Citrus Sinensis ID: 019928
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 334 | 2.2.26 [Sep-21-2011] | |||||||
| Q2T9S4 | 321 | Phosphoglycolate phosphat | yes | no | 0.745 | 0.775 | 0.401 | 8e-49 | |
| Q8CHP8 | 321 | Phosphoglycolate phosphat | yes | no | 0.742 | 0.772 | 0.4 | 3e-46 | |
| A6NDG6 | 321 | Phosphoglycolate phosphat | yes | no | 0.763 | 0.794 | 0.395 | 3e-46 | |
| Q00472 | 298 | 4-nitrophenylphosphatase | yes | no | 0.757 | 0.848 | 0.387 | 2e-45 | |
| P19881 | 312 | 4-nitrophenylphosphatase | yes | no | 0.703 | 0.753 | 0.409 | 7e-45 | |
| Q8VD52 | 309 | Pyridoxal phosphate phosp | no | no | 0.715 | 0.773 | 0.370 | 5e-44 | |
| Q96GD0 | 296 | Pyridoxal phosphate phosp | no | no | 0.727 | 0.820 | 0.359 | 3e-42 | |
| Q3ZBF9 | 296 | Pyridoxal phosphate phosp | no | no | 0.724 | 0.817 | 0.353 | 1e-41 | |
| P60487 | 292 | Pyridoxal phosphate phosp | no | no | 0.715 | 0.818 | 0.351 | 1e-41 | |
| Q5F4B1 | 312 | Phosphoglycolate phosphat | no | no | 0.769 | 0.823 | 0.365 | 2e-39 |
| >sp|Q2T9S4|PGP_BOVIN Phosphoglycolate phosphatase OS=Bos taurus GN=PGP PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 194 bits (493), Expect = 8e-49, Method: Compositional matrix adjust.
Identities = 110/274 (40%), Positives = 158/274 (57%), Gaps = 25/274 (9%)
Query: 74 KNADELIDSVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYG 133
+ A L+ V+T +FDCDGV+W+G+ + G PETL LR++GKRL F+TNNS+K+R+ Y
Sbjct: 19 ERAQALLADVDTLLFDCDGVLWRGETAVPGAPETLTALRARGKRLAFITNNSSKTREAYA 78
Query: 134 KKFETLGLTVTE-----EEIFASSFAAAAYLKS-IDFPKDKKVYVVGEDGILKELELAGF 187
+K LG E+F +++ A YL+ + P K YV+G + ELE G
Sbjct: 79 EKLRCLGFGAPAGPDAGREVFGTAYCTALYLRQRLTGPPAPKAYVLGSVALAAELEAVGV 138
Query: 188 QYLG-GPE----DGGKKIELKPGFLMEH--DKDVGAVVVGFDRYFNYYKVQYGTLCIR-- 238
+G GPE DG PG ++ + DV AVVVGFD +F+Y K+ T +R
Sbjct: 139 SCVGVGPEPLLGDG-------PGAWLDAPLEPDVRAVVVGFDPHFSYMKL---TKAVRYL 188
Query: 239 ENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKF 298
+ P CL + TN D L + + AG G +V A + QR+ ++GKPS F+ D ++ ++
Sbjct: 189 QQPDCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEY 248
Query: 299 GIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSG 332
GI + MVGDRLDTDIL G G KT+L L+G
Sbjct: 249 GIHPERTVMVGDRLDTDILLGVTCGLKTILTLTG 282
|
Bos taurus (taxid: 9913) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 8 |
| >sp|Q8CHP8|PGP_MOUSE Phosphoglycolate phosphatase OS=Mus musculus GN=Pgp PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A6NDG6|PGP_HUMAN Phosphoglycolate phosphatase OS=Homo sapiens GN=PGP PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q00472|PNPP_SCHPO 4-nitrophenylphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pho2 PE=4 SV=2 | Back alignment and function description |
|---|
| >sp|P19881|PNPP_YEAST 4-nitrophenylphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO13 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8VD52|PLPP_RAT Pyridoxal phosphate phosphatase OS=Rattus norvegicus GN=Pdxp PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q96GD0|PLPP_HUMAN Pyridoxal phosphate phosphatase OS=Homo sapiens GN=PDXP PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q3ZBF9|PLPP_BOVIN Pyridoxal phosphate phosphatase OS=Bos taurus GN=PDXP PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P60487|PLPP_MOUSE Pyridoxal phosphate phosphatase OS=Mus musculus GN=Pdxp PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5F4B1|PGP_CHICK Phosphoglycolate phosphatase OS=Gallus gallus GN=PGP PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 334 | ||||||
| 118486367 | 371 | unknown [Populus trichocarpa] gi|1184876 | 0.928 | 0.835 | 0.878 | 1e-152 | |
| 255547472 | 360 | 4-nitrophenylphosphatase, putative [Rici | 0.916 | 0.85 | 0.861 | 1e-149 | |
| 224109186 | 308 | predicted protein [Populus trichocarpa] | 0.820 | 0.889 | 0.970 | 1e-149 | |
| 357507859 | 367 | Phosphoglycolate phosphatase [Medicago t | 0.832 | 0.757 | 0.906 | 1e-148 | |
| 217072758 | 367 | unknown [Medicago truncatula] | 0.832 | 0.757 | 0.906 | 1e-148 | |
| 449442663 | 376 | PREDICTED: phosphoglycolate phosphatase- | 0.937 | 0.832 | 0.848 | 1e-147 | |
| 356531866 | 369 | PREDICTED: phosphoglycolate phosphatase- | 0.910 | 0.823 | 0.855 | 1e-146 | |
| 356568529 | 368 | PREDICTED: phosphoglycolate phosphatase- | 0.970 | 0.880 | 0.785 | 1e-145 | |
| 255634458 | 369 | unknown [Glycine max] | 0.910 | 0.823 | 0.849 | 1e-144 | |
| 357507861 | 385 | Phosphoglycolate phosphatase [Medicago t | 0.832 | 0.722 | 0.851 | 1e-144 |
| >gi|118486367|gb|ABK95024.1| unknown [Populus trichocarpa] gi|118487622|gb|ABK95636.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 543 bits (1398), Expect = e-152, Method: Compositional matrix adjust.
Identities = 281/320 (87%), Positives = 294/320 (91%), Gaps = 10/320 (3%)
Query: 14 LNPKTTSKFFGLKRVSFVSSDSLVFGGKNSSFNADGLKKSRSC-SRMESFVTKASASAQP 72
+NP T KF GLK S ++ +++N + L SR C +RME+F TKASA+AQP
Sbjct: 27 VNP-TIPKFLGLKGPSHNFTNC-------TTWNKN-LNLSRKCNTRMENFTTKASAAAQP 77
Query: 73 LKNADELIDSVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQY 132
LKNADELIDSVETFIFDCDGVIWKGDKLIDGVP+TLDMLRS+GKRLVFVTNNSTKSRKQY
Sbjct: 78 LKNADELIDSVETFIFDCDGVIWKGDKLIDGVPQTLDMLRSRGKRLVFVTNNSTKSRKQY 137
Query: 133 GKKFETLGLTVTEEEIFASSFAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGG 192
GKKFETLGL V+EEEIFASSFAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGG
Sbjct: 138 GKKFETLGLDVSEEEIFASSFAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGG 197
Query: 193 PEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDA 252
PEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDA
Sbjct: 198 PEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDA 257
Query: 253 VTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRL 312
VTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGI KSQICMVGDRL
Sbjct: 258 VTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGILKSQICMVGDRL 317
Query: 313 DTDILFGQNGGCKTLLVLSG 332
DTDILFGQNGGCKTLLVLSG
Sbjct: 318 DTDILFGQNGGCKTLLVLSG 337
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255547472|ref|XP_002514793.1| 4-nitrophenylphosphatase, putative [Ricinus communis] gi|223545844|gb|EEF47347.1| 4-nitrophenylphosphatase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224109186|ref|XP_002315115.1| predicted protein [Populus trichocarpa] gi|222864155|gb|EEF01286.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357507859|ref|XP_003624218.1| Phosphoglycolate phosphatase [Medicago truncatula] gi|355499233|gb|AES80436.1| Phosphoglycolate phosphatase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217072758|gb|ACJ84739.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449442663|ref|XP_004139100.1| PREDICTED: phosphoglycolate phosphatase-like [Cucumis sativus] gi|449485338|ref|XP_004157138.1| PREDICTED: phosphoglycolate phosphatase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356531866|ref|XP_003534497.1| PREDICTED: phosphoglycolate phosphatase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356568529|ref|XP_003552463.1| PREDICTED: phosphoglycolate phosphatase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255634458|gb|ACU17594.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357507861|ref|XP_003624219.1| Phosphoglycolate phosphatase [Medicago truncatula] gi|355499234|gb|AES80437.1| Phosphoglycolate phosphatase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 334 | ||||||
| TAIR|locus:2147371 | 362 | PGLP1 "2-phosphoglycolate phos | 0.976 | 0.900 | 0.760 | 1.3e-130 | |
| TAIR|locus:2149099 | 362 | AT5G36790 [Arabidopsis thalian | 0.976 | 0.900 | 0.760 | 1.3e-130 | |
| TAIR|locus:2160937 | 301 | PGLP2 "2-phosphoglycolate phos | 0.772 | 0.857 | 0.683 | 1.4e-96 | |
| GENEDB_PFALCIPARUM|PF07_0059 | 322 | PF07_0059 "4-nitrophenylphosph | 0.814 | 0.844 | 0.417 | 3e-53 | |
| UNIPROTKB|Q8IBV0 | 322 | PF07_0059 "4-nitrophenylphosph | 0.814 | 0.844 | 0.417 | 3e-53 | |
| DICTYBASE|DDB_G0284737 | 303 | DDB_G0284737 "putative phospho | 0.754 | 0.831 | 0.417 | 2.2e-50 | |
| ZFIN|ZDB-GENE-030131-6240 | 306 | pgp "phosphoglycolate phosphat | 0.742 | 0.810 | 0.416 | 4.2e-47 | |
| ASPGD|ASPL0000040358 | 308 | AN2970 [Emericella nidulans (t | 0.754 | 0.818 | 0.407 | 3.4e-45 | |
| SGD|S000002395 | 312 | PHO13 "Alkaline phosphatase sp | 0.757 | 0.810 | 0.407 | 1.2e-44 | |
| ZFIN|ZDB-GENE-080723-69 | 308 | zgc:194409 "zgc:194409" [Danio | 0.748 | 0.811 | 0.386 | 5e-44 |
| TAIR|locus:2147371 PGLP1 "2-phosphoglycolate phosphatase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1281 (456.0 bits), Expect = 1.3e-130, P = 1.3e-130
Identities = 254/334 (76%), Positives = 282/334 (84%)
Query: 1 MLSKAVASAVSVTLNPKTTSKFFGLKRVSFVSSDSLVFGGKNSSFNADGLKK-SRSCSRM 59
MLS++VASAV+ P ++S + F + G ++SSF ++K + RM
Sbjct: 1 MLSRSVASAVT----PVSSSSLLPNSKPIFCLKT--LSGYRSSSFCGGCIRKINHKPLRM 54
Query: 60 ESF-VTKASASAQPLKNADELIDSVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRL 118
S +T + + Q L+NAD+LIDSVETFIFDCDGVIWKGDKLI+GVPETLDMLR+KGKRL
Sbjct: 55 TSSNITPRAMATQQLENADQLIDSVETFIFDCDGVIWKGDKLIEGVPETLDMLRAKGKRL 114
Query: 119 VFVTNNSTKSRKQYGKKFETLGLTVTEEEIXXXXXXXXXYLKSIDFPKDKKVYVVGEDGI 178
VFVTNNSTKSRKQYGKKFETLGL V EEEI YL+SI+FPKDKKVYV+GE+GI
Sbjct: 115 VFVTNNSTKSRKQYGKKFETLGLNVNEEEIFASSFAAAAYLQSINFPKDKKVYVIGEEGI 174
Query: 179 LKELELAGFQYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIR 238
LKELELAGFQYLGGP+DG ++IELKPGFLMEHD DVGAVVVGFDRYFNYYK+QYGTLCIR
Sbjct: 175 LKELELAGFQYLGGPDDGKRQIELKPGFLMEHDHDVGAVVVGFDRYFNYYKIQYGTLCIR 234
Query: 239 ENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKF 298
ENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGA VGSTQREPLVVGKPSTFMMDYLA+KF
Sbjct: 235 ENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGALVGSTQREPLVVGKPSTFMMDYLADKF 294
Query: 299 GIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSG 332
GIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSG
Sbjct: 295 GIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSG 328
|
|
| TAIR|locus:2149099 AT5G36790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2160937 PGLP2 "2-phosphoglycolate phosphatase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF07_0059 PF07_0059 "4-nitrophenylphosphatase, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IBV0 PF07_0059 "4-nitrophenylphosphatase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0284737 DDB_G0284737 "putative phosphoric monoester hydrolase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-6240 pgp "phosphoglycolate phosphatase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000040358 AN2970 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| SGD|S000002395 PHO13 "Alkaline phosphatase specific for p-nitrophenyl phosphate" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080723-69 zgc:194409 "zgc:194409" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3 | 0.766 |
| 3rd Layer | 3.1.3.41 | 0.824 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 334 | |||
| PLN02645 | 311 | PLN02645, PLN02645, phosphoglycolate phosphatase | 0.0 | |
| TIGR01452 | 279 | TIGR01452, PGP_euk, phosphoglycolate/pyridoxal pho | 1e-120 | |
| COG0647 | 269 | COG0647, NagD, Predicted sugar phosphatases of the | 3e-72 | |
| TIGR01460 | 236 | TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Super | 1e-68 | |
| pfam13344 | 101 | pfam13344, Hydrolase_6, Haloacid dehalogenase-like | 4e-43 | |
| TIGR01457 | 249 | TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfam | 1e-40 | |
| PRK10444 | 248 | PRK10444, PRK10444, UMP phosphatase; Provisional | 1e-27 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 1e-16 | |
| pfam13242 | 74 | pfam13242, Hydrolase_like, HAD-hyrolase-like | 7e-16 | |
| TIGR01458 | 257 | TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfam | 3e-15 | |
| cd01427 | 139 | cd01427, HAD_like, Haloacid dehalogenase-like hydr | 1e-10 | |
| pfam00702 | 187 | pfam00702, Hydrolase, haloacid dehalogenase-like h | 8e-10 | |
| COG0546 | 220 | COG0546, Gph, Predicted phosphatases [General func | 9e-07 | |
| COG0241 | 181 | COG0241, HisB, Histidinol phosphatase and related | 1e-06 | |
| TIGR01459 | 242 | TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class | 4e-06 | |
| TIGR01662 | 132 | TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, | 2e-05 | |
| COG1011 | 229 | COG1011, COG1011, Predicted hydrolase (HAD superfa | 2e-05 | |
| PRK08942 | 181 | PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate p | 3e-05 | |
| COG2179 | 175 | COG2179, COG2179, Predicted hydrolase of the HAD s | 7e-05 | |
| TIGR01668 | 170 | TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfam | 1e-04 | |
| PRK13222 | 226 | PRK13222, PRK13222, phosphoglycolate phosphatase; | 3e-04 | |
| TIGR02253 | 221 | TIGR02253, CTE7, HAD superfamily (subfamily IA) hy | 5e-04 | |
| PRK06769 | 173 | PRK06769, PRK06769, hypothetical protein; Validate | 0.002 | |
| pfam09419 | 166 | pfam09419, PGP_phosphatase, Mitochondrial PGP phos | 0.002 |
| >gnl|CDD|178251 PLN02645, PLN02645, phosphoglycolate phosphatase | Back alignment and domain information |
|---|
Score = 575 bits (1484), Expect = 0.0
Identities = 241/268 (89%), Positives = 254/268 (94%)
Query: 65 KASASAQPLKNADELIDSVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRLVFVTNN 124
A+A L+NADELIDSVETFIFDCDGVIWKGDKLI+GVPETLDMLRS GK+LVFVTNN
Sbjct: 10 AAAAQLLTLENADELIDSVETFIFDCDGVIWKGDKLIEGVPETLDMLRSMGKKLVFVTNN 69
Query: 125 STKSRKQYGKKFETLGLTVTEEEIFASSFAAAAYLKSIDFPKDKKVYVVGEDGILKELEL 184
STKSR QYGKKFE+LGL VTEEEIF+SSFAAAAYLKSI+FPKDKKVYV+GE+GIL+ELEL
Sbjct: 70 STKSRAQYGKKFESLGLNVTEEEIFSSSFAAAAYLKSINFPKDKKVYVIGEEGILEELEL 129
Query: 185 AGFQYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCL 244
AGFQYLGGPEDG KKIELKPGFLMEHDKDVGAVVVGFDRY NYYK+QY TLCIRENPGCL
Sbjct: 130 AGFQYLGGPEDGDKKIELKPGFLMEHDKDVGAVVVGFDRYINYYKIQYATLCIRENPGCL 189
Query: 245 FIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQ 304
FIATNRDAVTHLTDAQEWAG GSMVGA GST+REPLVVGKPSTFMMDYLANKFGI+KSQ
Sbjct: 190 FIATNRDAVTHLTDAQEWAGAGSMVGAIKGSTEREPLVVGKPSTFMMDYLANKFGIEKSQ 249
Query: 305 ICMVGDRLDTDILFGQNGGCKTLLVLSG 332
ICMVGDRLDTDILFGQNGGCKTLLVLSG
Sbjct: 250 ICMVGDRLDTDILFGQNGGCKTLLVLSG 277
|
Length = 311 |
| >gnl|CDD|233420 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233422 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >gnl|CDD|205524 pfam13344, Hydrolase_6, Haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|130524 TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >gnl|CDD|182466 PRK10444, PRK10444, UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like | Back alignment and domain information |
|---|
| >gnl|CDD|162372 TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223319 COG0241, HisB, Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130526 TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >gnl|CDD|233517 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236354 PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225090 COG2179, COG2179, Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233519 TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >gnl|CDD|237310 PRK13222, PRK13222, phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >gnl|CDD|180686 PRK06769, PRK06769, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220230 pfam09419, PGP_phosphatase, Mitochondrial PGP phosphatase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 334 | |||
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 100.0 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 100.0 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 100.0 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 100.0 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 100.0 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 100.0 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 100.0 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 100.0 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 100.0 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 100.0 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 99.97 | |
| KOG1618 | 389 | consensus Predicted phosphatase [General function | 99.87 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 99.82 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 99.78 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 99.74 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 99.74 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 99.74 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 99.73 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 99.73 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 99.72 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 99.72 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 99.71 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 99.71 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 99.71 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 99.71 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 99.7 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 99.7 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 99.69 | |
| PLN02940 | 382 | riboflavin kinase | 99.69 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 99.69 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 99.69 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 99.69 | |
| PRK06769 | 173 | hypothetical protein; Validated | 99.68 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 99.68 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 99.68 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 99.68 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 99.68 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 99.67 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 99.67 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 99.67 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 99.66 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 99.65 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 99.65 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 99.65 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 99.64 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 99.63 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 99.63 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 99.62 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 99.62 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 99.62 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 99.62 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 99.61 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 99.61 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 99.61 | |
| KOG3085 | 237 | consensus Predicted hydrolase (HAD superfamily) [G | 99.61 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 99.61 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 99.6 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 99.59 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 99.59 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 99.59 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 99.58 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 99.54 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 99.54 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 99.53 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 99.52 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 99.51 | |
| PLN02811 | 220 | hydrolase | 99.5 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 99.49 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 99.49 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.47 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 99.47 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 99.47 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.45 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 99.44 | |
| PF13242 | 75 | Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY | 99.44 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 99.43 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 99.42 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 99.42 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 99.42 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 99.41 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 99.41 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 99.41 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 99.41 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.39 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.38 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 99.37 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 99.36 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 99.35 | |
| PLN02887 | 580 | hydrolase family protein | 99.35 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 99.34 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 99.34 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 99.33 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 99.33 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 99.3 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 99.27 | |
| PLN02954 | 224 | phosphoserine phosphatase | 99.27 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 99.26 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 99.26 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 99.23 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 99.22 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 99.2 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.19 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 99.19 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.17 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 99.14 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 99.09 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 99.08 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 99.07 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 99.06 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 99.02 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.01 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 98.99 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 98.97 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 98.95 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 98.92 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 98.85 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 98.84 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 98.84 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 98.8 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 98.66 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 98.65 | |
| PLN02423 | 245 | phosphomannomutase | 98.65 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 98.58 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 98.55 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.52 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 98.49 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.49 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 98.49 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 98.49 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 98.44 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 98.37 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 98.37 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 98.25 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 98.07 | |
| COG4229 | 229 | Predicted enolase-phosphatase [Energy production a | 98.06 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 98.03 | |
| PLN02580 | 384 | trehalose-phosphatase | 98.03 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 98.02 | |
| PRK08238 | 479 | hypothetical protein; Validated | 97.82 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 97.82 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 97.81 | |
| PLN03017 | 366 | trehalose-phosphatase | 97.81 | |
| PLN02151 | 354 | trehalose-phosphatase | 97.64 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 97.64 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.54 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 97.44 | |
| KOG2961 | 190 | consensus Predicted hydrolase (HAD superfamily) [G | 97.39 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 97.37 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 97.35 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 97.3 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 97.27 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 97.2 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 97.17 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 97.12 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 97.07 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 97.03 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 96.63 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 96.55 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 96.54 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 96.39 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 96.35 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 96.32 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 96.16 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 95.97 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 95.91 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 95.89 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 95.86 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 95.71 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 95.08 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 94.99 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 94.79 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 94.67 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 94.41 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 94.18 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 94.0 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 93.59 | |
| COG5663 | 194 | Uncharacterized conserved protein [Function unknow | 93.45 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 93.31 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 93.05 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 93.02 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 92.86 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 92.57 | |
| PF06437 | 408 | ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0 | 92.51 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 92.31 | |
| KOG2630 | 254 | consensus Enolase-phosphatase E-1 [Amino acid tran | 92.23 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 92.13 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 91.87 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 91.87 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 91.84 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 91.8 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 91.55 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 91.36 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 91.34 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 91.26 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 91.22 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 91.16 | |
| COG5083 | 580 | SMP2 Uncharacterized protein involved in plasmid m | 91.13 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 90.84 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 90.66 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 90.43 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 90.17 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 89.92 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 89.81 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 89.51 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 89.5 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 89.01 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 88.9 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 88.62 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 88.5 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 88.37 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 88.06 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 87.91 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 87.82 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 87.51 | |
| KOG2961 | 190 | consensus Predicted hydrolase (HAD superfamily) [G | 87.46 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 87.34 | |
| KOG2116 | 738 | consensus Protein involved in plasmid maintenance/ | 87.23 | |
| PF06189 | 264 | 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 | 87.13 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 86.38 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 85.6 | |
| COG3882 | 574 | FkbH Predicted enzyme involved in methoxymalonyl-A | 84.57 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 84.49 | |
| PLN02940 | 382 | riboflavin kinase | 84.36 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 84.31 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 83.82 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 82.56 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 82.25 | |
| KOG3189 | 252 | consensus Phosphomannomutase [Lipid transport and | 81.51 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 81.29 | |
| KOG4549 | 144 | consensus Magnesium-dependent phosphatase [General | 81.01 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 80.86 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 80.64 | |
| COG4850 | 373 | Uncharacterized conserved protein [Function unknow | 80.41 | |
| PF05761 | 448 | 5_nucleotid: 5' nucleotidase family; InterPro: IPR | 80.34 | |
| PLN02811 | 220 | hydrolase | 80.34 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 80.28 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 80.16 |
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-43 Score=314.50 Aligned_cols=258 Identities=58% Similarity=0.934 Sum_probs=235.4
Q ss_pred ccHHHHhhcCcEEEEecceeEEeCCeecCCHHHHHHHHHHCCCeEEEEeCCCCCCHHHHHHHHHHcCCC-CCcCcEEecH
Q 019928 74 KNADELIDSVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLT-VTEEEIFASS 152 (334)
Q Consensus 74 ~~~~~~~~~ik~viFDiDGTL~d~~~~~~~a~~aL~~L~~~G~~v~i~Tn~sgrs~~~~~~~l~~lGl~-~~~~~i~~~~ 152 (334)
+...+++.++++|+||+|||||.+++.+|++.+++..|++.|+.+.|+|||+.++++++.++++.+|+. +..++++++.
T Consensus 13 ~~~~e~l~~~DtfifDcDGVlW~g~~~ipGs~e~l~~L~~~gK~i~fvTNNStksr~~y~kK~~~lG~~~v~e~~i~ssa 92 (306)
T KOG2882|consen 13 EEARELLDSFDTFIFDCDGVLWLGEKPIPGSPEALNLLKSLGKQIIFVTNNSTKSREQYMKKFAKLGFNSVKEENIFSSA 92 (306)
T ss_pred HHHHHHHhhcCEEEEcCCcceeecCCCCCChHHHHHHHHHcCCcEEEEeCCCcchHHHHHHHHHHhCccccCcccccChH
Confidence 456778999999999999999999999999999999999999999999999999999999999999998 9999999999
Q ss_pred HHHHHHHHhCCCCCCcEEEEEeCcchHHHHHHcCCcccCCCCCCCcccccCCCcc-cCCCCCccEEEEEecCCCCHHHHH
Q 019928 153 FAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFL-MEHDKDVGAVVVGFDRYFNYYKVQ 231 (334)
Q Consensus 153 ~~~~~~l~~~~~~~~~~~~~~G~~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~vv~~~~~~~~~~~l~ 231 (334)
.+.+.|+++.. ..++++|++|.+++.++|+++|++...++++....--..+..+ ...+.+++||+++.|..++|.++.
T Consensus 93 ~~~a~ylk~~~-~~~k~Vyvig~~gi~~eL~~aG~~~~g~~~~~~~~~~~~~~~~~~~~d~~VgAVvvg~D~hfsy~KL~ 171 (306)
T KOG2882|consen 93 YAIADYLKKRK-PFGKKVYVIGEEGIREELDEAGFEYFGGGPDGKDTDGAKSFVLSIGLDPDVGAVVVGYDEHFSYPKLM 171 (306)
T ss_pred HHHHHHHHHhC-cCCCeEEEecchhhhHHHHHcCceeecCCCCcccccccccchhhcCCCCCCCEEEEecccccCHHHHH
Confidence 99999998877 4568999999999999999999998877666544411111111 122677999999999999999999
Q ss_pred HHHHhHHcCCCcEEEEecCCcccccccchhccccchHHHHhHhhcCCcccccCCCCHHHHHHHHHHhCCCCCcEEEEccC
Q 019928 232 YGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDR 311 (334)
Q Consensus 232 ~~~~~l~~~~g~~~i~tn~d~~~~~~~~~~~~~~g~~~~~i~~~~~~~~~~~gKP~~~~~~~~~~~lgi~~~evi~VGDs 311 (334)
.++..|+ ++++.|++||.|.+.|...+..++|.|+++.++..++++++.+.|||++.+++.+.++++++|++++||||+
T Consensus 172 kA~~yLq-nP~clflatn~D~~~p~~~~~~ipG~G~~v~av~~~t~R~P~v~GKP~~~m~~~l~~~~~i~psRt~mvGDR 250 (306)
T KOG2882|consen 172 KALNYLQ-NPGCLFLATNRDATTPPTPGVEIPGAGSFVAAVKFATGRQPIVLGKPSTFMFEYLLEKFNIDPSRTCMVGDR 250 (306)
T ss_pred HHHHHhC-CCCcEEEeccCccccCCCCCeeccCCccHHHHHHHHhcCCCeecCCCCHHHHHHHHHHcCCCcceEEEEccc
Confidence 9988886 799999999999999988999999999999999999999999999999999999999999999999999999
Q ss_pred chhHHHHHHHcCCcEEEEcccc
Q 019928 312 LDTDILFGQNGGCKTLLVLSGK 333 (334)
Q Consensus 312 ~~~DI~~a~~aG~~tv~V~tG~ 333 (334)
+++||..|++.|++|++|+||.
T Consensus 251 L~TDIlFG~~~G~~TLLvltGv 272 (306)
T KOG2882|consen 251 LDTDILFGKNCGFKTLLVLSGV 272 (306)
T ss_pred chhhhhHhhccCcceEEEecCc
Confidence 9999999999999999999995
|
|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >KOG1618 consensus Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >COG4229 Predicted enolase-phosphatase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >COG5663 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG4850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 334 | ||||
| 2cfs_A | 298 | Crystal Structure Of Human Pyridoxal 5'-Phosphate P | 3e-40 | ||
| 2cfr_A | 298 | Crystal Structure Of Human Pyridoxal 5'-Phosphate P | 7e-39 | ||
| 2oyc_A | 306 | Crystal Structure Of Human Pyridoxal Phosphate Phos | 1e-38 | ||
| 1zjj_A | 263 | Crystal Structure Of Hypothetical Protein Ph1952 Fr | 5e-32 | ||
| 3pdw_A | 266 | Crystal Structure Of Putative P-Nitrophenyl Phospha | 1e-27 | ||
| 3qgm_A | 268 | P-Nitrophenyl Phosphatase From Archaeoglobus Fulgid | 4e-25 | ||
| 1vjr_A | 271 | Crystal Structure Of 4-nitrophenylphosphatase (tm17 | 6e-25 | ||
| 1pw5_A | 253 | Putative Nagd Protein Length = 253 | 8e-25 | ||
| 1yv9_A | 264 | Crystal Structure Of A Had-Like Phosphatase From En | 2e-24 | ||
| 3epr_A | 264 | Crystal Structure Of Putative Had Superfamily Hydro | 5e-23 | ||
| 1wvi_A | 257 | Crystal Structure Of Putative Phosphatase From Stre | 3e-20 | ||
| 2c4n_A | 250 | Nagd From E.Coli K-12 Strain Length = 250 | 3e-20 | ||
| 1ydf_A | 257 | Crystal Structure Of A Had-like Phosphatase From St | 4e-20 | ||
| 1ys9_A | 254 | Crystal Sructure Of Phosphatase Spy1043 From Strept | 8e-20 | ||
| 2hx1_A | 284 | Crystal Structure Of Possible Sugar Phosphatase, Ha | 8e-12 | ||
| 2ho4_A | 259 | Crystal Structure Of Protein From Mouse Mm.236127 L | 4e-06 | ||
| 3hlt_A | 266 | The Crystal Structure Of Human Haloacid Dehalogenas | 6e-06 | ||
| 2w4m_A | 270 | The Crystal Structure Of Human N-Acetylneuraminic A | 1e-04 |
| >pdb|2CFS|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 | Back alignment and structure |
|
| >pdb|2CFR|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 | Back alignment and structure |
| >pdb|2OYC|A Chain A, Crystal Structure Of Human Pyridoxal Phosphate Phosphatase Length = 306 | Back alignment and structure |
| >pdb|1ZJJ|A Chain A, Crystal Structure Of Hypothetical Protein Ph1952 From Pyrococcus Horikoshii Ot3 Length = 263 | Back alignment and structure |
| >pdb|3PDW|A Chain A, Crystal Structure Of Putative P-Nitrophenyl Phosphatase From Bacillus Subtilis Length = 266 | Back alignment and structure |
| >pdb|3QGM|A Chain A, P-Nitrophenyl Phosphatase From Archaeoglobus Fulgidus Length = 268 | Back alignment and structure |
| >pdb|1VJR|A Chain A, Crystal Structure Of 4-nitrophenylphosphatase (tm1742) From Thermotoga Maritima At 2.40 A Resolution Length = 271 | Back alignment and structure |
| >pdb|1PW5|A Chain A, Putative Nagd Protein Length = 253 | Back alignment and structure |
| >pdb|1YV9|A Chain A, Crystal Structure Of A Had-Like Phosphatase From Enterococcus Faecalis V583 Length = 264 | Back alignment and structure |
| >pdb|3EPR|A Chain A, Crystal Structure Of Putative Had Superfamily Hydrolase From Streptococcus Agalactiae Length = 264 | Back alignment and structure |
| >pdb|1WVI|A Chain A, Crystal Structure Of Putative Phosphatase From Streptococcus Mutans Ua159 Length = 257 | Back alignment and structure |
| >pdb|2C4N|A Chain A, Nagd From E.Coli K-12 Strain Length = 250 | Back alignment and structure |
| >pdb|1YDF|A Chain A, Crystal Structure Of A Had-like Phosphatase From Streptococcus Pneumoniae Length = 257 | Back alignment and structure |
| >pdb|1YS9|A Chain A, Crystal Sructure Of Phosphatase Spy1043 From Streptococcus Pyogenes Length = 254 | Back alignment and structure |
| >pdb|2HX1|A Chain A, Crystal Structure Of Possible Sugar Phosphatase, Had Superfamily (Zp_00311070.1) From Cytophaga Hutchinsonii Atcc 33406 At 2.10 A Resolution Length = 284 | Back alignment and structure |
| >pdb|2HO4|A Chain A, Crystal Structure Of Protein From Mouse Mm.236127 Length = 259 | Back alignment and structure |
| >pdb|3HLT|A Chain A, The Crystal Structure Of Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 2 (Hdhd2) Length = 266 | Back alignment and structure |
| >pdb|2W4M|A Chain A, The Crystal Structure Of Human N-Acetylneuraminic Acid Phosphatase, Nanp Length = 270 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 | Back alignment and structure |
|---|
Score = 354 bits (911), Expect = e-123
Identities = 91/262 (34%), Positives = 142/262 (54%), Gaps = 16/262 (6%)
Query: 75 NADELIDSVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGK 134
+++ + +FDCDGV+W G++ + G PE L+ L GK +FV+NNS ++R +
Sbjct: 13 ALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNNSRRARPELAL 72
Query: 135 KFETLGL-TVTEEEIFASSFAAAAYLKSI---DFPKDKKVYVVGEDGILKELELAGFQYL 190
+F LG + E++F+S+ AA L+ V+V+G +G+ EL AG +
Sbjct: 73 RFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRAAGLRLA 132
Query: 191 GGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNR 250
G P G V AV+VG+D +F++ K++ +R +P CL +AT+R
Sbjct: 133 GDPSAG-----------DGAAPRVRAVLVGYDEHFSFAKLREACAHLR-DPECLLVATDR 180
Query: 251 DAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGD 310
D L+D G GS+ A ++ R+ LVVGKPS +M + + F I ++ MVGD
Sbjct: 181 DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSIDPARTLMVGD 240
Query: 311 RLDTDILFGQNGGCKTLLVLSG 332
RL+TDILFG G T+L L+G
Sbjct: 241 RLETDILFGHRCGMTTVLTLTG 262
|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Length = 263 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} Length = 268 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Length = 352 | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Length = 179 | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Length = 218 | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Length = 211 | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Length = 176 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Length = 267 | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Length = 260 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} Length = 240 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Length = 251 | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 210 | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Length = 234 | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Length = 240 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Length = 209 | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Length = 222 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Length = 240 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Length = 238 | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Length = 243 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 334 | |||
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 100.0 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 100.0 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 100.0 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 100.0 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 99.98 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 99.98 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 99.97 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 99.97 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 99.97 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 99.96 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 99.96 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 99.94 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 99.81 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 99.78 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.77 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 99.76 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 99.75 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 99.75 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 99.75 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 99.75 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 99.74 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 99.73 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 99.72 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 99.72 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 99.72 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 99.72 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 99.72 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 99.71 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 99.71 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 99.71 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 99.71 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 99.71 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 99.71 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 99.7 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 99.7 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 99.7 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 99.69 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 99.69 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.67 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 99.67 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 99.67 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 99.66 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 99.66 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 99.66 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 99.66 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 99.65 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 99.65 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 99.65 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 99.65 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 99.65 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 99.65 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 99.65 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 99.64 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 99.64 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 99.64 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 99.64 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 99.64 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 99.63 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 99.63 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 99.63 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 99.63 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 99.63 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 99.62 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 99.62 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 99.62 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 99.62 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 99.61 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 99.6 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 99.6 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 99.6 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 99.6 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 99.6 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 99.59 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 99.59 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 99.59 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 99.58 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 99.58 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 99.58 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 99.58 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 99.57 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 99.57 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 99.57 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 99.57 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.56 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 99.55 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.54 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 99.54 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 99.54 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 99.53 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 99.53 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 99.52 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 99.52 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 99.52 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 99.52 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 99.51 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 99.5 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 99.5 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 99.49 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 99.49 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.48 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 99.48 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.48 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 99.46 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 99.46 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 99.46 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 99.44 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.44 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.42 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 99.41 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.4 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 99.4 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 99.39 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 99.38 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 99.35 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 99.34 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 99.33 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 99.33 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 99.32 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 99.32 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 99.31 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.31 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 99.3 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 99.28 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 99.28 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 99.24 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 99.08 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.08 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 99.04 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.02 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 99.0 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 98.97 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 98.94 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 98.91 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 98.9 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 98.89 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 98.88 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 98.83 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 98.27 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 98.73 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 98.69 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 98.67 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.58 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 98.52 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 98.23 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 98.18 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 98.0 | |
| 2jc9_A | 555 | Cytosolic purine 5'-nucleotidase; cytosolic 5-prim | 97.11 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 96.89 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 96.65 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 96.03 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 96.01 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 95.5 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 95.46 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 93.75 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 93.64 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 93.49 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 92.68 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 92.4 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 92.28 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 91.66 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 90.6 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 90.6 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 90.34 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 90.09 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 89.93 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 89.36 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 89.07 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 89.05 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 88.99 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 88.57 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 88.22 | |
| 4g63_A | 470 | Cytosolic IMP-GMP specific 5'-nucleotidase; struct | 88.11 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 88.05 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 87.95 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 87.33 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 87.05 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 86.74 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 86.17 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 85.96 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 85.17 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 85.16 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 84.21 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 84.14 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 83.64 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 83.61 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 83.15 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 82.95 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 82.63 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 82.49 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 82.23 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 81.29 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 81.13 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 81.05 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 80.43 |
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=8e-35 Score=274.65 Aligned_cols=250 Identities=23% Similarity=0.274 Sum_probs=204.6
Q ss_pred hhcCcEEEEecceeEEeCCeecCCHHHHHHHHHHCCCeEEEEeCCCCCCHHHHHHHHH-HcCCCCCcCcEEecHHHHHHH
Q 019928 80 IDSVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFE-TLGLTVTEEEIFASSFAAAAY 158 (334)
Q Consensus 80 ~~~ik~viFDiDGTL~d~~~~~~~a~~aL~~L~~~G~~v~i~Tn~sgrs~~~~~~~l~-~lGl~~~~~~i~~~~~~~~~~ 158 (334)
+.+.++++||+||||+++.+.+|++.++|+.|++.|+++.++|||++++++++.++|. .+|++++++++++++.++..+
T Consensus 10 ~~~~~~~l~D~DGvl~~g~~~~p~a~~~l~~l~~~g~~~~~vTNn~~~~~~~~~~~l~~~lgi~~~~~~i~ts~~~~~~~ 89 (352)
T 3kc2_A 10 TSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYILLTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSL 89 (352)
T ss_dssp --CCEEEEECCBTTTEETTEECTTHHHHHHHHHHTTCCEEEECSCCSSCHHHHHHHHHHHHTSCCCGGGEECTTGGGGGG
T ss_pred hccCCEEEEECCCeeEcCCeeCcCHHHHHHHHHHCCCEEEEEeCCCCCCchHHHHHHHHhcCCCCChhhEeehHHHHHHH
Confidence 3568899999999999999999999999999999999999999999999999999997 699999999999999887766
Q ss_pred HHhCCCCCCcEEEEEeCcchHHHHHHcCCcccCCCCCCCccc-ccCC------C-------cccC-CCCCccEEEEEecC
Q 019928 159 LKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKI-ELKP------G-------FLME-HDKDVGAVVVGFDR 223 (334)
Q Consensus 159 l~~~~~~~~~~~~~~G~~~~~~~l~~~G~~~~~~~~~~~~~~-~~~~------~-------~~~~-~~~~~~~vv~~~~~ 223 (334)
+. .+++++++|.+++.+++++.|++.+..+.+...+. .+.| + ..++ .+..+++|+++.++
T Consensus 90 ~~-----~~~~v~viG~~~l~~~l~~~G~~~v~~~~d~~~~~~~~~p~~~l~~ee~~~~~d~ipD~~~~~v~AVvv~~Dp 164 (352)
T 3kc2_A 90 VN-----KYSRILAVGTPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDLTTKKFDAVLVFNDP 164 (352)
T ss_dssp TT-----TCSEEEEESSTTHHHHHHHHTCSEEEEHHHHHHHCGGGCTTCCCCHHHHHHHCCCCTTTTTSCCCEEEECSCC
T ss_pred Hh-----cCCEEEEECCHHHHHHHHhCCCeEecchhHhhhhcccccccccCCHHHHhhhccCcccccccCCCEEEEeCCC
Confidence 53 34789999999999999999998763221110000 0000 0 0111 13567999999999
Q ss_pred CCCHHHHHHHHHhHHc--------------CCCcEEEEecCCcccccccchhccccchHHHHhHh----hcCCc--cccc
Q 019928 224 YFNYYKVQYGTLCIRE--------------NPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVG----STQRE--PLVV 283 (334)
Q Consensus 224 ~~~~~~l~~~~~~l~~--------------~~g~~~i~tn~d~~~~~~~~~~~~~~g~~~~~i~~----~~~~~--~~~~ 283 (334)
..++.+++.+...++. .+++.+++||+|.+++......++|.|++..++.. ++|.+ ...+
T Consensus 165 ~d~~~~lq~~~d~L~s~~G~~~~~~~~~~~~~~~~~i~tN~D~~~~~~~~~~r~g~Ga~~~al~~~y~~~tg~~~~~~~~ 244 (352)
T 3kc2_A 165 HDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPIYFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTL 244 (352)
T ss_dssp SCHHHHHHHHHHHHTSBTTBTTCCCSCCCSSCSSCEEESCCCSEECCSSSSCEECHHHHHHHHHHHHHHHHSSCCCCEEC
T ss_pred cchHHHHHHHHHHHHhcCCCcCcccccccCCCCCeEEEECCCcccccCCCCcccCchHHHHHHHHHHHHhcCCCCCceEe
Confidence 9999999998888763 25789999999999887766668899998888776 57776 4789
Q ss_pred CCCCHHHHHHHHHHh----------------------CC-----CCCcEEEEccCchhHHHHHHHcCCcEEEEccccC
Q 019928 284 GKPSTFMMDYLANKF----------------------GI-----QKSQICMVGDRLDTDILFGQNGGCKTLLVLSGKW 334 (334)
Q Consensus 284 gKP~~~~~~~~~~~l----------------------gi-----~~~evi~VGDs~~~DI~~a~~aG~~tv~V~tG~~ 334 (334)
|||++.+|+++.+.+ |+ ++++++||||++.+||++|+++|+++|+|.+|.+
T Consensus 245 GKP~~~~y~~A~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VGD~~~~Di~~A~~aG~~ti~V~~G~~ 322 (352)
T 3kc2_A 245 GKPTKLTYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNPASDIIGAQNYGWNSCLVKTGVY 322 (352)
T ss_dssp STTCHHHHHHHHHHHHHHHHHHHC--------------CCTTTTTSSEEEEEESCTTTHHHHHHHHTCEEEECSSSSC
T ss_pred cCCCHHHHHHHHHHHHHHHHhhhcccccccccccccccccccCCCcceEEEEecCcHHHHHHHHHcCCEEEEEccCCC
Confidence 999999999987765 22 6799999999997799999999999999999964
|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 334 | ||||
| d1vjra_ | 261 | c.108.1.14 (A:) Hypothetical protein TM1742 {Therm | 3e-49 | |
| d1wvia_ | 253 | c.108.1.14 (A:) Putative phosphatase SMU.1415c {St | 6e-46 | |
| d1yv9a1 | 253 | c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En | 5e-43 | |
| d2c4na1 | 250 | c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId | 3e-41 | |
| d2fpwa1 | 161 | c.108.1.19 (A:3-163) Histidine biosynthesis bifunc | 2e-05 | |
| d2o2xa1 | 209 | c.108.1.19 (A:8-216) Hypothetical protein Mll2559 | 4e-04 | |
| d1qq5a_ | 245 | c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan | 9e-04 | |
| d1cr6a1 | 222 | c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal | 0.001 | |
| d2fi1a1 | 187 | c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str | 0.002 | |
| d2go7a1 | 204 | c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S | 0.002 | |
| d2f22a1 | 141 | a.213.1.2 (A:1-141) Hypothetical protein BH3987 {B | 0.004 |
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Length = 261 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NagD-like domain: Hypothetical protein TM1742 species: Thermotoga maritima [TaxId: 2336]
Score = 163 bits (413), Expect = 3e-49
Identities = 69/256 (26%), Positives = 124/256 (48%), Gaps = 24/256 (9%)
Query: 78 ELIDSVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFE 137
++D +E FI D DG + D L+ G E L+ L+ K KR VF TNNS+ + Y +K
Sbjct: 2 HVLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLR 61
Query: 138 TLGLTVTEEEIFASSFAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGG 197
+G+ V ++ + S A ++ +++++G + K E G
Sbjct: 62 NMGVDVPDDAVVTSGEITAEHML--KRFGRCRIFLLGTPQLKKVFEAYGH---------- 109
Query: 198 KKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLT 257
+ +++ VV+GFD+ Y +++ + + G +IAT+ D
Sbjct: 110 ----------VIDEENPDFVVLGFDKTLTYERLKKACILL--RKGKFYIATHPDINCPSK 157
Query: 258 DAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDIL 317
+ G M + ++ L+ GKP+ ++D ++ KFG+ K ++ MVGDRL TD+
Sbjct: 158 EGPVPDAGSIMAAIEASTGRKPDLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVK 217
Query: 318 FGQNGGCKTLLVLSGK 333
G+N G ++LVL+G+
Sbjct: 218 LGKNAGIVSILVLTGE 233
|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Length = 209 | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 334 | |||
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 100.0 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 100.0 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 100.0 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 99.77 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 99.76 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 99.75 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 99.75 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 99.73 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 99.73 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 99.72 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 99.72 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 99.72 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 99.71 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 99.7 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 99.69 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 99.69 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 99.68 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 99.68 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 99.68 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 99.68 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 99.67 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 99.67 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 99.6 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 99.6 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.53 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 99.53 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 99.51 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 99.46 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 99.43 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.39 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 99.38 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.29 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 99.27 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 99.26 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 99.24 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.24 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 99.2 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 99.17 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 99.16 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 99.07 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 99.01 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 98.99 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 98.8 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 98.8 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 98.78 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 98.7 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 98.66 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 98.39 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 97.9 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 97.87 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 96.86 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 96.57 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 93.82 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 93.22 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 93.13 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 91.82 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 88.89 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 87.0 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 86.87 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 86.77 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 86.47 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 85.72 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 85.58 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 85.33 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 83.81 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 83.4 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 81.03 |
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NagD-like domain: Putative phosphatase SMU.1415c species: Streptococcus mutans [TaxId: 1309]
Probab=100.00 E-value=4.2e-35 Score=262.58 Aligned_cols=228 Identities=28% Similarity=0.503 Sum_probs=197.6
Q ss_pred cCcEEEEecceeEEeCCeecCCHHHHHHHHHHCCCeEEEEeCCCCCCHHHHHHHH-HHcCCCCCcCcEEecHHHHHHHHH
Q 019928 82 SVETFIFDCDGVIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKF-ETLGLTVTEEEIFASSFAAAAYLK 160 (334)
Q Consensus 82 ~ik~viFDiDGTL~d~~~~~~~a~~aL~~L~~~G~~v~i~Tn~sgrs~~~~~~~l-~~lGl~~~~~~i~~~~~~~~~~l~ 160 (334)
.||+|+||+||||+++...+|.|.++++.|++.|++++++||++.+++..+.+++ ..+|++...++++++..+...++.
T Consensus 1 tyk~vlFDlDGTL~~~~~~i~~a~e~l~~l~~~g~~~~~~TN~s~~~~~~~~~~l~~~~~~~~~~~~i~~~~~~~~~~l~ 80 (253)
T d1wvia_ 1 TYKGYLIDLDGTIYKGKDRIPAGEDFVKRLQERQLPYILVTNNTTRTPEMVQEMLATSFNIKTPLETIYTATLATIDYMN 80 (253)
T ss_dssp CCCEEEEECBTTTEETTEECHHHHHHHHHHHHHTCCEEEEECCCSSCHHHHHHHHHHHHSCCCCGGGEEEHHHHHHHHHH
T ss_pred CcCEEEEcCcCceEECCCcCccHHHHHHHHHHCCCCEEEEeCCCCCCHHHHHHHHHhhcCccccccccccHHHHHHHHHH
Confidence 4899999999999999999999999999999999999999999999999999998 568999988999999999888887
Q ss_pred hCCCCCCcEEEEEeCcchHHHHHHcCCcccCCCCCCCcccccCCCcccCCCCCccEEEEEecCCCCHHHHHHHHHhHHcC
Q 019928 161 SIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIREN 240 (334)
Q Consensus 161 ~~~~~~~~~~~~~G~~~~~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vv~~~~~~~~~~~l~~~~~~l~~~ 240 (334)
.... ...++..+...+.+.+.+.+... ..+.+..++.+.+...++.+.........
T Consensus 81 ~~~~--~~~~~~~~~~~l~~~~~~~~~~~--------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-- 136 (253)
T d1wvia_ 81 DMKR--GKTAYVIGETGLKKAVAEAGYRE--------------------DSENPAYVVVGLDTNLTYEKLTLATLAIQ-- 136 (253)
T ss_dssp HHCC--CSEEEEESCHHHHHHHHHTTCEE--------------------CSSSCSEEEECCCTTCBHHHHHHHHHHHH--
T ss_pred Hhcc--CceeeeccchHHHHHHHHcCCcc--------------------cccccceEEEecCCCcCHHHHHHHhhhhh--
Confidence 6543 36788899999998898887754 23456788888888888877665554443
Q ss_pred CCcEEEEecCCcccccccchhccccchHHHHhHhhcCCcccccCCCCHHHHHHHHHHhCCCCCcEEEEccCchhHHHHHH
Q 019928 241 PGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDILFGQ 320 (334)
Q Consensus 241 ~g~~~i~tn~d~~~~~~~~~~~~~~g~~~~~i~~~~~~~~~~~gKP~~~~~~~~~~~lgi~~~evi~VGDs~~~DI~~a~ 320 (334)
.+..+|++|.+..++.... ...+.+.+...+...++.++..+|||+|.+|+.+++++|++|++|+||||++.+||++|+
T Consensus 137 ~~~~~i~tn~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~gKP~p~~~~~al~~l~i~~~~~~mIGDs~~~DI~gA~ 215 (253)
T d1wvia_ 137 KGAVFIGTNPDLNIPTERG-LLPGAGAILFLLEKATRVKPIIIGKPEAVIMNKALDRLGVKRHEAIMVGDNYLTDITAGI 215 (253)
T ss_dssp TTCEEEESCCCSEEEETTE-EEECHHHHHHHHHHHHCCCCEECSTTSHHHHHHHHHHHTSCGGGEEEEESCTTTTHHHHH
T ss_pred hccccccCCCCceeEcCCc-ccccCCcchhcccccccceeEEeccCCcccceehhhhccccccceEEEcCChHHHHHHHH
Confidence 5788999999987765443 466778889999999999999999999999999999999999999999999867999999
Q ss_pred HcCCcEEEEccccC
Q 019928 321 NGGCKTLLVLSGKW 334 (334)
Q Consensus 321 ~aG~~tv~V~tG~~ 334 (334)
++||++|+|+||.+
T Consensus 216 ~aG~~si~V~~G~~ 229 (253)
T d1wvia_ 216 KNDIATLLVTTGFT 229 (253)
T ss_dssp HTTCEEEEESSSSS
T ss_pred HCCCCEEEECCCCC
Confidence 99999999999964
|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|