Citrus Sinensis ID: 020094


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MLLRSSSTPILHSWLPQYSKDSSSSSSSNSSTEPELQVLQRTRSVSLSDDHHHHQSRKHKLLTTIYQRKEIRDSQMNKKGNIRALKPPPASHSHDHHQAKESSSRIQRLFSSSGLGEKLLKKDDDDEKEGCEVEDGGGSYVQTMVMGGGLGNNGGKICDGRGGGDAGGGGGGSGFSGSNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDAGDDEEEEQDNEESQHQTDHSHTSPPNFFHGASHHSPLTAAS
ccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHccccccHHHHHcccccccccHHHHHHHHccccccccccccccccccccccccccccccccccHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccHHccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccccEccc
mllrssstpilhswlpqyskdsssssssnsstepeLQVLQRtrsvslsddhhhhqsrkHKLLTTIYQRKEIrdsqmnkkgniralkpppashshdhhqakesSSRIQRLFsssglgekllkkddddekegcevedgggsYVQTMVMggglgnnggkicdgrgggdaggggggsgfsgsnnnysnnnhgssstdAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRailanpsdgniLSLYADLIWQAHKDASRAESYFDqavksapddcYVLASYAKFLwdagddeeeeqdneesqhqtdhshtsppnffhgashhspltaas
mllrssstpilhswlpqysKDSSSSSSSNSSTEPELQVLQRTRSVslsddhhhhqsrkhkllttiYQRKEIRDSQMNKKGNIRALKPPPASHShdhhqakesssriqrlfsssglgekllkkddddekegcevedgggsyVQTMVMGGGLGNNGGKICDGRGGGDAGGGGGGSGFSGSNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDAGDDEEEEQDNEESQHQTDHSHTSPPNFFHGASHHSPLTAAS
MLLRSSSTPILHSWLPQYSKDsssssssnssTEPELQVLQRTRSVSLSDDHHHHQSRKHKLLTTIYQRKEIRDSQMNKKGNIRALKPPPASHSHDHHQAKEsssriqrlfsssglgekllkkddddekegcevedgggSYVQTMVMggglgnnggkicdgrgggdaggggggsgfsgsnnnysnnnhgsssTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDAGddeeeeqdneeSQHQTDHSHTSPPNFFHGASHHSPLTAAS
*******************************************************************************************************************************************YVQTMVMGG**********************************************YYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDA*****************************************
MLLRSSSTPILHSW**************************************************************************************************************************GGSYVQTMVMGGGLGNNGGKICDGRGGGDAGGGGGGSGFSGSNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDAGDDEEEEQDNEESQHQTDHSHTSPPNFFHGASH********
MLLRSSSTPILHSWLP********************************************LLTTIYQRKEIRDSQMNKKGNIRALK*********************RLFSSSGLGEKLL*************EDGGGSYVQTMVMGGGLGNNGGKICDGRGGGDAGGGGGGSGFSGSNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAH********YFDQAVKSAPDDCYVLASYAKFLWDAG*********************SPPNFFHGA**********
*****************************************************************************************************************************************GSYVQTMVMGGGLGNNGGKICDGRGGGDAGGGGGGSGFSGSNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDAGDDEEEEQDNEESQHQT**SHTSPPNFFHGASHH*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLRSSSTPILHSWLPQYSKDSSSSSSSNSSTEPELQVLQRTRSVSLSDDHHHHQSRKHKLLTTIYQRKEIRDSQMNKKGNIRALKPPPASHSHDHHQAKESSSRIQRLFSSSGLGEKLLKKDDDDEKEGCEVEDGGGSYVQTMVMGGGLGNNGGKICDGRGGGDAGGGGGGSGFSGSNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDAGDDEEEEQDNEESQHQTDHSHTSPPNFFHGASHHSPLTAAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
255553177305 conserved hypothetical protein [Ricinus 0.888 0.963 0.514 9e-66
449436142319 PREDICTED: uncharacterized protein LOC10 0.921 0.956 0.498 4e-64
118486453304 unknown [Populus trichocarpa] 0.876 0.953 0.459 6e-60
225442971306 PREDICTED: uncharacterized protein LOC10 0.897 0.970 0.461 8e-57
224144206307 predicted protein [Populus trichocarpa] 0.888 0.957 0.447 4e-56
297743453289 unnamed protein product [Vitis vinifera] 0.864 0.989 0.464 6e-56
356519331315 PREDICTED: uncharacterized protein LOC10 0.903 0.949 0.456 4e-55
147823174306 hypothetical protein VITISV_012768 [Viti 0.906 0.980 0.448 5e-55
225445531288 PREDICTED: uncharacterized protein LOC10 0.845 0.972 0.437 8e-52
356555346282 PREDICTED: uncharacterized protein LOC10 0.812 0.953 0.410 9e-52
>gi|255553177|ref|XP_002517631.1| conserved hypothetical protein [Ricinus communis] gi|223543263|gb|EEF44795.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  256 bits (654), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 222/342 (64%), Gaps = 48/342 (14%)

Query: 1   MLLRSSSTPILHSWLPQYSKDSSSSSSSNSSTEPELQVLQRTRSVSLSDDHHHHQSRKHK 60
           MLLRSSSTPIL+SWLP          S  SS EPE Q L+RT+S+SL+       S   K
Sbjct: 1   MLLRSSSTPILNSWLPH---------SKESSPEPEFQALKRTKSISLTGSFRSQPSFDDK 51

Query: 61  LLTTIYQRKEIRDSQMNKKGNIRALKPPPASHSH-----DHHQAKES---SSRIQRLFSS 112
            +TT    + ++++ + K  N    +PP +         D    KE+   SSRIQR+FSS
Sbjct: 52  KVTT----QTLQETNLQKIKNASHGRPPQSKKQQCKKDSDDEIKKEAIVPSSRIQRMFSS 107

Query: 113 SGLGEKLLKKDDDDEKEGCEVEDGGGSYVQTMVMGGGLGNNGGKICDGRGGGDAGG---G 169
           SGLG ++    +DD+ +  E E+G G  +QT+V+GGG G+ GG    G  GG        
Sbjct: 108 SGLGGRVA---NDDDDDDDEKEEGRG--LQTLVVGGGSGSGGGGGVCGGSGGRRSDGGES 162

Query: 170 GGGSGFSGSNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEE 229
            GGS F           +G+ STDAYY+KMI A+PGNALLLGNYA+FLKEV+GDFAKAEE
Sbjct: 163 NGGSEF-----------YGNESTDAYYQKMISADPGNALLLGNYAKFLKEVKGDFAKAEE 211

Query: 230 LCGRAILANPSDGNILSLYADLIWQAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWD 289
            CGRAILANPSDGN+LS+YADLIWQ  KDA RAESYFDQAVK+AP+DC+VLASYA+FLWD
Sbjct: 212 FCGRAILANPSDGNVLSVYADLIWQKEKDAERAESYFDQAVKTAPEDCFVLASYARFLWD 271

Query: 290 AGDDEEEEQDNEESQHQTDHSHTSPPNFFHGASHHSPLTAAS 331
           A ++EE+E ++E+  H+T     SP  FF+G     PL AAS
Sbjct: 272 AEEEEEDEYESEDCPHETK----SPSGFFNGL----PLAAAS 305




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449436142|ref|XP_004135853.1| PREDICTED: uncharacterized protein LOC101208051 [Cucumis sativus] gi|449491043|ref|XP_004158782.1| PREDICTED: uncharacterized LOC101208051 [Cucumis sativus] Back     alignment and taxonomy information
>gi|118486453|gb|ABK95066.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225442971|ref|XP_002267739.1| PREDICTED: uncharacterized protein LOC100243938 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224144206|ref|XP_002325219.1| predicted protein [Populus trichocarpa] gi|222866653|gb|EEF03784.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297743453|emb|CBI36320.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519331|ref|XP_003528326.1| PREDICTED: uncharacterized protein LOC100784802 [Glycine max] Back     alignment and taxonomy information
>gi|147823174|emb|CAN73025.1| hypothetical protein VITISV_012768 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225445531|ref|XP_002285275.1| PREDICTED: uncharacterized protein LOC100257716 [Vitis vinifera] gi|297738966|emb|CBI28211.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555346|ref|XP_003545994.1| PREDICTED: uncharacterized protein LOC100801597 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
TAIR|locus:2016229305 AT1G80130 [Arabidopsis thalian 0.422 0.459 0.531 9.7e-46
TAIR|locus:2149314290 AT5G20190 "AT5G20190" [Arabido 0.404 0.462 0.581 4.7e-44
TAIR|locus:2127781238 AT4G32340 "AT4G32340" [Arabido 0.296 0.411 0.656 1.3e-31
TAIR|locus:2141030274 AT4G17940 "AT4G17940" [Arabido 0.290 0.350 0.562 1.5e-26
TAIR|locus:2197768310 TPR4 "tetratricopeptide repeat 0.283 0.303 0.473 4e-19
TAIR|locus:2060669536 AT2G29670 [Arabidopsis thalian 0.302 0.186 0.4 7.9e-15
TAIR|locus:2025067552 AT1G07280 "AT1G07280" [Arabido 0.302 0.181 0.39 8.4e-15
TAIR|locus:2075616515 AT3G47080 [Arabidopsis thalian 0.302 0.194 0.36 9.6e-12
TAIR|locus:2016229 AT1G80130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 398 (145.2 bits), Expect = 9.7e-46, Sum P(2) = 9.7e-46
 Identities = 75/141 (53%), Positives = 95/141 (67%)

Query:   192 TDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADL 251
             TD YY +MI++NPGN+LL GNYA+FLKEV+GD  KAEE C RAIL N +DGN+LSLYADL
Sbjct:   165 TDTYYREMIDSNPGNSLLTGNYAKFLKEVKGDMKKAEEYCERAILGNTNDGNVLSLYADL 224

Query:   252 IWQAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDAGXXXXXXXXXXXSQHQTDHS- 310
             I   H+D  RA SY+ QAVK +P+DCYV ASYA+FLWD              ++ +D + 
Sbjct:   225 ILHNHQDRQRAHSYYKQAVKMSPEDCYVQASYARFLWDVDEDEEDEALGEEEENLSDETG 284

Query:   311 HTSPPNFFHGASHHSPLTAAS 331
             H  P   F     H+ +TA+S
Sbjct:   285 HVPPTTMFRDFPQHTSITASS 305


GO:0016020 "membrane" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IMP
TAIR|locus:2149314 AT5G20190 "AT5G20190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127781 AT4G32340 "AT4G32340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141030 AT4G17940 "AT4G17940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197768 TPR4 "tetratricopeptide repeat 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060669 AT2G29670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025067 AT1G07280 "AT1G07280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075616 AT3G47080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-06
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 8e-05
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 1e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-04
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 6e-04
PHA00370297 PHA00370, III, attachment protein 0.001
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.003
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.003
pfam05268261 pfam05268, GP38, Phage tail fibre adhesin Gp38 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 50.5 bits (121), Expect = 3e-08
 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 195 YYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQ 254
           YYEK +E +P NA    N A    +  G + +A E   +A+  +P +           ++
Sbjct: 22  YYEKALELDPDNADAYYNLAAAYYK-LGKYEEALEDYEKALELDPDNAKAYYNLGLAYYK 80

Query: 255 AHKDASRAESYFDQAVKSAPD 275
             K    A   +++A++  P+
Sbjct: 81  LGKYE-EALEAYEKALELDPN 100


Length = 100

>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|164795 PHA00370, III, attachment protein Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|147458 pfam05268, GP38, Phage tail fibre adhesin Gp38 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 331
PRK15359144 type III secretion system chaperone protein SscB; 99.59
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.51
PRK10370198 formate-dependent nitrite reductase complex subuni 99.5
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.49
PRK15359144 type III secretion system chaperone protein SscB; 99.48
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.48
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.48
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.47
PRK11189296 lipoprotein NlpI; Provisional 99.46
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.45
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.43
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.43
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.42
PRK12370553 invasion protein regulator; Provisional 99.42
PRK12370553 invasion protein regulator; Provisional 99.41
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.4
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.4
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.38
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.37
PRK10370198 formate-dependent nitrite reductase complex subuni 99.37
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.36
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.35
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.35
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.35
KOG0553304 consensus TPR repeat-containing protein [General f 99.35
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.32
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.31
KOG1126638 consensus DNA-binding cell division cycle control 99.27
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.26
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.25
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.25
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.24
PRK11189 296 lipoprotein NlpI; Provisional 99.24
KOG1126638 consensus DNA-binding cell division cycle control 99.24
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.23
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.21
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.21
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.21
PRK11788389 tetratricopeptide repeat protein; Provisional 99.21
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.21
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.19
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.19
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.16
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.16
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.15
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.14
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.08
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.07
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.05
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.04
PLN02789 320 farnesyltranstransferase 99.04
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.03
KOG1125579 consensus TPR repeat-containing protein [General f 99.03
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.0
KOG0547606 consensus Translocase of outer mitochondrial membr 99.0
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.99
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.99
KOG2076 895 consensus RNA polymerase III transcription factor 98.99
KOG0547606 consensus Translocase of outer mitochondrial membr 98.96
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.95
KOG1125579 consensus TPR repeat-containing protein [General f 98.93
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.92
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.92
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.91
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.9
PLN02789320 farnesyltranstransferase 98.9
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.89
PRK14574 822 hmsH outer membrane protein; Provisional 98.88
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.88
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.87
PRK11906458 transcriptional regulator; Provisional 98.84
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.84
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.84
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.82
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.82
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.82
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.81
PRK10803263 tol-pal system protein YbgF; Provisional 98.79
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.79
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.76
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.75
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.75
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.75
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.73
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.72
PRK14574 822 hmsH outer membrane protein; Provisional 98.72
PRK15331165 chaperone protein SicA; Provisional 98.71
PF1337173 TPR_9: Tetratricopeptide repeat 98.7
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.69
KOG1129478 consensus TPR repeat-containing protein [General f 98.69
PF1337173 TPR_9: Tetratricopeptide repeat 98.69
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.66
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.66
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.64
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.63
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.62
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.62
KOG0553 304 consensus TPR repeat-containing protein [General f 98.61
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.59
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.57
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.56
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.56
PRK15331165 chaperone protein SicA; Provisional 98.55
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.54
KOG2003 840 consensus TPR repeat-containing protein [General f 98.54
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 98.54
KOG2003 840 consensus TPR repeat-containing protein [General f 98.53
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.53
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 98.49
PF12688120 TPR_5: Tetratrico peptide repeat 98.49
PRK11906458 transcriptional regulator; Provisional 98.48
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.48
PRK10803263 tol-pal system protein YbgF; Provisional 98.47
PF12688120 TPR_5: Tetratrico peptide repeat 98.47
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.45
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.43
KOG2076 895 consensus RNA polymerase III transcription factor 98.42
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.38
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.34
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.34
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 98.34
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.33
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.32
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.31
KOG1129478 consensus TPR repeat-containing protein [General f 98.28
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.28
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.28
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.27
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.26
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.25
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.24
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.22
KOG4234271 consensus TPR repeat-containing protein [General f 98.2
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.16
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.14
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.13
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.13
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.13
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.12
COG4700251 Uncharacterized protein conserved in bacteria cont 98.11
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.11
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 98.09
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.09
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.07
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.07
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.05
PF13512142 TPR_18: Tetratricopeptide repeat 98.03
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.02
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.01
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.96
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.96
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.96
PF1342844 TPR_14: Tetratricopeptide repeat 97.94
PF1342844 TPR_14: Tetratricopeptide repeat 97.93
PF1343134 TPR_17: Tetratricopeptide repeat 97.92
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.91
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.91
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.87
PLN03077 857 Protein ECB2; Provisional 97.86
PLN03218 1060 maturation of RBCL 1; Provisional 97.84
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.82
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.82
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.81
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.79
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.78
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.77
KOG4555175 consensus TPR repeat-containing protein [Function 97.76
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.76
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.76
PF1343134 TPR_17: Tetratricopeptide repeat 97.75
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.71
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.71
PLN03077 857 Protein ECB2; Provisional 97.68
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.67
PLN03218 1060 maturation of RBCL 1; Provisional 97.67
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.65
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.63
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.59
KOG4555175 consensus TPR repeat-containing protein [Function 97.57
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.57
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.55
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.55
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.54
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.52
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.43
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.43
PRK04841 903 transcriptional regulator MalT; Provisional 97.41
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.38
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.37
PRK04841 903 transcriptional regulator MalT; Provisional 97.35
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.34
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.32
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 97.25
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.22
PF13512142 TPR_18: Tetratricopeptide repeat 97.2
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.18
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.11
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.11
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.1
COG4700251 Uncharacterized protein conserved in bacteria cont 97.08
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.07
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.07
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.06
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.05
KOG4234271 consensus TPR repeat-containing protein [General f 97.04
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.99
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.98
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.94
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.89
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.89
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.81
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.8
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.76
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.76
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.75
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.74
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.74
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.69
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.68
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.68
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.66
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.58
KOG3785 557 consensus Uncharacterized conserved protein [Funct 96.57
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.55
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.55
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.55
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.49
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.45
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.39
KOG2471 696 consensus TPR repeat-containing protein [General f 96.38
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.36
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.35
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.34
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.33
COG5191 435 Uncharacterized conserved protein, contains HAT (H 96.31
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.26
KOG1585 308 consensus Protein required for fusion of vesicles 96.26
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.25
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 96.24
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.02
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 96.0
PRK10941269 hypothetical protein; Provisional 95.87
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.86
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.85
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.64
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.56
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.52
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 95.49
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.48
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 95.45
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.4
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.37
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.36
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.32
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.25
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 95.23
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.22
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.19
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.18
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.15
PRK10941269 hypothetical protein; Provisional 95.14
KOG1550 552 consensus Extracellular protein SEL-1 and related 95.05
KOG1310 758 consensus WD40 repeat protein [General function pr 95.02
COG4976 287 Predicted methyltransferase (contains TPR repeat) 95.02
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.88
KOG2471 696 consensus TPR repeat-containing protein [General f 94.86
KOG1586288 consensus Protein required for fusion of vesicles 94.8
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.77
COG3898 531 Uncharacterized membrane-bound protein [Function u 94.75
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.69
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 94.61
KOG4507 886 consensus Uncharacterized conserved protein, conta 94.56
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.54
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.47
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.41
KOG3364149 consensus Membrane protein involved in organellar 94.34
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.2
KOG1586288 consensus Protein required for fusion of vesicles 94.2
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 94.02
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 93.94
COG4976 287 Predicted methyltransferase (contains TPR repeat) 93.84
KOG1550 552 consensus Extracellular protein SEL-1 and related 93.67
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 93.59
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.5
COG5191 435 Uncharacterized conserved protein, contains HAT (H 93.36
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 93.14
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.99
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.96
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 92.95
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 92.87
COG2976207 Uncharacterized protein conserved in bacteria [Fun 92.75
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.53
PF1286294 Apc5: Anaphase-promoting complex subunit 5 92.52
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.36
KOG1585308 consensus Protein required for fusion of vesicles 92.32
KOG1258577 consensus mRNA processing protein [RNA processing 92.22
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 92.15
KOG2300 629 consensus Uncharacterized conserved protein [Funct 92.13
KOG1258 577 consensus mRNA processing protein [RNA processing 91.88
KOG1310 758 consensus WD40 repeat protein [General function pr 91.77
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 91.51
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 90.95
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 90.89
KOG4814 872 consensus Uncharacterized conserved protein [Funct 90.54
COG2912269 Uncharacterized conserved protein [Function unknow 90.39
KOG3364149 consensus Membrane protein involved in organellar 89.99
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.95
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.71
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.97
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 88.95
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 88.91
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 88.86
KOG0529 421 consensus Protein geranylgeranyltransferase type I 88.78
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.47
PF09986214 DUF2225: Uncharacterized protein conserved in bact 88.14
KOG2422 665 consensus Uncharacterized conserved protein [Funct 87.91
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 87.87
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 87.87
COG3629280 DnrI DNA-binding transcriptional activator of the 87.59
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 87.18
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.88
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 85.51
COG3898 531 Uncharacterized membrane-bound protein [Function u 85.41
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 85.33
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 84.44
KOG0529 421 consensus Protein geranylgeranyltransferase type I 84.0
COG1747 711 Uncharacterized N-terminal domain of the transcrip 83.9
KOG4814 872 consensus Uncharacterized conserved protein [Funct 83.83
PF1286294 Apc5: Anaphase-promoting complex subunit 5 83.56
COG2912269 Uncharacterized conserved protein [Function unknow 83.18
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 83.02
KOG2300 629 consensus Uncharacterized conserved protein [Funct 81.84
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 81.65
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 81.29
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 80.39
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
Probab=99.59  E-value=2.7e-14  Score=122.89  Aligned_cols=113  Identities=12%  Similarity=-0.012  Sum_probs=99.7

Q ss_pred             ccchHHHHHhCCCcHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHH
Q 020094          176 SGSNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQA  255 (331)
Q Consensus       176 ~~N~A~~y~s~gd~ekA~e~yerAL~~nP~n~~~l~nLA~~L~~~~gd~ekAee~~erALeldP~d~~al~~yA~ll~~~  255 (331)
                      ..+++..+...|++++|..+|++++..+|.++.++.++|.++.. .|++++|+.+|++|++++|+++.++++++.++.. 
T Consensus        27 ~~~~g~~~~~~g~~~~A~~~~~~al~~~P~~~~a~~~lg~~~~~-~g~~~~A~~~y~~Al~l~p~~~~a~~~lg~~l~~-  104 (144)
T PRK15359         27 VYASGYASWQEGDYSRAVIDFSWLVMAQPWSWRAHIALAGTWMM-LKEYTTAINFYGHALMLDASHPEPVYQTGVCLKM-  104 (144)
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHcCCCcHHHHHHHHHHHHH-HhhHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHH-
Confidence            45678888899999999999999999999999999999988665 8999999999999999999999999888888887 


Q ss_pred             cCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHc
Q 020094          256 HKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDA  290 (331)
Q Consensus       256 ~Gd~deA~~yfekAL~ldP~d~~vl~~LA~~L~~l  290 (331)
                      .|++++|+.+|++|++++|+++..+.+.+.+...+
T Consensus       105 ~g~~~eAi~~~~~Al~~~p~~~~~~~~~~~~~~~l  139 (144)
T PRK15359        105 MGEPGLAREAFQTAIKMSYADASWSEIRQNAQIMV  139 (144)
T ss_pred             cCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHH
Confidence            99999999999999999999999888888877654



>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.74
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.73
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.73
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.72
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.71
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.7
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.69
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.68
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.68
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.68
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.67
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.67
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.67
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.66
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.66
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.66
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.65
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.65
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.65
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.64
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.63
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.63
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.63
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.62
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.62
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.62
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.61
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.61
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.61
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.6
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.6
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.6
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.6
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.59
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.59
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.59
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.59
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.59
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.59
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.58
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.58
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.58
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.58
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.57
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.57
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.57
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.57
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.57
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.57
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.57
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.56
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.56
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.55
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.55
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.55
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.55
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.55
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.54
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.54
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.54
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.54
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.54
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.53
3k9i_A117 BH0479 protein; putative protein binding protein, 99.53
3u4t_A272 TPR repeat-containing protein; structural genomics 99.53
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.52
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.52
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.51
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.51
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.51
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.51
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.5
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.5
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.49
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.49
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.49
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.48
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.48
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.48
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.48
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.47
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.47
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.47
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.47
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.46
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.46
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.46
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.46
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.45
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.45
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.45
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.45
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.45
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.44
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.44
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.44
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.43
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.43
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.41
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.4
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.39
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.39
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.39
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.38
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.38
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.38
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.37
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.36
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.36
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.35
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.34
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.34
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.33
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.33
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.33
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.33
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.32
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.32
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.32
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.32
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.32
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.31
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.3
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.3
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.29
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.28
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.28
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.27
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.26
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.25
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.25
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.24
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.24
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.24
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.24
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 99.24
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.23
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.23
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.22
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.22
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.22
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.19
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.19
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 99.18
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.17
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.17
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.16
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.16
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 99.16
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.15
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.13
3k9i_A117 BH0479 protein; putative protein binding protein, 99.13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.13
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.13
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.11
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.08
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.07
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.05
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.05
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.03
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.03
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.02
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 99.0
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.99
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.97
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.96
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.95
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.95
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.95
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.94
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.9
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.9
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.88
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.88
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.87
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.87
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.84
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.83
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.82
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.8
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.79
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.75
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.74
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.74
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.74
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.72
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.66
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.66
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.63
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.54
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.51
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.49
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.47
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.44
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.43
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.37
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.33
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.31
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.29
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.28
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.24
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.21
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.2
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.11
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.06
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.01
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.97
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.95
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.95
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.9
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.89
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.89
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.77
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.71
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.64
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.43
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.33
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.19
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.14
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.99
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.98
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.94
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.78
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.72
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.56
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.51
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 96.3
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 95.81
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.7
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 94.68
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.65
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.27
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.87
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 93.73
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 93.4
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 92.46
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 91.91
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.4
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 90.17
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.65
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 86.54
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 86.17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 85.42
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 84.34
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 84.12
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 81.91
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.77  E-value=1.3e-17  Score=136.48  Aligned_cols=109  Identities=17%  Similarity=0.195  Sum_probs=104.2

Q ss_pred             cchHHHHHhCCCcHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHc
Q 020094          177 GSNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAH  256 (331)
Q Consensus       177 ~N~A~~y~s~gd~ekA~e~yerAL~~nP~n~~~l~nLA~~L~~~~gd~ekAee~~erALeldP~d~~al~~yA~ll~~~~  256 (331)
                      .|.+..|+..|+|++|+.+|+++|+++|+++.++.++|.++.. .|++++|++.|++||+++|+++.+|..+|.+++. +
T Consensus        17 ~~~G~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~-~~~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~-~   94 (126)
T 4gco_A           17 KNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTK-LMEFQRALDDCDTCIRLDSKFIKGYIRKAACLVA-M   94 (126)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH-TTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH-T
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHhhHHHh-hccHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHH-C
Confidence            4778999999999999999999999999999999999999776 9999999999999999999999999999999998 9


Q ss_pred             CCHHHHHHHHHHHHHhCCCCHHHHHHHHHHH
Q 020094          257 KDASRAESYFDQAVKSAPDDCYVLASYAKFL  287 (331)
Q Consensus       257 Gd~deA~~yfekAL~ldP~d~~vl~~LA~~L  287 (331)
                      |++++|+.+|+++++++|++..++..++.++
T Consensus        95 ~~~~~A~~~~~~al~l~P~~~~a~~~l~~~l  125 (126)
T 4gco_A           95 REWSKAQRAYEDALQVDPSNEEAREGVRNCL  125 (126)
T ss_dssp             TCHHHHHHHHHHHHHHCTTCHHHHHHHHHHC
T ss_pred             CCHHHHHHHHHHHHHHCcCCHHHHHHHHHhc
Confidence            9999999999999999999999999998775



>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 331
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-10
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-06
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 6e-07
d2onda1 308 a.118.8.7 (A:242-549) Cleavage stimulation factor 0.001
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-06
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-06
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 3e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-04
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: ImpE-like
superfamily: ImpE-like
family: ImpE-like
domain: Hypothetical protein VPA1032
species: Vibrio parahaemolyticus [TaxId: 670]
 Score = 57.0 bits (137), Expect = 5e-10
 Identities = 20/109 (18%), Positives = 38/109 (34%), Gaps = 1/109 (0%)

Query: 194 AYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIW 253
               + I+A+P +A L  ++   L    GDF +A+E   ++I   P      S    L+ 
Sbjct: 17  ELLIEAIKASPKDASLRSSFIELLCI-DGDFERADEQLMQSIKLFPEYLPGASQLRHLVK 75

Query: 254 QAHKDASRAESYFDQAVKSAPDDCYVLASYAKFLWDAGDDEEEEQDNEE 302
            A      A+      V    ++             + D E+  +   +
Sbjct: 76  AAQARKDFAQGAATAKVLGENEELTKSLVSFNLSMVSQDYEQVSELALQ 124


>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.67
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.65
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.65
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.63
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.61
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.59
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.58
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.55
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.55
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.55
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.5
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.5
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.49
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.46
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.45
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.45
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.45
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.36
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.35
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.17
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.15
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.12
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.11
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.08
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.06
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.06
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.05
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.05
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.04
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.02
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.01
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.99
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.99
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.94
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.91
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.85
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.72
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.69
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.53
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.51
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.37
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.24
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.14
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.89
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.84
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.71
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.64
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Hop
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.69  E-value=3.1e-16  Score=125.52  Aligned_cols=109  Identities=17%  Similarity=0.167  Sum_probs=102.8

Q ss_pred             chHHHHHhCCCcHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHcC
Q 020094          178 SNNNYSNNNHGSSSTDAYYEKMIEANPGNALLLGNYARFLKEVRGDFAKAEELCGRAILANPSDGNILSLYADLIWQAHK  257 (331)
Q Consensus       178 N~A~~y~s~gd~ekA~e~yerAL~~nP~n~~~l~nLA~~L~~~~gd~ekAee~~erALeldP~d~~al~~yA~ll~~~~G  257 (331)
                      +-|..++..|++++|+.+|+++|..+|+++.++.++|.++.. .+++++|+..|.++++++|+++.+|.+++.++.. +|
T Consensus         8 ~~g~~~~~~g~~~eAi~~~~~al~~~p~~~~~~~~~a~~~~~-~~~~~~A~~~~~~al~~~p~~~~~~~~~g~~~~~-~~   85 (117)
T d1elwa_           8 EKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAK-KGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEF-LN   85 (117)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH-HTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH-TT
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHhcCCcchhhhhcccccccc-cccccccchhhhhHHHhccchhhHHHHHHHHHHH-cc
Confidence            457889999999999999999999999999999999999766 9999999999999999999999999999998888 99


Q ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Q 020094          258 DASRAESYFDQAVKSAPDDCYVLASYAKFLW  288 (331)
Q Consensus       258 d~deA~~yfekAL~ldP~d~~vl~~LA~~L~  288 (331)
                      ++++|+.+|+++++++|++..++..++.+..
T Consensus        86 ~~~~A~~~~~~a~~~~p~~~~~~~~l~~l~~  116 (117)
T d1elwa_          86 RFEEAKRTYEEGLKHEANNPQLKEGLQNMEA  116 (117)
T ss_dssp             CHHHHHHHHHHHHTTCTTCHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHhC
Confidence            9999999999999999999999999887653



>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure