Citrus Sinensis ID: 019858
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 335 | ||||||
| 255557651 | 727 | lipid binding protein, putative [Ricinus | 0.916 | 0.422 | 0.928 | 1e-173 | |
| 356496432 | 725 | PREDICTED: uncharacterized protein LOC10 | 0.922 | 0.426 | 0.899 | 1e-168 | |
| 357484695 | 725 | Kinase-START [Medicago truncatula] gi|35 | 0.922 | 0.426 | 0.903 | 1e-167 | |
| 449456757 | 724 | PREDICTED: uncharacterized protein LOC10 | 0.913 | 0.422 | 0.902 | 1e-167 | |
| 225427393 | 716 | PREDICTED: uncharacterized protein LOC10 | 0.922 | 0.431 | 0.893 | 1e-165 | |
| 297800150 | 718 | hypothetical protein ARALYDRAFT_492951 [ | 0.916 | 0.427 | 0.889 | 1e-165 | |
| 42566947 | 718 | enhanced disease resistance 2 protein [A | 0.916 | 0.427 | 0.885 | 1e-165 | |
| 224139070 | 725 | predicted protein [Populus trichocarpa] | 0.946 | 0.437 | 0.858 | 1e-164 | |
| 225427395 | 722 | PREDICTED: uncharacterized protein LOC10 | 0.922 | 0.427 | 0.876 | 1e-164 | |
| 359474679 | 715 | PREDICTED: uncharacterized protein LOC10 | 0.922 | 0.432 | 0.876 | 1e-164 |
| >gi|255557651|ref|XP_002519855.1| lipid binding protein, putative [Ricinus communis] gi|223540901|gb|EEF42459.1| lipid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 614 bits (1583), Expect = e-173, Method: Compositional matrix adjust.
Identities = 285/307 (92%), Positives = 296/307 (96%)
Query: 3 SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRVE 62
SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYK+KPQDNQVPIKT+LIDGNCRVE
Sbjct: 2 SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKRKPQDNQVPIKTMLIDGNCRVE 61
Query: 63 DRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIELVIDQHQESQVSNGN 122
DRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIE VIDQHQESQV NGN
Sbjct: 62 DRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIEFVIDQHQESQVVNGN 121
Query: 123 KYVSFEYKSGMDNGRNGSSSDHESQFSAQEDEDDGHLNLMRRTTIGNGPPDLVHDWTREL 182
KY+SFEYKSGMDNGR SSSDHESQFSAQEDEDD + NL+RRTTIGNGPPD V DWTRE+
Sbjct: 122 KYISFEYKSGMDNGRTASSSDHESQFSAQEDEDDANPNLLRRTTIGNGPPDSVLDWTREV 181
Query: 183 DSDLSNQNINNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCEE 242
DS+LS QN NNQAFSRKHWRLLQCQNGLRIFEEL+EVDYLPRSCSRAMKAVGVVEA+CEE
Sbjct: 182 DSELSTQNANNQAFSRKHWRLLQCQNGLRIFEELVEVDYLPRSCSRAMKAVGVVEATCEE 241
Query: 243 IFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWR 302
IFELVMSMDGTR+EWDCSFQYGSLVEEVDGHTAILYHRLQLDWFP F+WPRDLCYVRYWR
Sbjct: 242 IFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPAFIWPRDLCYVRYWR 301
Query: 303 RNDDGSY 309
RNDDGSY
Sbjct: 302 RNDDGSY 308
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356496432|ref|XP_003517072.1| PREDICTED: uncharacterized protein LOC100806401 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357484695|ref|XP_003612635.1| Kinase-START [Medicago truncatula] gi|355513970|gb|AES95593.1| Kinase-START [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449456757|ref|XP_004146115.1| PREDICTED: uncharacterized protein LOC101209463 [Cucumis sativus] gi|449509520|ref|XP_004163612.1| PREDICTED: uncharacterized LOC101209463 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225427393|ref|XP_002262725.1| PREDICTED: uncharacterized protein LOC100246589 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297800150|ref|XP_002867959.1| hypothetical protein ARALYDRAFT_492951 [Arabidopsis lyrata subsp. lyrata] gi|297313795|gb|EFH44218.1| hypothetical protein ARALYDRAFT_492951 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42566947|ref|NP_193639.2| enhanced disease resistance 2 protein [Arabidopsis thaliana] gi|332658730|gb|AEE84130.1| enhanced disease resistance 2 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224139070|ref|XP_002326760.1| predicted protein [Populus trichocarpa] gi|222834082|gb|EEE72559.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225427395|ref|XP_002262787.1| PREDICTED: uncharacterized protein LOC100246589 isoform 3 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359474679|ref|XP_003631511.1| PREDICTED: uncharacterized protein LOC100246589 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 335 | ||||||
| TAIR|locus:2117134 | 724 | EDR2 "ENHANCED DISEASE RESISTA | 0.916 | 0.424 | 0.869 | 2.6e-150 | |
| TAIR|locus:2163548 | 719 | AT5G45560 [Arabidopsis thalian | 0.916 | 0.426 | 0.856 | 7.1e-148 | |
| TAIR|locus:2102465 | 733 | AT3G54800 [Arabidopsis thalian | 0.397 | 0.181 | 0.404 | 6.7e-34 | |
| TAIR|locus:2057547 | 737 | AT2G28320 [Arabidopsis thalian | 0.420 | 0.191 | 0.406 | 1e-31 | |
| TAIR|locus:2182417 | 811 | AT5G35180 [Arabidopsis thalian | 0.892 | 0.368 | 0.264 | 7.6e-21 |
| TAIR|locus:2117134 EDR2 "ENHANCED DISEASE RESISTANCE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1467 (521.5 bits), Expect = 2.6e-150, P = 2.6e-150
Identities = 272/313 (86%), Positives = 288/313 (92%)
Query: 3 SKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRVE 62
SKVVYEGWMVRYGRRKIGRS+IHMRYFVLE RLLAYYKKKPQD QVPIKT+LIDGNCRVE
Sbjct: 2 SKVVYEGWMVRYGRRKIGRSYIHMRYFVLEPRLLAYYKKKPQDYQVPIKTMLIDGNCRVE 61
Query: 63 DRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIELVIDQHQESQVSNGN 122
DRGLKTHHGHMVYVLSVYNKKEK HRITMAAFNIQEAL+WKEKIE VIDQHQESQV NG
Sbjct: 62 DRGLKTHHGHMVYVLSVYNKKEKSHRITMAAFNIQEALMWKEKIESVIDQHQESQVPNGQ 121
Query: 123 KYVSFEYKSGMDNGRNGSSSDHESQ------FSAQEDEDDGHLNLMRRTTIGNGPPDLVH 176
+YVSFEYKSGMD GR SSSDHESQ FSA EDE+D +LMRRTTIGNGPP+ V
Sbjct: 122 QYVSFEYKSGMDTGRTASSSDHESQSAISFRFSAAEDEEDSRRSLMRRTTIGNGPPESVL 181
Query: 177 DWTRELDSDLSNQNINNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVV 236
DWT+E D++L+NQN +NQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVV
Sbjct: 182 DWTKEFDAELANQNSDNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVV 241
Query: 237 EASCEEIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLC 296
EA+CEEIFEL+MSMDGTRYEWDCSFQ+GSLVEEVDGHTA+LYHRL LDWFPM VWPRDLC
Sbjct: 242 EATCEEIFELLMSMDGTRYEWDCSFQFGSLVEEVDGHTAVLYHRLLLDWFPMIVWPRDLC 301
Query: 297 YVRYWRRNDDGSY 309
YVRYWRRNDDGSY
Sbjct: 302 YVRYWRRNDDGSY 314
|
|
| TAIR|locus:2163548 AT5G45560 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2102465 AT3G54800 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057547 AT2G28320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2182417 AT5G35180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 335 | |||
| PLN00188 | 719 | PLN00188, PLN00188, enhanced disease resistance pr | 0.0 | |
| cd00177 | 193 | cd00177, START, Lipid-binding START domain of mamm | 7e-28 | |
| smart00234 | 205 | smart00234, START, in StAR and phosphatidylcholine | 1e-21 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 1e-07 | |
| pfam01852 | 205 | pfam01852, START, START domain | 1e-06 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 6e-06 | |
| cd13297 | 123 | cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin h | 1e-05 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 9e-05 |
| >gnl|CDD|215094 PLN00188, PLN00188, enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
Score = 690 bits (1782), Expect = 0.0
Identities = 287/308 (93%), Positives = 297/308 (96%)
Query: 2 SSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRV 61
+SKVVYEGWMVRYGRRKIGRS+IHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRV
Sbjct: 1 ASKVVYEGWMVRYGRRKIGRSYIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRV 60
Query: 62 EDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIELVIDQHQESQVSNG 121
EDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIE VIDQHQ+SQV NG
Sbjct: 61 EDRGLKTHHGHMVYVLSVYNKKEKYHRITMAAFNIQEALIWKEKIESVIDQHQDSQVPNG 120
Query: 122 NKYVSFEYKSGMDNGRNGSSSDHESQFSAQEDEDDGHLNLMRRTTIGNGPPDLVHDWTRE 181
NKY SFEYKSGMDNGR SSSDHESQFSAQEDE+D H +L+RRTTIGNGPPD V DWT+E
Sbjct: 121 NKYASFEYKSGMDNGRTASSSDHESQFSAQEDEEDTHRDLLRRTTIGNGPPDSVLDWTKE 180
Query: 182 LDSDLSNQNINNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCE 241
DS+LSNQN NNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEA+CE
Sbjct: 181 FDSELSNQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCE 240
Query: 242 EIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYW 301
EIFELVMSMDGTR+EWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYW
Sbjct: 241 EIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYW 300
Query: 302 RRNDDGSY 309
RRNDDGSY
Sbjct: 301 RRNDDGSY 308
|
Length = 719 |
| >gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|216740 pfam01852, START, START domain | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH) domain, repeat 3 | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 335 | |||
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 100.0 | |
| cd08904 | 204 | START_STARD6-like Lipid-binding START domain of ma | 99.86 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 99.83 | |
| cd08903 | 208 | START_STARD5-like Lipid-binding START domain of ma | 99.83 | |
| cd08872 | 235 | START_STARD11-like Ceramide-binding START domain o | 99.82 | |
| cd08909 | 205 | START_STARD13-like C-terminal lipid-binding START | 99.81 | |
| cd08867 | 206 | START_STARD4_5_6-like Lipid-binding START domain o | 99.81 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 99.77 | |
| cd08911 | 207 | START_STARD7-like Lipid-binding START domain of ma | 99.76 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 99.76 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 99.74 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 99.74 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 99.74 | |
| cd08873 | 235 | START_STARD14_15-like Lipid-binding START domain o | 99.73 | |
| cd08914 | 236 | START_STARD15-like Lipid-binding START domain of m | 99.73 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 99.72 | |
| PF01852 | 206 | START: START domain; InterPro: IPR002913 START (St | 99.7 | |
| cd08913 | 240 | START_STARD14-like Lipid-binding START domain of m | 99.67 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 99.66 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 99.64 | |
| cd08905 | 209 | START_STARD1-like Cholesterol-binding START domain | 99.63 | |
| cd08910 | 207 | START_STARD2-like Lipid-binding START domain of ma | 99.63 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 99.58 | |
| cd08907 | 205 | START_STARD8-like C-terminal lipid-binding START d | 99.57 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.57 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.54 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.51 | |
| cd08902 | 202 | START_STARD4-like Lipid-binding START domain of ma | 99.51 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.45 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.4 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.39 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.39 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.37 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.36 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 99.36 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.35 | |
| KOG2761 | 219 | consensus START domain-containing proteins involve | 99.35 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 99.34 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.34 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.32 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.27 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.24 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.24 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.23 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 99.1 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 99.07 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 99.04 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.0 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 98.97 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 98.97 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 98.97 | |
| KOG0930 | 395 | consensus Guanine nucleotide exchange factor Cytoh | 98.89 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 98.89 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 98.88 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 98.87 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 98.83 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 98.8 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 98.7 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 98.4 | |
| cd08875 | 229 | START_ArGLABRA2_like C-terminal lipid-binding STAR | 98.23 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 97.85 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 97.71 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 97.56 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 97.53 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 97.45 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 97.44 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 97.26 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 97.24 | |
| KOG1739 | 611 | consensus Serine/threonine protein kinase GPBP [Si | 97.17 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 97.11 | |
| PF15408 | 104 | PH_7: Pleckstrin homology domain | 97.06 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 96.49 | |
| PLN02866 | 1068 | phospholipase D | 96.49 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 96.46 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 96.22 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 96.11 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 96.09 | |
| KOG3640 | 1116 | consensus Actin binding protein Anillin [Cell cycl | 95.9 | |
| cd08864 | 208 | SRPBCC_DUF3074 DUF3074, an uncharacterized ligand- | 95.83 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 95.77 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 95.48 | |
| KOG1090 | 1732 | consensus Predicted dual-specificity phosphatase [ | 94.32 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 94.32 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 93.7 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 92.26 | |
| KOG3751 | 622 | consensus Growth factor receptor-bound proteins (G | 91.99 | |
| KOG2059 | 800 | consensus Ras GTPase-activating protein [Signal tr | 91.04 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 90.84 | |
| KOG4424 | 623 | consensus Predicted Rho/Rac guanine nucleotide exc | 89.93 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 89.29 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 88.56 | |
| cd07819 | 140 | SRPBCC_2 Ligand-binding SRPBCC domain of an unchar | 88.07 | |
| KOG1117 | 1186 | consensus Rho- and Arf-GTPase activating protein A | 86.63 | |
| cd08860 | 146 | TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom | 86.11 | |
| cd08866 | 144 | SRPBCC_11 Ligand-binding SRPBCC domain of an uncha | 85.95 | |
| cd07813 | 138 | COQ10p_like Coenzyme Q-binding protein COQ10p and | 85.83 |
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.9e-101 Score=792.93 Aligned_cols=323 Identities=89% Similarity=1.421 Sum_probs=314.1
Q ss_pred CCCCceeeeEEEeeecccccccceeeEEEEecceeeecccCCCCCCCccEEEEecCceEEeeCCcceecCceeEEEEEEe
Q 019858 2 SSKVVYEGWMVRYGRRKIGRSFIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRVEDRGLKTHHGHMVYVLSVYN 81 (335)
Q Consensus 2 ~~~~~~EGWly~~g~~~~g~q~~~~RyFVL~g~~l~~YK~~P~~~~~Pirs~vid~~~rVed~Gre~~hg~~~yvf~iyn 81 (335)
++.+.||||||++|+||||++|||+|||||+||+|+|||++|.++++|||+|+||+||||||+|||+|||++||||+|||
T Consensus 1 ~~~~~~eGW~y~~g~~kig~~~~~~Ry~vl~~~~~~~yK~~P~~~~~pirs~~id~~~rVed~Gr~~~~g~~~yvl~~Yn 80 (719)
T PLN00188 1 ASKVVYEGWMVRYGRRKIGRSYIHMRYFVLESRLLAYYKKKPQDNQVPIKTLLIDGNCRVEDRGLKTHHGHMVYVLSVYN 80 (719)
T ss_pred CCcceEeeEEEEEcccccccccceeEEEEEecchhhhcccCCccccccceeeccCCCceEeecCceEEcCceEEEEEEec
Confidence 45778999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCcceEEEeecCHHHHHHHHHHHHHHHhhhhhhhccCCCccccccccccCCCCCCCCCCccccccccccccccccccc
Q 019858 82 KKEKYHRITMAAFNIQEALIWKEKIELVIDQHQESQVSNGNKYVSFEYKSGMDNGRNGSSSDHESQFSAQEDEDDGHLNL 161 (335)
Q Consensus 82 ~~~~~~~~~laa~s~eea~~W~~a~~~Ai~q~~~~~~~~~~~~~s~~~~~~~~~~~~~s~s~~~s~~~~~~~~~~~~~~l 161 (335)
+++|++|+||||.|+|||++||+||++||+|+++.....+++|++++++..+.+|++.++++++++++++...++.++.+
T Consensus 81 ~~~~~~~~~~~a~~~eea~~W~~a~~~a~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~ 160 (719)
T PLN00188 81 KKEKYHRITMAAFNIQEALIWKEKIESVIDQHQDSQVPNGNKYASFEYKSGMDNGRTASSSDHESQFSAQEDEEDTHRDL 160 (719)
T ss_pred CCCccccEEEecCCHHHHHHHHHHHHHHHhhhccccccccccccceeeccccccccccccccccccccccccccccCccc
Confidence 99999999999999999999999999999999999888888999999999899999999999999988888888889999
Q ss_pred eeeeeecCCCCCCcccCcccccCccccCCCCccccccCCcEEEEeecCeEEEEEecccCCCCccCccceEEeeeeecCHH
Q 019858 162 MRRTTIGNGPPDLVHDWTRELDSDLSNQNINNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCE 241 (335)
Q Consensus 162 ~rr~tig~gp~~~~~dwt~~~~~~~~n~~~~~dv~~~~~W~l~~~~nGlrif~e~~~~~~~~~~~~~~~kavgvV~aspe 241 (335)
.||+|||||||.++.|||...+.+.+|+++++||++.++|+||+|+||||||+|+.+++|++++++++|||||||+||||
T Consensus 161 ~r~~tig~gp~~s~~~~t~~~~~~~~~~~~~~d~~~~~~Wr~~~c~NGlRiF~e~~~~~~~~~~~~~~mKavGVV~aspE 240 (719)
T PLN00188 161 LRRTTIGNGPPDSVLDWTKEFDSELSNQNSNNQAFSRKHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEATCE 240 (719)
T ss_pred ceeeeccCCCcchhcccccccCccccccCCCccccccCCeEEEEeeccceeehhhhccccccccCCceeEEEEEecCCHH
Confidence 99999999999999999999999899999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhccCCCcccccceeeeeeEEEEEeCcccEEEEEEeeCcccCcccCceeEEEEeeEecCCCcEEEEEeeeechhh
Q 019858 242 EIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRRNDDGSYGSMRTVVHNQDM 321 (335)
Q Consensus 242 ~IFe~lm~~d~~R~eWD~~~~~~~vVE~iD~HtdIvy~~~~p~wlp~~~~~RDlv~~RyWrR~~DGsYvIl~~Sv~H~~~ 321 (335)
+||++||+++.+|+|||+++++++|||+||+||||+|++++|.|+|++++|||||++|||+|++||+|+|+++||+||+|
T Consensus 241 ~Ifd~Vm~~~~~R~eWD~~~~~~~vIE~ID~htdI~Y~~~~~~~~~~~ispRDFV~~Rywrr~eDGsYvil~~Sv~Hp~c 320 (719)
T PLN00188 241 EIFELVMSMDGTRFEWDCSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRRNDDGSYVVLFRSREHENC 320 (719)
T ss_pred HHHHHHhccCcccccchhcccceEEEEEecCCeEEEEEEeccccccCccCcceeEEEEEEEEcCCCcEEEeeeeeecCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhh
Q 019858 322 YEL 324 (335)
Q Consensus 322 ~~~ 324 (335)
|-.
T Consensus 321 PP~ 323 (719)
T PLN00188 321 GPQ 323 (719)
T ss_pred CCC
Confidence 743
|
|
| >cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains | Back alignment and domain information |
|---|
| >cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins | Back alignment and domain information |
|---|
| >cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] | Back alignment and domain information |
|---|
| >cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins | Back alignment and domain information |
|---|
| >cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG2761 consensus START domain-containing proteins involved in steroidogenesis/phosphatidylcholine transfer [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15408 PH_7: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains | Back alignment and domain information |
|---|
| >cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 335 | |||
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 8e-24 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 3e-20 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 3e-19 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 1e-18 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 5e-18 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 4e-17 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 3e-15 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 1e-13 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 6e-13 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 8e-07 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 3e-06 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 3e-06 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 4e-06 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 8e-06 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 2e-05 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 2e-05 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 2e-05 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 3e-05 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 3e-05 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 3e-05 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 6e-05 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 7e-05 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 9e-05 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 9e-05 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 1e-04 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 1e-04 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 1e-04 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 2e-04 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 2e-04 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 2e-04 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 2e-04 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 2e-04 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 7e-04 |
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Length = 258 | Back alignment and structure |
|---|
Score = 97.5 bits (242), Expect = 8e-24
Identities = 29/161 (18%), Positives = 55/161 (34%), Gaps = 17/161 (10%)
Query: 162 MRRTTIGNGPPDLVHDWTRELDSDLSNQNINN--QAFSRKHWRLLQCQNGLRIFEELLEV 219
+ P W LS N+++ ++ +W L + +R++
Sbjct: 29 IVSCKQTEVPLS--VPWDPSNQVYLSYNNVSSLKMLVAKDNWVLSSEISQVRLY------ 80
Query: 220 DYLPRSCSRAMKAVGVVEASCEEIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAILYH 279
L + VV + F L+ + R EWD ++ LV++VD AI +
Sbjct: 81 -TLEDDKFLSFHMEMVVHVDAAQAFLLLSDLR-QRPEWDKHYRSVELVQQVDEDDAIYHV 138
Query: 280 RLQLDWFPMFVWPRDLCYVRYWRRNDDGSYG---SMRTVVH 317
P+D + R+ D ++R+V
Sbjct: 139 TSP--ALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTL 177
|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Length = 229 | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Length = 255 | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Length = 224 | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Length = 231 | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Length = 189 | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Length = 237 | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Length = 214 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 335 | |||
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 99.89 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 99.89 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 99.87 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 99.85 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 99.84 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 99.84 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 99.82 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 99.81 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 99.8 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.68 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.63 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.62 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.61 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.6 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.59 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.59 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.59 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.58 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.57 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.57 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.57 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.56 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.56 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.55 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.55 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.55 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.55 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.54 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.54 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.53 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.53 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.53 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.52 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.52 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.52 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.52 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.52 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.51 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.51 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.51 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.49 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.48 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.47 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.47 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.47 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.47 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.47 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.46 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.46 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.45 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.44 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.43 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.43 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.41 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.38 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.37 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.35 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 99.32 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 99.31 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.31 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.27 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 99.27 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.26 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.23 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 99.22 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.22 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 99.2 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 99.17 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.09 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 98.98 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 98.84 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 98.84 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 98.78 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 98.78 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 98.74 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 98.64 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 98.53 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 98.07 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 98.02 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 97.64 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 97.53 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 97.19 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 96.61 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 96.43 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 96.1 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 95.9 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 95.52 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 95.52 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 95.52 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 95.37 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 95.32 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 95.23 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 95.14 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 94.28 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 94.09 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 93.96 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 93.55 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 92.45 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 92.18 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 92.16 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 91.97 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 91.82 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 91.59 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 91.08 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 86.26 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 85.14 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 82.12 |
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.89 E-value=9.5e-23 Score=182.39 Aligned_cols=120 Identities=17% Similarity=0.197 Sum_probs=105.5
Q ss_pred CCcEEEEeecCeEEEEEecccCCCCccCccceEEeeeeecCHHHHHHHh--hccCCCcccccceeeeeeEEEEEeCcccE
Q 019858 199 KHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCEEIFELV--MSMDGTRYEWDCSFQYGSLVEEVDGHTAI 276 (335)
Q Consensus 199 ~~W~l~~~~nGlrif~e~~~~~~~~~~~~~~~kavgvV~aspe~IFe~l--m~~d~~R~eWD~~~~~~~vVE~iD~HtdI 276 (335)
..|+++..+||++||....+. ..++++|++|+|++||++||++| ++++ .|.+||..+.++++||++|++++|
T Consensus 43 ~~W~~~~~~~gv~v~~~~~~~-----~~~~~~k~~~~v~~~~~~v~~~l~~~d~~-~r~~Wd~~~~~~~vle~i~~~~~i 116 (231)
T 2r55_A 43 AGWKICREGNGVSVSWRPSVE-----FPGNLYRGEGIVYGTLEEVWDCVKPAVGG-LRVKWDENVTGFEIIQSITDTLCV 116 (231)
T ss_dssp SSCEEEECCSSEEEEEEECSS-----SSSEEEEEEEEESSCHHHHHHHHCC--CC-SHHHHCTTCSEEEEEEECSSSEEE
T ss_pred CCCEEEEeCCCEEEEEEccCC-----CCCcEEEEEEEECCCHHHHHHHHHhhCcc-hhhhhccccceeEEEEEcCCCEEE
Confidence 679999999999999986531 24579999999999999999999 5455 699999999999999999999998
Q ss_pred EEEEEeeCcccCcccCceeEEEEeeEecCCCcEEEEEeeeechhhhhhc
Q 019858 277 LYHRLQLDWFPMFVWPRDLCYVRYWRRNDDGSYGSMRTVVHNQDMYELT 325 (335)
Q Consensus 277 vy~~~~p~wlp~~~~~RDlv~~RyWrR~~DGsYvIl~~Sv~H~~~~~~t 325 (335)
+| .+.+.|+++.+++||||++|+|++.+||+|+|+..||+||+++...
T Consensus 117 ~~-~~~~~~~~~~v~~RDfv~~r~~~~~~~g~~vi~~~Sv~~~~~P~~~ 164 (231)
T 2r55_A 117 SR-TSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKP 164 (231)
T ss_dssp EE-EECCCBTTTTBCCEEEEEEEEEEECTTSCEEEEEEECCCTTSCCCT
T ss_pred EE-EEeccccCCccCCCeEEEEEEEEEcCCCEEEEEEEeccCCCCCCCC
Confidence 55 4666777788999999999999999999999999999999998653
|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 335 | ||||
| d2psoa1 | 197 | d.129.3.2 (A:908-1104) Star-related lipid transfer | 9e-13 | |
| d1ln1a_ | 203 | d.129.3.2 (A:) Phosphatidylcholine transfer protei | 2e-12 | |
| d1em2a_ | 214 | d.129.3.2 (A:) Lipid transport domain of Mln64 {Hu | 5e-12 | |
| d1jssa_ | 199 | d.129.3.2 (A:) Cholesterol-regulated Start protein | 2e-10 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 8e-07 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 1e-06 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 1e-05 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 2e-05 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 2e-05 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 4e-05 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 8e-05 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 1e-04 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 3e-04 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 3e-04 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 6e-04 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 0.001 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 0.001 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 0.001 |
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Length = 197 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: STAR domain domain: Star-related lipid transfer protein 13 species: Human (Homo sapiens) [TaxId: 9606]
Score = 63.9 bits (155), Expect = 9e-13
Identities = 22/111 (19%), Positives = 36/111 (32%), Gaps = 10/111 (9%)
Query: 199 KHWRLLQCQNGLRIFEELLEVDYLPRSCSRAMKAVGVVEASCEEIFELVMSMDGTRYEWD 258
K W + + + + + KA VEA + V+ R+ WD
Sbjct: 19 KGWVTCSSTDNTDLAFK----KVGDGNPLKLWKASVEVEAPPSVVLNRVLR---ERHLWD 71
Query: 259 CSFQYGSLVEEVDGHTAILYHRLQLDWFPMFVWPRDLCYVRYWRRNDDGSY 309
F +VE +D T I + L RD +R W+ +
Sbjct: 72 EDFVQWKVVETLDRQTEIYQYVL---NSMAPHPSRDFVVLRTWKTDLPKGM 119
|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Length = 203 | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Length = 199 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 335 | |||
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 99.77 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 99.71 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 99.7 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 99.67 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.61 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.6 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.57 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 99.54 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.54 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.53 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.53 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.53 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.52 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.51 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.49 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.48 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.48 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.45 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.45 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.44 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.44 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.43 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.43 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.39 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.39 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.38 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.36 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.28 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.28 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.26 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.25 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.2 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.2 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 98.47 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 98.36 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 97.96 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 97.86 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 97.74 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 97.16 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 97.1 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 97.07 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 96.8 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 96.39 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 95.76 | |
| d2d4ra1 | 146 | Hypothetical protein TTHA0849 {Thermus thermophilu | 86.13 |
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: STAR domain domain: Star-related lipid transfer protein 13 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77 E-value=9.1e-19 Score=151.56 Aligned_cols=114 Identities=21% Similarity=0.212 Sum_probs=100.0
Q ss_pred CCcEEEEeecCeEEEEEe-cccCCCCccCccceEEeeeeecCHHHHHHHhhccCCCcccccceeeeeeEEEEEeCcccEE
Q 019858 199 KHWRLLQCQNGLRIFEEL-LEVDYLPRSCSRAMKAVGVVEASCEEIFELVMSMDGTRYEWDCSFQYGSLVEEVDGHTAIL 277 (335)
Q Consensus 199 ~~W~l~~~~nGlrif~e~-~~~~~~~~~~~~~~kavgvV~aspe~IFe~lm~~d~~R~eWD~~~~~~~vVE~iD~HtdIv 277 (335)
..|++...++|++|+... .+ .+...++|+++.|+|+|++|+..+|. .|.+||..+.++++||++|+|++|+
T Consensus 19 ~GW~~~~~~~gi~V~~kk~~~-----gs~~~~~k~~~~i~a~~~~vl~~~l~---~r~~Wd~~~~~~~~le~~~~~~~i~ 90 (197)
T d2psoa1 19 KGWVTCSSTDNTDLAFKKVGD-----GNPLKLWKASVEVEAPPSVVLNRVLR---ERHLWDEDFVQWKVVETLDRQTEIY 90 (197)
T ss_dssp CSCEEECCSSSCEEEEECCCS-----SCCCCEEEEEEEESSCHHHHHHHHHH---CGGGTCTTBCCCEEEEEEETTEEEE
T ss_pred CCceEEecCCCeEEEEEecCC-----CCCeEEEEEEEEEcCCHHHHHHHHHH---hHHHHhhhhheEEEEEEcCCCCEEE
Confidence 469999999999996543 33 23346999999999999999988874 3999999999999999999999999
Q ss_pred EEEEeeCcccCcccCceeEEEEeeEec-CCCcEEEEEeeeechhhhh
Q 019858 278 YHRLQLDWFPMFVWPRDLCYVRYWRRN-DDGSYGSMRTVVHNQDMYE 323 (335)
Q Consensus 278 y~~~~p~wlp~~~~~RDlv~~RyWrR~-~DGsYvIl~~Sv~H~~~~~ 323 (335)
|..++++| .+++||||+.|.|++. +||+++|++.|++|+.++.
T Consensus 91 y~~~~~p~---pvs~RD~v~~~~~~~~~~~~~~~i~~~Sv~~~~~p~ 134 (197)
T d2psoa1 91 QYVLNSMA---PHPSRDFVVLRTWKTDLPKGMCTLVSLSVEHEEAQL 134 (197)
T ss_dssp EEEECCSS---SCCCEEEEEEEEEESCCGGGCEEEEEEECCCTTCCC
T ss_pred EEEccCCC---cccceeEEEEEEEEEeCCCCEEEEEEEeccccCCCC
Confidence 99999655 5899999999999996 7999999999999998764
|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|