3ia2174 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( 4e-06
d1v3va1147 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hyd 8e-06
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 2e-04
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 0.002
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 0.003
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Putative enoyl reductase domain of polyketide synthase
species: Mycobacterium tuberculosis [TaxId: 1773]
 Score =  101 bits (252), Expect = 2e-26
 Identities = 48/190 (25%), Positives = 82/190 (43%), Gaps = 11/190 (5%)

Query: 116 DAAAFPEVACTVWSTVFMTSHLSPGESFLVDFCSISYSDVHGGSSGIGTFAIQMGKCQGV 175
           +AA F     T W ++     LSPGE  L+          H  + G+G  A+ + K  G 
Sbjct: 2   EAATFGVAYLTAWHSLCEVGRLSPGERVLI----------HSATGGVGMAAVSIAKMIGA 51

Query: 176 RVFVTAGSEEKLAVCKDLGADVCINYKTEDFVARVKEETGGKGVDVILDCMGASYFQRNL 235
           R++ TAGS+ K  +   LG +   + ++ DF   + E T G GVDV+L+ +     QR +
Sbjct: 52  RIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGV 111

Query: 236 GSLNIDGRLFIIGTQGGAKTELNITSLFAKRLTVQAAGLRSRSTENKALIVSEVEKNVWP 295
             L   GR   +G +          +  AK  +     L        A    ++ +++  
Sbjct: 112 QILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARY-RQLLQHILQ 170

Query: 296 AIAVGKVKPV 305
            +A GK++ +
Sbjct: 171 HVADGKLEVL 180


>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 189 Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 147 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 176 Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 177 Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 172 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 182 Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 168 Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 170 Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 170 Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 187 Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 147 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query335
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.97
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.96
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.96
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.95
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.95
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.95
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.95
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.95
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.95
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.95
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.95
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.95
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.94
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.94
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.94
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.94
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.94
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.94
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.94
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 99.94
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.93
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.93
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.93
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.92
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.92
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 99.92
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.92
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.91
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.91
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.91
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 99.91
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.9
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.9
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 99.9
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.9
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.89
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.89
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.89
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.89
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.89
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.89
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.89
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.89
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.89
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.89
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.88
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.88
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.87
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.87
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.86
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.86
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.84
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 99.7
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.66
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.46
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.62
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.55
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.43
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.36
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.28
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.23
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.17
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.12
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.08
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 97.06
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.06
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.05
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.02
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 96.97
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.96
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.95
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.93
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 96.93
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 96.92
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 96.9
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.89
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.89
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 96.89
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.88
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 96.86
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.86
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 96.86
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 96.86
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 96.85
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 96.84
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 96.82
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.78
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.78
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 96.77
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.76
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.74
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.74
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 96.72
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.71
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 96.69
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.68
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 96.65
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.64
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 96.57
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.56
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.54
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.53
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.5
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.5
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.48
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.48
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 96.48
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.47
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 96.45
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.44
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 96.44
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.43
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.42
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.41
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 96.39
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.33
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.33
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.31
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.3
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 96.29
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.28
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 96.24
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 96.22
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 96.13
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.11
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 96.07
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.05
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 96.02
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.98
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 95.96
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 95.95
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 95.84
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 95.83
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 95.82
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 95.79
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 95.79
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 95.78
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 95.74
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 95.65
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.54
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 95.54
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 95.48
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 95.48
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 95.34
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.21
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 95.21
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 94.99
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 94.93
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.92
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 94.77
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 94.64
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 94.49
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 94.45
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 94.32
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 94.28
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 94.27
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 94.22
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 94.16
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 94.15
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 94.05
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.0
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 93.97
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 93.92
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 93.87
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 93.75
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.74
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 93.65
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 93.59
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 93.3
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 93.16
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 93.13
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 93.06
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 92.93
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.91
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 92.88
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 92.83
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 92.81
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 92.74
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.72
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.51
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 92.26
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 92.07
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 91.87
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 91.62
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 91.61
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 91.33
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 91.28
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 91.28
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 91.27
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.25
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 91.08
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.91
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 90.82
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 90.79
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 90.76
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 90.58
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 90.41
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 90.41
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 90.37
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 90.34
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.23
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 90.22
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 90.15
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 90.01
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 89.93
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 89.86
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.67
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.65
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 89.53
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 89.37
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 89.3
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 89.29
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 89.24
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.21
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 89.2
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 89.13
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 89.03
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 88.98
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.78
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 88.73
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 88.62
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 88.58
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 88.48
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 88.45
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 88.23
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 88.18
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 88.01
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 87.88
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 87.86
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 87.68
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 87.66
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 87.65
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 87.52
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 87.26
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 87.16
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 87.0
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 86.96
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 86.89
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 86.88
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 86.73
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 86.53
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.46
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.27
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.18
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 86.03
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 85.99
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 85.24
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 85.11
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 84.91
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 84.85
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 84.7
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 84.5
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 84.39
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 84.12
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 83.85
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 83.78
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 83.76
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 83.67
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 83.64
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 83.61
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 83.07
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 82.0
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 81.69
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 81.52
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 80.81
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 80.65
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Quinone oxidoreductase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=3.1e-31  Score=211.47  Aligned_cols=145  Identities=30%  Similarity=0.443  Sum_probs=136.9

