Citrus Sinensis ID: 019884
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 334 | ||||||
| 255551573 | 338 | conserved hypothetical protein [Ricinus | 0.994 | 0.982 | 0.764 | 1e-129 | |
| 224107297 | 346 | predicted protein [Populus trichocarpa] | 0.988 | 0.953 | 0.685 | 1e-115 | |
| 449454446 | 346 | PREDICTED: uncharacterized protein LOC10 | 0.988 | 0.953 | 0.645 | 1e-111 | |
| 359477457 | 332 | PREDICTED: uncharacterized protein LOC10 | 0.949 | 0.954 | 0.656 | 1e-109 | |
| 356555589 | 332 | PREDICTED: uncharacterized protein LOC10 | 0.946 | 0.951 | 0.622 | 1e-109 | |
| 357478533 | 344 | hypothetical protein MTR_4g118510 [Medic | 0.973 | 0.944 | 0.633 | 1e-108 | |
| 297804694 | 335 | hypothetical protein ARALYDRAFT_915246 [ | 0.934 | 0.931 | 0.640 | 1e-108 | |
| 18414476 | 337 | uncharacterized protein [Arabidopsis tha | 0.937 | 0.928 | 0.628 | 1e-106 | |
| 357478535 | 338 | hypothetical protein MTR_4g118510 [Medic | 0.955 | 0.943 | 0.621 | 1e-104 | |
| 357478537 | 389 | hypothetical protein MTR_4g118510 [Medic | 0.973 | 0.835 | 0.559 | 1e-102 |
| >gi|255551573|ref|XP_002516832.1| conserved hypothetical protein [Ricinus communis] gi|223543920|gb|EEF45446.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 468 bits (1205), Expect = e-129, Method: Compositional matrix adjust.
Identities = 260/340 (76%), Positives = 291/340 (85%), Gaps = 8/340 (2%)
Query: 1 MLAKEPGAGSTFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLA 60
MLAKE G GSTFDLPEEVLQVLPSDPFEQLDVARKITSIA+STRVS LESE SALR QLA
Sbjct: 1 MLAKESG-GSTFDLPEEVLQVLPSDPFEQLDVARKITSIALSTRVSSLESEFSALRLQLA 59
Query: 61 EKDSRIAELQSQIESIYSSLSD---KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEV 117
EKD IAELQS IES+ +SLSD KL QA A+KE L KEN +L+N V+KLQRDVSKLEV
Sbjct: 60 EKDHLIAELQSHIESLDASLSDSADKLAQADAEKENLLKENASLSNIVKKLQRDVSKLEV 119
Query: 118 FRKTLVQSLKDDEDASTGATRI-AKPTPNEDDAAVAPTGTSSVHSQISEGGNSSFAEERE 176
FRKTL++SL+DDE++S+GA I AKPTP EDDA++ P+ TSS+ SQ SE GNS FAE+RE
Sbjct: 120 FRKTLMKSLQDDEESSSGAIPIIAKPTPTEDDASMLPSRTSSMRSQFSEMGNS-FAEDRE 178
Query: 177 PE-SSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRG 235
+ SSRPG+S G +LASQTSTPR TPPGSPPS SASVSPT+T KPVSPRRHS+SFSTSRG
Sbjct: 179 IDASSRPGMSHGPLLASQTSTPRFTPPGSPPSFSASVSPTRTSKPVSPRRHSMSFSTSRG 238
Query: 236 MFDDR-SSILSSVHSSHSSISSSESGSQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVK 294
M DDR S S S HSSISSSE+GS TG+TRVDGKEFFRQVR+RLSYEQF FLANVK
Sbjct: 239 MPDDRSSLFSSIPSSQHSSISSSETGSHTGRTRVDGKEFFRQVRSRLSYEQFGAFLANVK 298
Query: 295 ELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITRNVH 334
ELN+HKQTKE+TLRK +E+FGP+NKDLY IFEGLITRNVH
Sbjct: 299 ELNSHKQTKEDTLRKAEEIFGPDNKDLYVIFEGLITRNVH 338
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224107297|ref|XP_002314437.1| predicted protein [Populus trichocarpa] gi|222863477|gb|EEF00608.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449454446|ref|XP_004144966.1| PREDICTED: uncharacterized protein LOC101217996 [Cucumis sativus] gi|449515179|ref|XP_004164627.1| PREDICTED: uncharacterized protein LOC101231402 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359477457|ref|XP_002278619.2| PREDICTED: uncharacterized protein LOC100252741 [Vitis vinifera] gi|297736943|emb|CBI26144.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356555589|ref|XP_003546113.1| PREDICTED: uncharacterized protein LOC100776071 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357478533|ref|XP_003609552.1| hypothetical protein MTR_4g118510 [Medicago truncatula] gi|355510607|gb|AES91749.1| hypothetical protein MTR_4g118510 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297804694|ref|XP_002870231.1| hypothetical protein ARALYDRAFT_915246 [Arabidopsis lyrata subsp. lyrata] gi|297316067|gb|EFH46490.1| hypothetical protein ARALYDRAFT_915246 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18414476|ref|NP_567470.1| uncharacterized protein [Arabidopsis thaliana] gi|14517356|gb|AAK62569.1| AT4g15540/dl3810w [Arabidopsis thaliana] gi|15982813|gb|AAL09754.1| AT4g15540/dl3810w [Arabidopsis thaliana] gi|16323276|gb|AAL15372.1| AT4g15540/dl3810w [Arabidopsis thaliana] gi|21592639|gb|AAM64588.1| unknown [Arabidopsis thaliana] gi|22531186|gb|AAM97097.1| expressed protein [Arabidopsis thaliana] gi|23198008|gb|AAN15531.1| expressed protein [Arabidopsis thaliana] gi|332658223|gb|AEE83623.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357478535|ref|XP_003609553.1| hypothetical protein MTR_4g118510 [Medicago truncatula] gi|355510608|gb|AES91750.1| hypothetical protein MTR_4g118510 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357478537|ref|XP_003609554.1| hypothetical protein MTR_4g118510 [Medicago truncatula] gi|355510609|gb|AES91751.1| hypothetical protein MTR_4g118510 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 334 | ||||||
| TAIR|locus:505006472 | 337 | AT4G15545 "AT4G15545" [Arabido | 0.943 | 0.934 | 0.604 | 5.9e-96 | |
| TAIR|locus:2017933 | 325 | AT1G16520 "AT1G16520" [Arabido | 0.934 | 0.96 | 0.425 | 9.9e-55 | |
| TAIR|locus:2205230 | 310 | AT1G56080 "AT1G56080" [Arabido | 0.604 | 0.651 | 0.368 | 2.1e-29 | |
| UNIPROTKB|E7EMV0 | 863 | DIAPH1 "Protein diaphanous hom | 0.574 | 0.222 | 0.248 | 5.8e-05 | |
| MGI|MGI:96687 | 487 | Krt12 "keratin 12" [Mus muscul | 0.455 | 0.312 | 0.254 | 7.3e-05 | |
| MGI|MGI:1914738 | 691 | Calcoco1 "calcium binding and | 0.514 | 0.248 | 0.267 | 0.00012 | |
| DICTYBASE|DDB_G0292068 | 1096 | frpA "fimbrin-related protein" | 0.296 | 0.090 | 0.333 | 0.00013 | |
| UNIPROTKB|E7ERW8 | 1215 | DIAPH1 "Protein diaphanous hom | 0.574 | 0.158 | 0.248 | 0.00014 | |
| RGD|1304805 | 456 | Krt12 "keratin 12" [Rattus nor | 0.452 | 0.331 | 0.253 | 0.00014 | |
| UNIPROTKB|Q6IFW5 | 456 | Krt12 "Keratin, type I cytoske | 0.452 | 0.331 | 0.253 | 0.00014 |
| TAIR|locus:505006472 AT4G15545 "AT4G15545" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 954 (340.9 bits), Expect = 5.9e-96, P = 5.9e-96
Identities = 200/331 (60%), Positives = 242/331 (73%)
Query: 9 GS-TFDLPEEVLQVLPSDPFEQLDVARKITSIAISTRVSDLESEHSALRSQLAEKDSRIA 67
GS +FDLP+E+LQVLPSDPFEQLDVARKITSIA+STRVS LESE S LR LAEK+
Sbjct: 18 GSRSFDLPDELLQVLPSDPFEQLDVARKITSIALSTRVSALESESSDLRELLAEKEKEFE 77
Query: 68 ELQSQIESIYSSLSD---KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQ 124
ELQS +ES+ +SLSD KL A +KE L +EN +L+NTV++LQRDVSKLE FRKTL+
Sbjct: 78 ELQSHVESLEASLSDAFHKLSLADGEKENLIRENASLSNTVKRLQRDVSKLEGFRKTLMM 137
Query: 125 SLKDDEDASTGATRI-AKPTPNEDDAAVAPTGTSSVHSQISEGGNSSFAEEREPESSRPG 183
SL+DD D + G T+I AKPTPN+DD P+ SS+ SQ + A + E ++ +P
Sbjct: 138 SLQDD-DQNAGTTQIIAKPTPNDDDTPFQPSRHSSIQSQQASEAIEPAATDNENDAPKPS 196
Query: 184 ISRGFVLASQTSTPRLTPPGSPPSLSASVSPTKTPKPVSPRRHSISFSTSRGMFDDRXXX 243
+S L SQT+TPRLTPPGSPP LSAS +P T +P+SPRRHS+SF+T+RGMFDD
Sbjct: 197 LSASLPLVSQTTTPRLTPPGSPPILSASGTPKTTSRPISPRRHSVSFATTRGMFDD---- 252
Query: 244 XXXXXXXXXXXXXXXXXXQTGKTRVDGKEFFRQVRNRLSYEQFAIFLANVKELNAHKQTK 303
QT +TRVDGKEFFRQVR+RLSYEQF FL NVK+LNAHKQT+
Sbjct: 253 ------TRSSISISEPGSQTARTRVDGKEFFRQVRSRLSYEQFGAFLGNVKDLNAHKQTR 306
Query: 304 EETLRKTDEVFGPENKDLYTIFEGLITRNVH 334
EETLRK +E+FG +N+DLY IFEGLITRN H
Sbjct: 307 EETLRKAEEIFGGDNRDLYVIFEGLITRNAH 337
|
|
| TAIR|locus:2017933 AT1G16520 "AT1G16520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205230 AT1G56080 "AT1G56080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EMV0 DIAPH1 "Protein diaphanous homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96687 Krt12 "keratin 12" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914738 Calcoco1 "calcium binding and coiled coil domain 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0292068 frpA "fimbrin-related protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ERW8 DIAPH1 "Protein diaphanous homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1304805 Krt12 "keratin 12" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6IFW5 Krt12 "Keratin, type I cytoskeletal 12" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 334 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 1e-04 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 3e-04 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 7e-04 | |
| pfam12329 | 74 | pfam12329, TMF_DNA_bd, TATA element modulatory fac | 0.002 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 43.5 bits (103), Expect = 1e-04
Identities = 24/109 (22%), Positives = 49/109 (44%), Gaps = 4/109 (3%)
Query: 27 FEQLDVARKITSIA-ISTRVSDLESEHSALRSQLAEKDSRIAELQSQIESI---YSSLSD 82
+ R I + + +LE + L +L E + + EL+ ++E + L D
Sbjct: 818 SLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELED 877
Query: 83 KLGQAQADKERLSKENEALTNTVRKLQRDVSKLEVFRKTLVQSLKDDED 131
+L + + +KE L +E L + + +L+ ++ KL + L L+ E
Sbjct: 878 ELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLERLEV 926
|
Length = 1163 |
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|221533 pfam12329, TMF_DNA_bd, TATA element modulatory factor 1 DNA binding | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 334 | |||
| PF02671 | 47 | PAH: Paired amphipathic helix repeat; InterPro: IP | 96.93 | |
| PF06637 | 442 | PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 Th | 96.74 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.08 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 96.0 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 95.92 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.9 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 95.51 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 95.23 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 95.1 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.02 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 94.72 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.46 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 94.34 | |
| PRK09039 | 343 | hypothetical protein; Validated | 94.23 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 93.69 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 93.55 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 93.48 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 93.38 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 93.35 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 92.92 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 92.71 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 92.53 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 92.37 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 92.33 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 92.23 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.19 | |
| COG5602 | 1163 | SIN3 Histone deacetylase complex, SIN3 component [ | 92.15 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 91.88 | |
| KOG3990 | 305 | consensus Uncharacterized conserved protein [Funct | 91.78 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 91.72 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 91.7 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 91.55 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 91.37 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 91.3 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 91.26 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 91.19 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 91.17 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 91.12 | |
| KOG3433 | 203 | consensus Protein involved in meiotic recombinatio | 90.76 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 90.51 | |
| PF10205 | 102 | KLRAQ: Predicted coiled-coil domain-containing pro | 90.46 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 90.43 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 90.34 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 90.25 | |
| PF10224 | 80 | DUF2205: Predicted coiled-coil protein (DUF2205); | 90.2 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 90.03 | |
| KOG4010 | 208 | consensus Coiled-coil protein TPD52 [General funct | 89.86 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 89.82 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 89.75 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 89.52 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 89.5 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 89.23 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 89.2 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 89.13 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 89.03 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 89.0 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 88.69 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 88.61 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 88.57 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 88.31 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 88.12 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 88.05 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 88.04 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 88.03 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 87.72 | |
| PF11068 | 131 | YlqD: YlqD protein; InterPro: IPR021297 This bacte | 87.6 | |
| KOG4398 | 359 | consensus Predicted coiled-coil protein [General f | 87.48 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 87.36 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 87.36 | |
| PRK09039 | 343 | hypothetical protein; Validated | 87.3 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 87.24 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 87.1 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 87.1 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 86.91 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 86.73 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 86.72 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 86.62 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 86.59 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 86.44 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 86.37 | |
| KOG4204 | 231 | consensus Histone deacetylase complex, SIN3 compon | 86.35 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 86.32 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 86.29 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 86.21 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 86.17 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 86.1 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 86.09 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 86.05 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 85.99 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 85.9 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 85.81 | |
| PF04201 | 162 | TPD52: Tumour protein D52 family; InterPro: IPR007 | 85.6 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 85.58 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 85.54 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 85.47 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 85.34 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 85.31 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 85.31 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 85.2 | |
| PF04899 | 70 | MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th | 85.19 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 84.74 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 84.51 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 84.38 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 84.22 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 83.97 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 83.89 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 83.83 | |
| COG1322 | 448 | Predicted nuclease of restriction endonuclease-lik | 83.7 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 83.64 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 83.44 | |
| PF05377 | 55 | FlaC_arch: Flagella accessory protein C (FlaC); In | 83.41 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 83.24 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 83.2 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 83.19 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 82.99 | |
| PF11594 | 106 | Med28: Mediator complex subunit 28; InterPro: IPR0 | 82.92 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 82.75 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 82.73 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 82.63 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 82.37 | |
| TIGR02559 | 158 | HrpB7 type III secretion protein HrpB7. This famil | 82.33 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 82.33 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 82.26 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 82.23 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 82.22 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 82.09 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 82.08 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 81.86 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 81.8 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 81.78 | |
| PF09798 | 654 | LCD1: DNA damage checkpoint protein; InterPro: IPR | 80.93 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 80.91 | |
| PF09486 | 158 | HrpB7: Bacterial type III secretion protein (HrpB7 | 80.87 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 80.8 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 80.62 | |
| PF11544 | 76 | Spc42p: Spindle pole body component Spc42p; InterP | 80.42 | |
| PF10158 | 131 | LOH1CR12: Tumour suppressor protein; InterPro: IPR | 80.3 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 80.2 |
| >PF02671 PAH: Paired amphipathic helix repeat; InterPro: IPR003822 This family contains the paired amphipathic helix (PAH) repeat | Back alignment and domain information |
|---|
Probab=96.93 E-value=0.0025 Score=45.41 Aligned_cols=46 Identities=17% Similarity=0.363 Sum_probs=41.7
Q ss_pred HHHHHHHHHHHHHHhhccccHHHHHHhhhhhcCCCChhHHHHHHHhh
Q 019884 283 YEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLI 329 (334)
Q Consensus 283 YEQFsaFLANIKELNAhkQTREETL~KA~eIFG~~NkdLY~~FegLL 329 (334)
.|.|.+||..++.++.++.+++|...++.++|+. |+||...|...|
T Consensus 1 p~~Y~~FL~il~~y~~~~~~~~~v~~~v~~Ll~~-hpdLl~~F~~Fl 46 (47)
T PF02671_consen 1 PEVYNEFLKILNDYKKGRISRSEVIEEVSELLRG-HPDLLEEFNRFL 46 (47)
T ss_dssp HHHHHHHHHHHHHHHCTCSCHHHHHHHHHHHTTT--HHHHHHHHHHS
T ss_pred ChHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHcc-CHHHHHHHHhhC
Confidence 3789999999999999999999999999999996 899999998764
|
The family contains the eukaryotic Sin3 proteins, which have at least three PAH domains (PAH1, PAH2, and PAH3). Sin3 proteins are components of a co-repressor complex that silences transcription, playing important roles in the transition between proliferation and differentiation. Sin3 proteins are recruited to the DNA by various DNA-binding transcription factors such as the Mad family of repressors, Mnt/Rox, PLZF, MeCP2, p53, REST/NRSF, MNFbeta, Sp1, TGIF and Ume6 []. Sin3 acts as a scaffold protein that in turn recruits histone-binding proteins RbAp46/RbAp48 and histone deacetylases HDAC1/HDAC2, which deacetylate the core histones resulting in a repressed state of the chromatin []. The PAH domains are protein-protein interaction domains through which Sin3 fulfils its role as a scaffold. The PAH2 domain of Sin3 can interact with a wide range of unrelated and structurally diverse transcription factors that bind using different interaction motifs. For example, the Sin3 PAH2 domain can interact with the unrelated Mad and HBP1 factors using alternative interaction motifs that involve binding in opposite helical orientations [].; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1S5Q_B 2L9S_B 1G1E_B 1S5R_B 2CR7_A 2CZY_A 2LD7_B 2RMR_A 2RMS_A 1PD7_A .... |
| >PF06637 PV-1: PV-1 protein (PLVAP); InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG5602 SIN3 Histone deacetylase complex, SIN3 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3990 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG4010 consensus Coiled-coil protein TPD52 [General function prediction only] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF11068 YlqD: YlqD protein; InterPro: IPR021297 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG4398 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG4204 consensus Histone deacetylase complex, SIN3 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF04201 TPD52: Tumour protein D52 family; InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1322 Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF11594 Med28: Mediator complex subunit 28; InterPro: IPR021640 Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species [],[] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR02559 HrpB7 type III secretion protein HrpB7 | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF09798 LCD1: DNA damage checkpoint protein; InterPro: IPR018622 This is a family of proteins which regulate checkpoint kinases | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11544 Spc42p: Spindle pole body component Spc42p; InterPro: IPR021611 Spc42p is a 42kDa component of the S | Back alignment and domain information |
|---|
| >PF10158 LOH1CR12: Tumour suppressor protein; InterPro: IPR018780 This entry represents a region of 130 amino acids that is the most conserved part of some hypothetical proteins involved in loss of heterozygosity, and thus, tumour suppression [] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 334 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 61.8 bits (149), Expect = 1e-10
Identities = 52/406 (12%), Positives = 113/406 (27%), Gaps = 107/406 (26%)
Query: 12 FDLPE------EVLQVLPSDPF-EQLDV--ARKITSIAISTRVSD--LESEHSALRSQ-- 58
F+ E ++L V D F + D + + +S D + S+ + +
Sbjct: 9 FETGEHQYQYKDILSVF-EDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRL 67
Query: 59 ---LAEKDSRIAE------LQSQIESIYSSLSDKLGQAQADKERLSKENEALTNTVRKLQ 109
L K + + L+ + + S + + Q ++ + L N +
Sbjct: 68 FWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVF- 126
Query: 110 RDVSKLEVFRKTLVQSLKDDEDASTGATRIAKPTPNEDDAAV---APTGTSSV------- 159
+K V R L+ A +P N + +G + V
Sbjct: 127 ---AKYNVSRLQPYLKLRQ-------ALLELRPAKN---VLIDGVLGSGKTWVALDVCLS 173
Query: 160 HSQISEGGNS----SFAEEREPESSRPGISRGFVLASQTSTPRLTPPGSPPSLSASVSP- 214
+ + + PE+ + + T R + S+
Sbjct: 174 YKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAE 233
Query: 215 -----TKTPKP--------VSPRRHSISFS-------TSRGMFDDRS--SILSSVHSSHS 252
P V + +F+ T+R + LS+ ++H
Sbjct: 234 LRRLLKSKPYENCLLVLLNVQNAKAWNAFNLSCKILLTTR----FKQVTDFLSAATTTHI 289
Query: 253 SISSSESGSQTGKTRVDGKEFFRQVRN----RLSYE-------QFAIFLANVKELNAH-- 299
S+ T + K + + L E + +I ++++ A
Sbjct: 290 SLDHHSMTL----TPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAESIRDGLATWD 345
Query: 300 --KQTKEETLRKTDEVF-----GPENKDLY---TIF-EGL-ITRNV 333
K + L E E + ++ ++F I +
Sbjct: 346 NWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTIL 391
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 334 | |||
| 2ld7_B | 75 | Paired amphipathic helix protein SIN3A; transcript | 97.92 | |
| 2cr7_A | 80 | Paired amphipathic helix protein SIN3B; paired amp | 97.36 | |
| 2czy_A | 77 | Paired amphipathic helix protein SIN3B; SIN3, PAH1 | 96.98 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 96.7 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 96.25 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.62 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 95.53 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 95.44 | |
| 1e91_A | 85 | Paired amphipathic helix protein SIN3B; eukaryotic | 95.22 | |
| 1g1e_B | 89 | SIN3A; four-helix bundle, protein-peptide complex, | 95.09 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 94.66 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 94.62 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.54 | |
| 2f05_A | 105 | Paired amphipathic helix protein SIN3B; helix bund | 93.93 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 93.41 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 93.03 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 92.38 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 92.36 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.31 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 92.03 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 91.99 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 91.96 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 91.86 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 91.33 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 91.26 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 91.25 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 91.16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 90.81 | |
| 2akf_A | 32 | Coronin-1A; coiled coil, protein binding; 1.20A {S | 90.52 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 90.14 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 90.11 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 90.05 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 89.03 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 88.39 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 88.36 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 88.34 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 88.33 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 88.32 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 88.24 | |
| 2q6q_A | 74 | Spindle POLE BODY component SPC42; SPC42P, budding | 87.61 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 87.52 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 87.49 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 87.17 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 87.14 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 86.86 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 86.67 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 86.64 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 86.11 | |
| 4fm3_A | 98 | Uncharacterized hypothetical protein; PF14346 fami | 86.08 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 86.07 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 85.66 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 85.16 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 84.34 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 83.5 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 83.47 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 83.39 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 82.93 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 82.36 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 81.54 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 81.22 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 80.75 | |
| 4dci_A | 150 | Uncharacterized protein; PSI-biology, midwest cent | 80.63 | |
| 1x4t_A | 92 | Hypothetical protein LOC57905; structural genomics | 80.08 |
| >2ld7_B Paired amphipathic helix protein SIN3A; transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=97.92 E-value=3e-05 Score=60.39 Aligned_cols=65 Identities=22% Similarity=0.343 Sum_probs=61.3
Q ss_pred CccchHHHHHHHHhcC-CHHHHHHHHHHHHHHhhccccHHHHHHhhhhhcCCCChhHHHHHHHhhcc
Q 019884 266 TRVDGKEFFRQVRNRL-SYEQFAIFLANVKELNAHKQTKEETLRKTDEVFGPENKDLYTIFEGLITR 331 (334)
Q Consensus 266 ~rVDGKEFFRQARsRL-SYEQFsaFLANIKELNAhkQTREETL~KA~eIFG~~NkdLY~~FegLL~R 331 (334)
...|.-.||.+||.|| +-+-|..||--++-+|.+.-+|.|.+..+..+|| .|+||+..|..+|..
T Consensus 7 ~~~de~~Ff~kVK~~l~~~~~Y~eFLk~lnlf~q~~Id~~eLv~~V~~~lg-~~pdL~~~Fk~Fl~~ 72 (75)
T 2ld7_B 7 GVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLG-KFPELFNWFKNFLGY 72 (75)
T ss_dssp TSSHHHHHHHHHHHHHCSHHHHHHHHHHHHHHHTTCSCHHHHHHHTHHHHT-TCHHHHHHHHHHHTC
T ss_pred ccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhhhcCcCHHHHHHHHHHHHc-cCHHHHHHHHHHcCC
Confidence 6679999999999999 8899999999999999999999999999999999 599999999999864
|
| >2cr7_A Paired amphipathic helix protein SIN3B; paired amphipathic helix repeat, transcriptional repressor, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rmr_A 2rms_A | Back alignment and structure |
|---|
| >2czy_A Paired amphipathic helix protein SIN3B; SIN3, PAH1, transcriptional repressor, gene regulation; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e91_A Paired amphipathic helix protein SIN3B; eukaryotic transcriptional regulation, SIN3, PAH domains, protein-protein interactions; NMR {Mus musculus} SCOP: a.59.1.1 PDB: 1pd7_A | Back alignment and structure |
|---|
| >1g1e_B SIN3A; four-helix bundle, protein-peptide complex, transcription; NMR {Mus musculus} SCOP: a.59.1.1 PDB: 1s5q_B 1s5r_B 2l9s_B | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2f05_A Paired amphipathic helix protein SIN3B; helix bundle, transcription repressor; NMR {Mus musculus} SCOP: a.59.1.1 | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2akf_A Coronin-1A; coiled coil, protein binding; 1.20A {Synthetic} | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >4fm3_A Uncharacterized hypothetical protein; PF14346 family protein, DUF4398, structural genomics, joint for structural genomics, JCSG; HET: PG4; 2.47A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4dci_A Uncharacterized protein; PSI-biology, midwest center for structural genomics, MCSG, S genomics, unknown function; 2.82A {Synechococcus SP} | Back alignment and structure |
|---|
| >1x4t_A Hypothetical protein LOC57905; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.2.15.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 334 | |||
| d2f05a1 | 85 | Sin3B {Mouse (Mus musculus) [TaxId: 10090]} | 96.87 | |
| d1s5qb_ | 89 | Sin3A {Mouse (Mus musculus) [TaxId: 10090]} | 96.19 | |
| d1yf2a2 | 205 | Bipartite methylase S protein MJ0130 {Methanocaldo | 89.53 | |
| d1ydxa2 | 181 | Bipartite methylase S protein MG438 {Mycoplasma ge | 84.86 | |
| d1ydxa1 | 193 | Bipartite methylase S protein MG438 {Mycoplasma ge | 80.43 |
| >d2f05a1 a.59.1.1 (A:1-85) Sin3B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: PAH2 domain superfamily: PAH2 domain family: PAH2 domain domain: Sin3B species: Mouse (Mus musculus) [TaxId: 10090]
Probab=96.87 E-value=0.0012 Score=49.86 Aligned_cols=60 Identities=17% Similarity=0.405 Sum_probs=53.5
Q ss_pred chHHHHHHHHhcC--CHHHHHHHHHHHHHHhhcc----------ccHHHHHHhhhhhcCCCChhHHHHHHHhh
Q 019884 269 DGKEFFRQVRNRL--SYEQFAIFLANVKELNAHK----------QTKEETLRKTDEVFGPENKDLYTIFEGLI 329 (334)
Q Consensus 269 DGKEFFRQARsRL--SYEQFsaFLANIKELNAhk----------QTREETL~KA~eIFG~~NkdLY~~FegLL 329 (334)
|...|++.+|.|+ -.|.|..||.-.+.+.+++ .+..|.+..+.+|||. |+||...|...|
T Consensus 9 dA~~yl~kVK~rf~~~p~~Y~~FL~il~~f~~~~i~~~~~~~~~~~~~ev~~~V~~Lf~~-hpdLl~~F~~FL 80 (85)
T d2f05a1 9 NAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRG-QEDLLSEFGQFL 80 (85)
T ss_dssp HHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHSSSSSSSSCCCCHHHHHHHHHHHTTT-CHHHHHHHHHHS
T ss_pred HHHHHHHHHHHHHccCHHHHHHHHHHHHHHHHhhccccccccccCCHHHHHHHHHHHHcc-CHHHHHHHHHHC
Confidence 5778999999999 4789999999999998875 4889999999999975 799999999876
|
| >d1s5qb_ a.59.1.1 (B:) Sin3A {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yf2a2 d.287.1.2 (A:221-425) Bipartite methylase S protein MJ0130 {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ydxa2 d.287.1.2 (A:194-374) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1ydxa1 d.287.1.2 (A:1-193) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|