Q ss_pred             CEEEEEcCCCCCcceEEE-eecCCCCCCCcEEEEEEEeecCcchhhhhcCCCCCCCCCCCCCCCceEEEEEEecCCCCCC
Q 019790            1 MKAIVITQPGSPEVLQLQ-EVEDPQIKDDEVLIKVEATALNRADTLQRKGSYPPPKGASPYPGLECSGTILSVGKNVSRW   79 (335)
Q Consensus         1 mka~~~~~~~~~~~l~~~-~~~~~~~~~~eVlI~v~~~~i~~~D~~~~~g~~~~~~~~p~~~G~e~~G~V~~vG~~~~~~   79 (335)
                      |||++++++|+|+.++++ +.+.|.|++|||+|||.+++||++|++.+.|..+....+|.++|||++|+|+++|+++++|
T Consensus         3 MkAv~~~~~G~p~~l~~~~~~~~P~~~~~eVlVkv~a~~i~~~D~~~~~g~~~~~~~~p~i~G~e~~G~V~~vG~~v~~~   82 (150)
T d1yb5a1           3 MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAF   82 (150)
T ss_dssp             EEEEEESSCSSGGGEEEEEEEECCCCCTTEEEEEEEEEECCHHHHHHHHTCSSCCCCSSBCCCSCEEEEEEEECTTCTTC
T ss_pred             eeEEEEEccCCcceEEEEeecCCCCCCCCeEEEEEEEecCcccchhhhcCCcCccccccccCccceeeeeEeecceeecc
Confidence            899999999999999986 5799999999999999999999999999999888877889999999999999999999999


Q ss_pred             CCCCEEEEec-CCcceeeEEEecCCceEeCCCCCChhhhccCcchHHHHHHHHHHhcCCCCCCEEEE
Q 019790           80 KVGDQVCALL-GGGGYAEKVAVPAGQVLPVPSGVSLKDAAAFPEVACTVWSTVFMTSHLSPGESFLV  145 (335)
Q Consensus        80 ~~Gd~V~~~~-~~g~~~~~~~~~~~~~~~~p~~~~~~~aa~~~~~~~~a~~~l~~~~~~~~~~~vli  145 (335)
                      ++||+|++.. .+|+|+||+.++++.++++|+++++++||+++...+|+|+++...+....|+++||
T Consensus        83 ~vGdrV~~~~~~~G~~ae~~~v~~~~~~~iP~~ls~~~Aa~~~~~~~ta~~~~~~~g~~~~G~~vli  149 (150)
T d1yb5a1          83 KKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILL  149 (150)
T ss_dssp             CTTCEEEESCCSSCSSBSEEEEEGGGEEECCTTCCCCEEEEEEGGGHHHHHHHHHHSSCCSSEEEEE
T ss_pred             ccCccccccccccccccccccccccccccccCCCCHHHHHHhhhhhhhehhhheEEcCcccCCEEEE
Confidence            9999998765 45899999999999999999999999999999999999999988899999999988



>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure